F331825

General Info

Members Datasets Scaffolds Average Seq Length
220 158 440 120

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100981139|Ga0070683_1009811392
Length 131
Sequence MATVRYLVDDVDAAAAFYVEHLGFEPAQRMGPAFSIVQRDDLSLWLAGPQSSAARPMPDGRQPGPGGWNRLVIEVDAIDEVVARLRAAGLAFRNDVVTGPGGKQVLVEDPAGNPVEIFEAAASRPGGRRRR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
145 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
156 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
157 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
158 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 10.45
Rhizosphere 85.45
Stem 0
Stem Tuber 0
Unclassified 13.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100981139 3300005329 Bacteria 811
2 Ga0070683_100436366 3300005329 Bacteria 1250
3 Ga0070683_100512204 3300005329 Bacteria 1146
4 Ga0068869_100736740 3300005334 Bacteria 843
5 Ga0068868_101005952 3300005338 Bacteria 763
6 Ga0070692_10136668 3300005345 Bacteria 1383
7 Ga0070692_10673842 3300005345 Bacteria 693
8 Ga0070675_100610074 3300005354 Bacteria 990
9 Ga0070673_100591913 3300005364 Bacteria 1011
10 Ga0070673_101793981 3300005364 Bacteria 581
11 Ga0070713_100850631 3300005436 Bacteria 876
12 Ga0070701_10673381 3300005438 Bacteria 693
13 Ga0070705_100238704 3300005440 Bacteria 1269
14 Ga0070705_101101863 3300005440 Bacteria 650
15 Ga0070700_101052100 3300005441 Bacteria 672
16 Ga0070694_100016967 3300005444 Bacteria 4594
17 Ga0070694_100247198 3300005444 Bacteria 1348
18 Ga0070678_100030977 3300005456 Bacteria 3684
19 Ga0070662_101032271 3300005457 Unclassified 704
20 Ga0070685_10856294 3300005466 Bacteria 674
21 Ga0070699_101863296 3300005518 Unclassified 550
22 Ga0070684_100077393 3300005535 Bacteria 2937
23 Ga0070672_101049920 3300005543 Bacteria 723
24 Ga0070686_100143011 3300005544 Bacteria 1667
25 Ga0070695_100430948 3300005545 Unclassified 1006
26 Ga0070696_100059367 3300005546 Bacteria 2673
27 Ga0070693_100297365 3300005547 Bacteria 1087
28 Ga0070665_100432482 3300005548 Bacteria 1325
29 Ga0070704_100690771 3300005549 Bacteria 904
30 Ga0068857_100297916 3300005577 Bacteria 1486
31 Ga0068857_100825759 3300005577 Archaea 886
32 Ga0068854_101172360 3300005578 Unclassified 687
33 Ga0070702_100564623 3300005615 Unclassified 847
34 Ga0068859_102528835 3300005617 Bacteria 565
35 Ga0068864_101228416 3300005618 Unclassified 748
36 Ga0068863_100239481 3300005841 Bacteria 1751
37 Ga0068858_100078266 3300005842 Bacteria 3073
38 Ga0081455_10012651 3300005937 Bacteria 8402
39 Ga0081539_10013906 3300005985 Bacteria 6014
40 Ga0075365_10097119 3300006038 Bacteria 2013
41 Ga0075428_101129200 3300006844 Bacteria 827
42 Ga0075433_10601067 3300006852 Bacteria 966
43 Ga0068865_100481848 3300006881 Bacteria 1031
44 Ga0068865_100527874 3300006881 Bacteria 988
45 Ga0075436_101139208 3300006914 Unclassified 588
46 Ga0097620_102529193 3300006931 Bacteria 565
