F331742

General Info

Members Datasets Scaffolds Average Seq Length
220 161 207 202

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10215864|rootH1_102158642
Length 231
Sequence MTAKRRGRGVAPAPGFCDTGAMTKIAQGTLTPLFVSEVYRADLGPELGEAFIEDLDDTCRAIADEDEAGQGWSQQKGYLGYTSYASLNDLPARAEVFARLKKKLDAHVAAFAEALEYDLHGRKLKLDSLWINVLEHLGTHSGHIHPHSVISGTFYVAIPDGASALRFEDPRLPQMMAAPARKPDARKDRQTFVSMTPRPGTLLLWESYLRHEVPINLGEDVRISVSFNYGY

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
4 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
5 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
8 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
9 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
10 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
11 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
12 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
13 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
54 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
103 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
107 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
110 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
111 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
112 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
147 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
151 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
152 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
159 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.18
Metatranscriptomes 0.91
Isolates 5.91

Biome Distribution

Category Percentage (%)
Aerial Root 1.36
Bulb 0
Endosphere 29.55
Nodule 0
Rhizoplane 2.27
Rhizosphere 54.09
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000096 3300002774 Bacteria 50476
2 JGI25151J46595_10013844 3300003187 Bacteria 3617
3 JGI25153J46596_10000028 3300003215 Bacteria 209842
4 rootH2_10001159 3300003320 Bacteria 3095
5 rootH2_10038161 3300003320 Bacteria 4632
6 rootL2_10083079 3300003322 Bacteria 1993
7 rootL2_10087965 3300003322 Bacteria 1801
8 rootL2_10152799 3300003322 Bacteria 1611
9 rootH1_10000381 3300003323 Bacteria 4257
10 rootH1_10215864 3300003323 Bacteria 1532
11 Ga0055526_1001386 3300003771 Bacteria 17220
12 Ga0055526_1035458 3300003771 Bacteria 1343
13 Ga0055537_1001351 3300003773 Bacteria 9918
14 Ga0055537_1002843 3300003773 Bacteria 5550
15 Ga0055524_1001543 3300003775 Bacteria 13030
16 Ga0055536_1075157 3300003781 Bacteria 655
17 Ga0055530_10000082 3300003791 Bacteria 81812
18 Ga0055530_10000596 3300003791 Bacteria 31254
19 Ga0055530_10014546 3300003791 Bacteria 2615
20 Ga0055540_1000927 3300003792 Bacteria 19158
21 Ga0055531_10000012 3300003794 Bacteria 191187
22 Ga0055531_10005292 3300003794 Bacteria 7572
23 Ga0055531_10020916 3300003794 Bacteria 2564
24 Ga0055531_10021358 3300003794 Bacteria 2514
25 Ga0065165_1002910 3300005262 Bacteria 13124
26 Ga0065165_1015143 3300005262 Bacteria 2955
27 Ga0065707_10708117 3300005295 Bacteria 636
28 Ga0070680_100083374 3300005336 Bacteria 2640
29 Ga0070660_100011886 3300005339 Bacteria 6207