47 Ga0105240_10431181 3300009093 Bacteria 1479
48 Ga0111539_11632878 3300009094 Unclassified 747
49 Ga0105245_11226909 3300009098 Bacteria 798
50 Ga0105245_11848504 3300009098 Bacteria 657
51 Ga0105247_10062349 3300009101 Bacteria 2313
52 Ga0114129_11520460 3300009147 Bacteria 822
53 Ga0105243_10018121 3300009148 Bacteria 5328
54 Ga0105243_10081341 3300009148 Bacteria 2644
55 Ga0105243_10924854 3300009148 Bacteria 869
56 Ga0105243_11955143 3300009148 Bacteria 620
57 Ga0105243_12730753 3300009148 Bacteria 534
58 Ga0105242_10037878 3300009176 Bacteria 3875
59 Ga0105242_10112932 3300009176 Bacteria 2319
60 Ga0105242_10539401 3300009176 Bacteria 1116
61 Ga0105248_10695935 3300009177 Bacteria 1147
62 Ga0105248_10740475 3300009177 Bacteria 1109
63 Ga0105249_10847378 3300009553 Bacteria 980
64 Ga0105239_10295581 3300010375 Bacteria 1824
65 Ga0105239_11058004 3300010375 Bacteria 934
66 Ga0105239_11580102 3300010375 Bacteria 758
67 Ga0105239_11749051 3300010375 Bacteria 720
68 Ga0105246_10371603 3300011119 Bacteria 1178
69 Ga0157373_11349489 3300013100 Unclassified 541
70 Ga0157370_10644000 3300013104 Bacteria 969
71 Ga0157378_10225731 3300013297 Bacteria 1782
72 Ga0157378_10773636 3300013297 Bacteria 984
73 Ga0157375_10161094 3300013308 Bacteria 2385
74 Ga0157375_11468680 3300013308 Bacteria 804
75 Ga0163163_10023621 3300014325 Bacteria 5837
76 Ga0157380_12254545 3300014326 Bacteria 609
77 Ga0157379_10395293 3300014968 Bacteria 1270
78 Ga0207710_10038405 3300025900 Bacteria 2117
79 Ga0207688_10148807 3300025901 Bacteria 1382
80 Ga0207707_10940255 3300025912 Bacteria 712
81 Ga0207660_10374526 3300025917 Bacteria 1144
82 Ga0207657_10804243 3300025919 Bacteria 727
83 Ga0207659_10358190 3300025926 Bacteria 1212
84 Ga0207687_10083011 3300025927 Bacteria 2319
85 Ga0207687_10465189 3300025927 Bacteria 1051
86 Ga0207700_10328203 3300025928 Bacteria 1327
87 Ga0207686_10052909 3300025934 Bacteria 2536
88 Ga0207686_10689380 3300025934 Bacteria 811
89 Ga0207686_10976107 3300025934 Bacteria 687
90 Ga0207709_10011565 3300025935 Bacteria 4869
91 Ga0207709_10320819 3300025935 Bacteria 1159
92 Ga0207709_10578867 3300025935 Bacteria 886
93 Ga0207709_11353184 3300025935 Bacteria 589
94 Ga0207709_11633485 3300025935 Bacteria 535
95 Ga0207704_10228936 3300025938 Bacteria 1381
96 Ga0207661_11306763 3300025944 Bacteria 666
97 Ga0207667_11091307 3300025949 Bacteria 782
98 Ga0207651_10942376 3300025960 Bacteria 770
99 Ga0207651_10972879 3300025960 Bacteria 758
100 Ga0207712_10295145 3300025961 Bacteria 1328
101 Ga0207677_10151763 3300026023 Bacteria 1788
102 Ga0207703_10176585 3300026035 Bacteria 1882
103 Ga0207703_10786741 3300026035 Unclassified 908
104 Ga0207708_10551721 3300026075 Bacteria 972
105 Ga0207708_10740110 3300026075 Bacteria 843
106 Ga0207648_10615042 3300026089 Bacteria 1002
107 Ga0207648_11591191 3300026089 Bacteria 614