30 Ga0070692_10001945 3300005345 Bacteria 7819
31 Ga0070668_100041847 3300005347 Bacteria 3510
32 Ga0070659_100003828 3300005366 Bacteria 10734
33 Ga0070678_100151059 3300005456 Bacteria 1871
34 Ga0070681_10451700 3300005458 Bacteria 1197
35 Ga0070679_100000001 3300005530 Bacteria 764811
36 Ga0070679_100093471 3300005530 Bacteria 2995
37 Ga0070696_100015319 3300005546 Bacteria 5148
38 Ga0070665_100073361 3300005548 Bacteria 3428
39 Ga0068854_100006158 3300005578 Bacteria 7615
40 Ga0068854_100007747 3300005578 Bacteria 6866
41 Ga0068858_100213717 3300005842 Bacteria 1825
42 Ga0075366_10061759 3300006195 Bacteria 2227
43 Ga0097621_100000784 3300006237 Bacteria 22308
44 Ga0068871_100020532 3300006358 Bacteria 5062
45 Ga0068871_100099817 3300006358 Bacteria 2430
46 Ga0068871_100213943 3300006358 Bacteria 1668
47 Ga0105240_10000528 3300009093 Bacteria 70421
48 Ga0105240_10266163 3300009093 Bacteria 1976
49 Ga0105245_10004043 3300009098 Bacteria 13041
50 Ga0105248_10014353 3300009177 Bacteria 8717
51 Ga0105248_11793362 3300009177 Unclassified 696
52 Ga0105239_10296418 3300010375 Bacteria 1821
53 Ga0157371_10299009 3300013102 Bacteria 1165
54 Ga0157370_10176795 3300013104 Bacteria 1984
55 Ga0157369_10004779 3300013105 Bacteria 15925
56 Ga0157369_10953921 3300013105 Bacteria 879
57 Ga0157378_10153931 3300013297 Unclassified 2144
58 Ga0157378_11335314 3300013297 Bacteria 759
59 Ga0157379_10017002 3300014968 Bacteria 6402
60 Ga0183365_10001 3300015684 Bacteria 2090444
61 Ga0183363_1004 3300015690 Bacteria 416766
62 Ga0206354_10325876 3300020081 Bacteria 7781
63 Ga0206353_11447746 3300020082 Bacteria 11145
64 Ga0213876_10001309 3300021384 Bacteria 15644
65 Ga0207425_1000005 3300025245 Bacteria 900502
66 Ga0207425_1019374 3300025245 Bacteria 1465
67 Ga0209646_1007620 3300025246 Bacteria 1759
68 Ga0209677_118348 3300025253 Bacteria 854
69 Ga0209129_1001276 3300025258 Bacteria 14388
70 Ga0209565_1000030 3300025263 Bacteria 325058
71 Ga0209565_1000056 3300025263 Bacteria 200189
72 Ga0209676_1003020 3300025292 Bacteria 10926
73 Ga0209676_1009518 3300025292 Bacteria 4182
74 Ga0209025_1000464 3300025294 Bacteria 79341
75 Ga0209564_1000899 3300025295 Bacteria 39101
76 Ga0209564_1009325 3300025295 Bacteria 4690
77 Ga0209758_1000002 3300025297 Bacteria 1400310
78 Ga0209758_1005806 3300025297 Bacteria 9251
79 Ga0209758_1102439 3300025297 Bacteria 811
80 Ga0209050_1000005 3300025298 Bacteria 1557793
81 Ga0209050_1000039 3300025298 Bacteria 410069
82 Ga0209050_1012485 3300025298 Bacteria 3889
83 Ga0209050_1018462 3300025298 Bacteria 2708
84 Ga0209050_1023639 3300025298 Bacteria 2154
85 Ga0209050_1027669 3300025298 Bacteria 1862
86 Ga0209256_1000046 3300025299 Bacteria 325040
87 Ga0209051_1002826 3300025303 Bacteria 11966
88 Ga0209257_1000051 3300025304 Bacteria 434166
89 Ga0209257_1000533 3300025304 Bacteria 66037
90 Ga0209257_1003535 3300025304 Bacteria 13287
91 Ga0209257_1003538 3300025304 Bacteria 13285
92 Ga0209257_1017180 3300025304 Bacteria 2870
93 Ga0209257_1023326 3300025304 Bacteria 2178