108 Ga0207676_10234154 3300026095 Bacteria 1644
109 Ga0207674_10703169 3300026116 Bacteria 976
110 Ga0207683_10020297 3300026121 Bacteria 5682
111 Ga0207698_10281285 3300026142 Bacteria 1539
112 Ga0265327_10002246 3300031251 Bacteria 20928
113 Ga0307416_100566627 3300032002 Unclassified 1211
114 Ga0307415_100482676 3300032126 Unclassified 1079
115 Ga0373923_0641820 3300035111 Unclassified 525
116 Ga0373943_0901992 3300035170 Unclassified 528
117 Ga0373931_0487357 3300035691 Unclassified 793
118 Ga0373935_0811702 3300035692 Bacteria 691
119 Ga0395899_0023981 3300037312 Bacteria 4616
120 Ga0395900_0025314 3300037418 Bacteria 6076
121 Ga0395900_0030789 3300037418 Bacteria 5510
122 Ga0395900_0537311 3300037418 Bacteria 1115
123 Ga0395898_0007634 3300037466 Bacteria 11481
124 Ga0395898_0012006 3300037466 Bacteria 8968
125 Ga0395898_0040938 3300037466 Bacteria 4579
126 Ga0395905_0020332 3300037471 Bacteria 6289
127 Ga0395905_0179674 3300037471 Bacteria 1986
128 Ga0395905_0292046 3300037471 Bacteria 1517
129 Ga0395905_0662591 3300037471 Bacteria 946
130 Ga0395901_0004582 3300038443 Bacteria 13957
131 Ga0395901_0110126 3300038443 Bacteria 2891
132 Ga0395901_0136893 3300038443 Bacteria 2573
133 Ga0395901_0234201 3300038443 Bacteria 1917
134 Ga0436361_1184221 3300039447 Bacteria 5757
135 Ga0451853_1728423 3300041512 Bacteria 638
136 Ga0439450_051505 3300042008 Unclassified 979
137 Ga0450907_003676 3300042146 Bacteria 2704
138 Ga0451576_0046306 3300045051 Bacteria 4580
139 Ga0495603_0024749 3300046455 Bacteria 3632
140 Ga0495603_0499587 3300046455 Unclassified 697
141 Ga0495603_0575262 3300046455 Bacteria 645
142 Ga0495629_0254446 3300046459 Bacteria 1208
143 Ga0495641_0217498 3300046461 Unclassified 857
144 Ga0495651_0439957 3300046462 Unclassified 844
145 Ga0495582_0266542 3300046473 Bacteria 983
146 Ga0495582_0294610 3300046473 Unclassified 932
147 Ga0495662_0224460 3300046476 Unclassified 926
148 Ga0495584_0240802 3300046491 Bacteria 920
149 Ga0495594_0662366 3300046499 Bacteria 591
150 Ga0495596_0388471 3300046500 Bacteria 544
151 Ga0495607_0287739 3300046501 Bacteria 778
152 Ga0495630_0439943 3300046517 Unclassified 999
153 Ga0495644_0071602 3300046523 Bacteria 1303
154 Ga0495644_0147867 3300046523 Unclassified 899
155 Ga0495665_0052631 3300046531 Unclassified 2155
156 Ga0495586_0117189 3300046535 Bacteria 1486
157 Ga0495586_0553272 3300046535 Bacteria 664
158 Ga0495622_0456727 3300046557 Bacteria 548
159 Ga0495633_0130487 3300046558 Bacteria 1163
160 Ga0495667_0616707 3300046559 Bacteria 675
161 Ga0495656_0035358 3300046615 Bacteria 2052
162 Ga0495634_0364678 3300046642 Bacteria 863
163 Ga0495611_0267403 3300046648 Unclassified 791
164 Ga0495635_0214195 3300046663 Bacteria 1304
165 Ga0495659_0093277 3300046664 Bacteria 1158
166 Ga0495588_0244203 3300046674 Bacteria 947
167 Ga0495657_0423705 3300046675 Bacteria 781
168 Ga0495647_0284509 3300046681 Unclassified 742