94 Ga0207707_10173038 3300025912 Bacteria 1887
95 Ga0207695_10049660 3300025913 Bacteria 4420
96 Ga0207660_10001259 3300025917 Bacteria 16985
97 Ga0207657_10018088 3300025919 Bacteria 6743
98 Ga0207652_10000001 3300025921 Bacteria 1006643
99 Ga0207652_10000002 3300025921 Bacteria 878035
100 Ga0207687_10006338 3300025927 Bacteria 7820
101 Ga0207690_10003057 3300025932 Bacteria 10081
102 Ga0207686_10196773 3300025934 Unclassified 1441
103 Ga0207711_10082643 3300025941 Bacteria 2808
104 Ga0207667_10536020 3300025949 Bacteria 1185
105 Ga0207668_10031465 3300025972 Bacteria 3495
106 Ga0207640_10007471 3300025981 Bacteria 6037
107 Ga0207640_10011348 3300025981 Bacteria 5043
108 Ga0207640_10811373 3300025981 Bacteria 811
109 Ga0207677_10079205 3300026023 Bacteria 2349
110 Ga0207639_10395917 3300026041 Bacteria 1243
111 Ga0207683_10125468 3300026121 Bacteria 2307
112 Ga0268266_10227598 3300028379 Bacteria 1716
113 Ga0265324_10104685 3300029957 Bacteria 961
114 Ga0265332_10039805 3300031238 Bacteria 2036
115 Ga0265325_10027723 3300031241 Bacteria 3059
116 Ga0265331_10133117 3300031250 Unclassified 1133
117 Ga0265313_10001152 3300031595 Bacteria 25241
118 Ga0265313_10001905 3300031595 Bacteria 18928
119 Ga0265314_10114905 3300031711 Unclassified 1704
120 Ga0316578_10022110 3300031728 Bacteria 3541
121 Ga0307412_10003755 3300031911 Bacteria 8441
122 Ga0307412_10006182 3300031911 Bacteria 6750
123 Ga0307411_11096449 3300032005 Bacteria 717
124 Ga0373941_0143935 3300035115 Bacteria 869
125 Ga0316584_0095813 3300036712 Bacteria 2221
126 Ga0395905_0002126 3300037471 Bacteria 22466
127 Ga0395905_0218539 3300037471 Bacteria 1784
128 Ga0395905_0485586 3300037471 Bacteria 1135
129 Ga0400483_008718 3300039062 Bacteria 1954
130 Ga0436365_0429708 3300039437 Bacteria 77395
131 Ga0436363_0028904 3300039450 Bacteria 1408
132 Ga0439436_0027194 3300041404 Bacteria 1674
133 Ga0439436_0053562 3300041404 Bacteria 1136
134 Ga0439461_0000030 3300041410 Bacteria 18085
135 Ga0439465_0004752 3300041413 Bacteria 4377
136 Ga0451791_0256703 3300041451 Bacteria 1053
137 Ga0439431_0000296 3300041997 Bacteria 10267
138 Ga0439442_005337 3300042002 Bacteria 2571
139 Ga0439445_0012490 3300042004 Bacteria 2042
140 Ga0439432_000137 3300042006 Bacteria 24708
141 Ga0439452_013545 3300042010 Bacteria 2285
142 Ga0439462_0000624 3300042015 Bacteria 7091
143 Ga0439446_0030849 3300042156 Bacteria 1550
144 Ga0439434_0000185 3300042435 Bacteria 17001
145 Ga0466969_0040049 3300044656 Bacteria 2349
146 Ga0466966_0013570 3300044684 Bacteria 5392
147 Ga0466961_0035982 3300044693 Bacteria 3178
148 Ga0466963_0079094 3300044694 Bacteria 2224
149 Ga0466971_0003531 3300044719 Bacteria 6683
150 Ga0466970_0062749 3300044765 Bacteria 1992
151 Ga0466957_0061345 3300044842 Bacteria 2307
152 Ga0466959_0020380 3300045049 Bacteria 4884
153 Ga0466958_0018594 3300045836 Bacteria 4035
154 Ga0495648_0029401 3300046524 Bacteria 3648
155 Ga0495622_0013978 3300046557 Bacteria 3725
156 Ga0495668_0245198 3300046616 Bacteria 981
157 Ga0495669_0000004 3300046684 Bacteria 208878
158 Ga0495670_0000012 3300046691 Bacteria 170426
159 Ga0495686_0022301 3300047472 Bacteria 4191
160 Ga0496102_0817158 3300048905 Bacteria 854
161 Ga0496115_0000314 3300048918 Bacteria 41118
162 Ga0496120_0052014 3300048923 Bacteria 2335
163 Ga0496122_0300225 3300048925 Bacteria 866
164 Ga0496123_0020886 3300048926 Bacteria 5106
165 Ga0496123_0051259 3300048926 Bacteria 2749
166 Ga0496124_0000129 3300048927 Bacteria 156648
167 Ga0496124_0048132 3300048927 Bacteria 3645
168 Ga0496124_0105754 3300048927 Bacteria 2273
169 Ga0496124_0130694 3300048927 Bacteria 1995
170 Ga0496125_0063477 3300048928 Bacteria 2945
171 Ga0501033_0003941 3300049570 Bacteria 12039
172 Ga0501033_0007590 3300049570 Bacteria 8435
173 Ga0501034_0093340 3300049571 Bacteria 3006
174 Ga0501034_0127380 3300049571 Bacteria 2531
175 Ga0501034_0470496 3300049571 Bacteria 1173
176 Ga0501034_0589146 3300049571 Bacteria 1018
177 Ga0501036_0299396 3300049572 Bacteria 1345
178 Ga0501037_0170107 3300049573 Bacteria 1549
179 Ga0501038_0287373 3300049574 Bacteria 1293
180 Ga0501046_0056353 3300049580 Bacteria 3086
181 Ga0501046_0103712 3300049580 Bacteria 2180
182 Ga0501047_0040138 3300049581 Bacteria 4527
183 Ga0501047_0054362 3300049581 Bacteria 3873
184 Ga0501047_0054537 3300049581 Bacteria 3866
185 Ga0501047_0096665 3300049581 Bacteria 2832
186 Ga0501048_0124091 3300049582 Bacteria 1826
187 Ga0501044_0020458 3300049823 Bacteria 7066
188 Ga0495601_0460493 3300053077 Bacteria 822
189 Ga0500635_0002866 3300053080 Bacteria 4291
190 Ga0500643_000750 3300053087 Bacteria 21221
191 Ga0500643_001430 3300053087 Bacteria 13755
192 Ga0500566_0000840 3300053094 Bacteria 17527
193 Ga0500641_0001403 3300053096 Bacteria 8590
194 Ga0500555_022966 3300053103 Bacteria 1790
195 Ga0500556_0009350 3300053104 Bacteria 2847
196 Ga0500562_059750 3300053108 Bacteria 1024
197 Ga0500658_0002595 3300053134 Bacteria 6984
198 Ga0500658_0008481 3300053134 Bacteria 3796
199 Ga0500559_0052145 3300053136 Bacteria 1808
200 Ga0500568_0130131 3300053139 Bacteria 936
201 Ga0500616_0029331 3300053153 Bacteria 3028
202 Ga0500622_0014065 3300053156 Bacteria 4301
203 Ga0500622_0046082 3300053156 Bacteria 2255
204 Ga0500627_0025660 3300053158 Bacteria 2425
205 Ga0500645_005545 3300053730 Bacteria 4624
206 Ga0501084_0629035 3300054114 Bacteria 906
207 Ga0466962_0000027 3300061719 Bacteria 71620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10000381 rootH1_100003812 176
2 3300037471 Ga0395905_0485586 Ga0395905_0485586_114_728 182
3 3300005578 Ga0068854_100006158 Ga0068854_1000061586 186
4 3300025981 Ga0207640_10007471 Ga0207640_100074715 186
5 3300005347 Ga0070668_100041847 Ga0070668_1000418472 187
6 3300025972 Ga0207668_10031465 Ga0207668_100314652 187
7 3300049570 Ga0501033_0003941 Ga0501033_0003941_2012_2608 191
8 3300049572 Ga0501036_0299396 Ga0501036_0299396_122_718 191
9 3300049574 Ga0501038_0287373 Ga0501038_0287373_133_729 191
10 3300049580 Ga0501046_0103712 Ga0501046_0103712_708_1304 191
11 3300049581 Ga0501047_0054537 Ga0501047_0054537_2025_2621 191