169 Ga0495658_0077425 3300046683 Unclassified 1945
170 Ga0495624_0072752 3300046690 Bacteria 2138
171 Ga0495581_0018759 3300047315 Bacteria 4016
172 Ga0495604_0952688 3300047317 Bacteria 534
173 Ga0495636_0327950 3300047318 Bacteria 720
174 Ga0495676_0087731 3300047321 Bacteria 2336
175 Ga0495676_0939224 3300047321 Bacteria 553
176 Ga0495680_0212281 3300047322 Bacteria 1385
177 Ga0495680_0253520 3300047322 Bacteria 1247
178 Ga0495677_0216590 3300047445 Bacteria 746
179 Ga0495593_0204243 3300047673 Bacteria 993
180 Ga0495602_0298020 3300048088 Bacteria 1181
181 Ga0496102_0197485 3300048905 Bacteria 1896
182 Ga0496104_0187230 3300048907 Bacteria 1981
183 Ga0496104_0490545 3300048907 Bacteria 1140
184 Ga0496104_1022384 3300048907 Bacteria 730
185 Ga0496105_0107660 3300048908 Bacteria 2301
186 Ga0496105_0380592 3300048908 Bacteria 1123
187 Ga0496106_0240449 3300048909 Bacteria 1447
188 Ga0496107_0604143 3300048910 Bacteria 811
189 Ga0496107_0813014 3300048910 Bacteria 684
190 Ga0496108_0158195 3300048911 Bacteria 1957
191 Ga0496108_0256375 3300048911 Bacteria 1522
192 Ga0496109_0085396 3300048912 Bacteria 2913
193 Ga0496109_0701794 3300048912 Bacteria 949
194 Ga0496110_0003447 3300048913 Bacteria 12110
195 Ga0496110_0353976 3300048913 Bacteria 1338
196 Ga0496111_0020033 3300048914 Bacteria 4654
197 Ga0496111_0114173 3300048914 Bacteria 1991
198 Ga0496112_0359636 3300048915 Bacteria 1398
199 Ga0496112_1877254 3300048915 Bacteria 511
200 Ga0496113_0238281 3300048916 Bacteria 1451
201 Ga0496114_0018789 3300048917 Bacteria 5594
202 Ga0496114_0049776 3300048917 Bacteria 3487
203 Ga0496114_1388007 3300048917 Unclassified 590
204 Ga0501202_232304 3300049652 Bacteria 514
205 Ga0501221_107510 3300049704 Bacteria 699
206 nmdc:mga03n38_840475_c1 3300050490 Bacteria 536
207 nmdc:mga0yw44_482267_c1 3300050492 Bacteria 841
208 nmdc:mga0qj67_386344_c1 3300050509 Bacteria 1130
209 nmdc:mga08y16_107123_c1 3300050511 Bacteria 2909
210 nmdc:mga08y16_1617856_c1 3300050511 Unclassified 605
211 nmdc:mga08y16_533416_c1 3300050511 Bacteria 1189
212 nmdc:mga0n895_78194_c1 3300050512 Bacteria 3292
213 nmdc:mga08x19_1022218_c1 3300050514 Unclassified 587
214 nmdc:mga0sz30_23001_c1 3300050516 Bacteria 2532
215 Ga0495601_0122622 3300053077 Bacteria 1689
216 Ga0495595_0470068 3300053084 Bacteria 640
217 Ga0500641_0021694 3300053096 Bacteria 2452
218 Ga0500577_0234932 3300053142 Bacteria 795
219 Ga0500588_0416080 3300053146 Bacteria 512
220 Ga0500645_184467 3300053730 Bacteria 567
221 Ga0070683_100981139
222 Ga0070683_100436366
223 Ga0070683_100512204
224 Ga0068869_100736740
225 Ga0068868_101005952
226 Ga0070692_10136668
227 Ga0070692_10673842
228 Ga0070675_100610074
229 Ga0070673_100591913
230 Ga0070673_101793981
231 Ga0070713_100850631
232 Ga0070701_10673381
233 Ga0070705_100238704
234 Ga0070705_101101863
235 Ga0070700_101052100
236 Ga0070694_100016967
237 Ga0070694_100247198
238 Ga0070678_100030977
239 Ga0070662_101032271
240 Ga0070685_10856294
241 Ga0070699_101863296
242 Ga0070684_100077393
243 Ga0070672_101049920
244 Ga0070686_100143011
245 Ga0070695_100430948
246 Ga0070696_100059367
247 Ga0070693_100297365
248 Ga0070665_100432482
249 Ga0070704_100690771
250 Ga0068857_100297916
251 Ga0068857_100825759
252 Ga0068854_101172360
253 Ga0070702_100564623
254 Ga0068859_102528835
255 Ga0068864_101228416
256 Ga0068863_100239481
257 Ga0068858_100078266
258 Ga0081455_10012651
259 Ga0081539_10013906
260 Ga0075365_10097119
261 Ga0075428_101129200
262 Ga0075433_10601067
263 Ga0068865_100481848
264 Ga0068865_100527874
265 Ga0075436_101139208
266 Ga0097620_102529193
267 Ga0105240_10431181
268 Ga0111539_11632878
269 Ga0105245_11226909
270 Ga0105245_11848504
271 Ga0105247_10062349
272 Ga0114129_11520460
273 Ga0105243_10018121
274 Ga0105243_10081341
275 Ga0105243_10924854
276 Ga0105243_11955143
277 Ga0105243_12730753
278 Ga0105242_10037878
279 Ga0105242_10112932
280 Ga0105242_10539401
281 Ga0105248_10695935
282 Ga0105248_10740475
283 Ga0105249_10847378
284 Ga0105239_10295581
285 Ga0105239_11058004
286 Ga0105239_11580102
287 Ga0105239_11749051
288 Ga0105246_10371603
289 Ga0157373_11349489
290 Ga0157370_10644000
291 Ga0157378_10225731
292 Ga0157378_10773636
293 Ga0157375_10161094
294 Ga0157375_11468680
295 Ga0163163_10023621
296 Ga0157380_12254545
297 Ga0157379_10395293
298 Ga0207710_10038405
299 Ga0207688_10148807
300 Ga0207707_10940255
301 Ga0207660_10374526
302 Ga0207657_10804243
303 Ga0207659_10358190
304 Ga0207687_10083011
305 Ga0207687_10465189
306 Ga0207700_10328203
307 Ga0207686_10052909
308 Ga0207686_10689380
309 Ga0207686_10976107
310 Ga0207709_10011565
311 Ga0207709_10320819
312 Ga0207709_10578867
313 Ga0207709_11353184
314 Ga0207709_11633485
315 Ga0207704_10228936
316 Ga0207661_11306763
317 Ga0207667_11091307
318 Ga0207651_10942376
319 Ga0207651_10972879
320 Ga0207712_10295145
321 Ga0207677_10151763
322 Ga0207703_10176585
323 Ga0207703_10786741
324 Ga0207708_10551721
325 Ga0207708_10740110
326 Ga0207648_10615042
327 Ga0207648_11591191
328 Ga0207676_10234154
329 Ga0207674_10703169
330 Ga0207683_10020297
331 Ga0207698_10281285
332 Ga0265327_10002246
333 Ga0307416_100566627
334 Ga0307415_100482676
335 Ga0373923_0641820
336 Ga0373943_0901992
337 Ga0373931_0487357
338 Ga0373935_0811702
339 Ga0395899_0023981
340 Ga0395900_0025314
341 Ga0395900_0030789
342 Ga0395900_0537311
343 Ga0395898_0007634
344 Ga0395898_0012006
345 Ga0395898_0040938
346 Ga0395905_0020332
347 Ga0395905_0179674
348 Ga0395905_0292046
349 Ga0395905_0662591
350 Ga0395901_0004582
351 Ga0395901_0110126
352 Ga0395901_0136893
353 Ga0395901_0234201
354 Ga0436361_1184221
355 Ga0451853_1728423
356 Ga0439450_051505
357 Ga0450907_003676
358 Ga0451576_0046306
359 Ga0495603_0024749
360 Ga0495603_0499587
361 Ga0495603_0575262
362 Ga0495629_0254446