12 3300049823 Ga0501044_0020458 Ga0501044_0020458_714_1310 191
13 3300041404 Ga0439436_0053562 Ga0439436_0053562_257_835 192
14 3300041410 Ga0439461_0000030 Ga0439461_0000030_14757_15335 192
15 3300041413 Ga0439465_0004752 Ga0439465_0004752_1134_1712 192
16 3300041997 Ga0439431_0000296 Ga0439431_0000296_1796_2374 192
17 3300042002 Ga0439442_005337 Ga0439442_005337_1418_1996 192
18 3300042004 Ga0439445_0012490 Ga0439445_0012490_1109_1687 192
19 3300042006 Ga0439432_000137 Ga0439432_000137_21662_22240 192
20 3300042010 Ga0439452_013545 Ga0439452_013545_1087_1665 192
21 3300042015 Ga0439462_0000624 Ga0439462_0000624_2239_2817 192
22 3300042156 Ga0439446_0030849 Ga0439446_0030849_152_730 192
23 3300042435 Ga0439434_0000185 Ga0439434_0000185_12037_12615 192
24 3300053134 Ga0500658_0008481 Ga0500658_0008481_2433_3011 192
25 3300053158 Ga0500627_0025660 Ga0500627_0025660_70_648 192
26 3300003322 rootL2_10083079 rootL2_100830792 195
27 3300003322 rootL2_10087965 rootL2_100879652 195
28 3300003322 rootL2_10152799 rootL2_101527992 195
29 3300005842 Ga0068858_100213717 Ga0068858_1002137173 195
30 3300037471 Ga0395905_0002126 Ga0395905_0002126_17045_17650 195
31 iso_pu_bacteria 2599185359 2600228621 195
32 iso_pu_bacteria 2643221622 2644128384 195
33 iso_pu_bacteria 2818991466 2819714568 195
34 iso_pu_bacteria 2879163058 2879164998 195
35 iso_pu_bacteria 2928526807 2928529071 195
36 iso_pu_bacteria 2928968154 2928968588 195
37 iso_pu_bacteria 2599185354 2600200385 196
38 iso_pu_bacteria 2751185897 2753763803 196
39 iso_pu_bacteria 2928027323 2928030471 196
40 iso_pu_bacteria 2984555340 2984557309 196
41 iso_pu_bacteria 2984564862 2984568293 196
42 iso_pu_bacteria 2993356040 2993359373 196
43 3300005262 Ga0065165_1015143 Ga0065165_10151433 197
44 3300005336 Ga0070680_100083374 Ga0070680_1000833743 197
45 3300005456 Ga0070678_100151059 Ga0070678_1001510593 197
46 3300005458 Ga0070681_10451700 Ga0070681_104517003 197
47 3300005530 Ga0070679_100093471 Ga0070679_1000934711 197
48 3300005548 Ga0070665_100073361 Ga0070665_1000733613 197
49 3300006195 Ga0075366_10061759 Ga0075366_100617592 197
50 3300006237 Ga0097621_100000784 Ga0097621_1000007848 197
51 3300006358 Ga0068871_100020532 Ga0068871_1000205324 197
52 3300006358 Ga0068871_100099817 Ga0068871_1000998172 197
53 3300006358 Ga0068871_100213943 Ga0068871_1002139433 197
54 3300009093 Ga0105240_10000528 Ga0105240_1000052867 197
55 3300009093 Ga0105240_10266163 Ga0105240_102661633 197
56 3300009177 Ga0105248_10014353 Ga0105248_100143533 197
57 3300009177 Ga0105248_11793362 Ga0105248_117933621 197
58 3300010375 Ga0105239_10296418 Ga0105239_102964183 197
59 3300013105 Ga0157369_10953921 Ga0157369_109539211 197
60 3300013297 Ga0157378_10153931 Ga0157378_101539312 197
61 3300013297 Ga0157378_11335314 Ga0157378_113353141 197
62 3300014968 Ga0157379_10017002 Ga0157379_100170025 197
63 3300025298 Ga0209050_1023639 Ga0209050_10236393 197
64 3300025304 Ga0209257_1000533 Ga0209257_100053357 197
65 3300025912 Ga0207707_10173038 Ga0207707_101730383 197