363 Ga0495641_0217498
364 Ga0495651_0439957
365 Ga0495582_0266542
366 Ga0495582_0294610
367 Ga0495662_0224460
368 Ga0495584_0240802
369 Ga0495594_0662366
370 Ga0495596_0388471
371 Ga0495607_0287739
372 Ga0495630_0439943
373 Ga0495644_0071602
374 Ga0495644_0147867
375 Ga0495665_0052631
376 Ga0495586_0117189
377 Ga0495586_0553272
378 Ga0495622_0456727
379 Ga0495633_0130487
380 Ga0495667_0616707
381 Ga0495656_0035358
382 Ga0495634_0364678
383 Ga0495611_0267403
384 Ga0495635_0214195
385 Ga0495659_0093277
386 Ga0495588_0244203
387 Ga0495657_0423705
388 Ga0495647_0284509
389 Ga0495658_0077425
390 Ga0495624_0072752
391 Ga0495581_0018759
392 Ga0495604_0952688
393 Ga0495636_0327950
394 Ga0495676_0087731
395 Ga0495676_0939224
396 Ga0495680_0212281
397 Ga0495680_0253520
398 Ga0495677_0216590
399 Ga0495593_0204243
400 Ga0495602_0298020
401 Ga0496102_0197485
402 Ga0496104_0187230
403 Ga0496104_0490545
404 Ga0496104_1022384
405 Ga0496105_0107660
406 Ga0496105_0380592
407 Ga0496106_0240449
408 Ga0496107_0604143
409 Ga0496107_0813014
410 Ga0496108_0158195
411 Ga0496108_0256375
412 Ga0496109_0085396
413 Ga0496109_0701794
414 Ga0496110_0003447
415 Ga0496110_0353976
416 Ga0496111_0020033
417 Ga0496111_0114173
418 Ga0496112_0359636
419 Ga0496112_1877254
420 Ga0496113_0238281
421 Ga0496114_0018789
422 Ga0496114_0049776
423 Ga0496114_1388007
424 Ga0501202_232304
425 Ga0501221_107510
426 nmdc:mga03n38_840475_c1
427 nmdc:mga0yw44_482267_c1
428 nmdc:mga0qj67_386344_c1
429 nmdc:mga08y16_107123_c1
430 nmdc:mga08y16_1617856_c1
431 nmdc:mga08y16_533416_c1
432 nmdc:mga0n895_78194_c1
433 nmdc:mga08x19_1022218_c1
434 nmdc:mga0sz30_23001_c1
435 Ga0495601_0122622
436 Ga0495595_0470068
437 Ga0500641_0021694
438 Ga0500577_0234932
439 Ga0500588_0416080
440 Ga0500645_184467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

117

0.84

PF18029

Glyoxalase_6

Glyoxalase-like domain

2

118

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.841 1 115
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8318 2 115
2i7r-assembly1.cif.gz_B conserved domain protein 0.8236 1 115
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8142 1 115
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.81 1 115
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9334 64 111 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8881 63 115 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8611 64 112 3.30.720.110
4huzA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8515 64 113 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8479 64 111 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A535TUI6-F1-model_v4 VOC family protein 0.9787 61 115
AF-A0A836QFY2-F1-model_v4 Methylmalonyl-CoA epimerase 0.973 63 115
AF-A0A5R2MZ14-F1-model_v4 VOC family protein 0.9693 65 115
AF-A0A495K2E6-F1-model_v4 merged 0.9679 2 115
AF-A0A2D9TB96-F1-model_v4 VOC domain-containing protein 0.9662 61 115

Map