66 3300025913 Ga0207695_10049660 Ga0207695_100496604 197
67 3300025934 Ga0207686_10196773 Ga0207686_101967733 197
68 3300025941 Ga0207711_10082643 Ga0207711_100826434 197
69 3300025949 Ga0207667_10536020 Ga0207667_105360201 197
70 3300026023 Ga0207677_10079205 Ga0207677_100792052 197
71 3300026121 Ga0207683_10125468 Ga0207683_101254683 197
72 3300028379 Ga0268266_10227598 Ga0268266_102275982 197
73 3300029957 Ga0265324_10104685 Ga0265324_101046852 197
74 3300039062 Ga0400483_008718 Ga0400483_008718_1179_1823 197
75 3300041451 Ga0451791_0256703 Ga0451791_0256703_382_978 197
76 3300046557 Ga0495622_0013978 Ga0495622_0013978_3110_3706 197
77 3300048928 Ga0496125_0063477 Ga0496125_0063477_2120_2719 197
78 3300053087 Ga0500643_000750 Ga0500643_000750_10904_11503 197
79 3300003320 rootH2_10001159 rootH2_100011592 198
80 3300005339 Ga0070660_100011886 Ga0070660_1000118867 198
81 3300005530 Ga0070679_100000001 Ga0070679_10000000154 198
82 3300013102 Ga0157371_10299009 Ga0157371_102990092 198
83 3300013104 Ga0157370_10176795 Ga0157370_101767952 198
84 3300015684 Ga0183365_10001 Ga0183365_100011928 198
85 3300015690 Ga0183363_1004 Ga0183363_1004219 198
86 3300020081 Ga0206354_10325876 Ga0206354_103258766 198
87 3300020082 Ga0206353_11447746 Ga0206353_114477466 198
88 3300025917 Ga0207660_10001259 Ga0207660_1000125915 198
89 3300025919 Ga0207657_10018088 Ga0207657_100180882 198
90 3300025921 Ga0207652_10000001 Ga0207652_10000001111 198
91 3300025921 Ga0207652_10000002 Ga0207652_10000002616 198
92 3300025981 Ga0207640_10811373 Ga0207640_108113731 198
93 3300031911 Ga0307412_10006182 Ga0307412_100061825 198
94 3300035115 Ga0373941_0143935 Ga0373941_0143935_241_852 198
95 3300049571 Ga0501034_0093340 Ga0501034_0093340_2070_2714 198
96 3300049571 Ga0501034_0127380 Ga0501034_0127380_1671_2303 198
97 3300049580 Ga0501046_0056353 Ga0501046_0056353_50_679 198
98 3300053077 Ga0495601_0460493 Ga0495601_0460493_98_700 198
99 3300053080 Ga0500635_0002866 Ga0500635_0002866_3338_3967 198
100 3300053136 Ga0500559_0052145 Ga0500559_0052145_836_1465 198
101 3300003320 rootH2_10038161 rootH2_100381614 199
102 3300003323 rootH1_10215864 rootH1_102158642 199
103 3300003773 Ga0055537_1001351 Ga0055537_10013514 199
104 3300003775 Ga0055524_1001543 Ga0055524_10015432 199
105 3300003791 Ga0055530_10000082 Ga0055530_1000008252 199
106 3300003791 Ga0055530_10000596 Ga0055530_1000059625 199
107 3300003794 Ga0055531_10000012 Ga0055531_1000001252 199
108 3300003794 Ga0055531_10005292 Ga0055531_100052926 199
109 3300005262 Ga0065165_1002910 Ga0065165_10029104 199
110 3300005295 Ga0065707_10708117 Ga0065707_107081171 199
111 3300005345 Ga0070692_10001945 Ga0070692_100019453 199
112 3300005366 Ga0070659_100003828 Ga0070659_1000038283 199
113 3300005546 Ga0070696_100015319 Ga0070696_1000153192 199
114 3300005578 Ga0068854_100007747 Ga0068854_1000077474 199
115 3300009098 Ga0105245_10004043 Ga0105245_1000404310 199
116 3300013105 Ga0157369_10004779 Ga0157369_1000477910 199
117 3300021384 Ga0213876_10001309 Ga0213876_1000130916 199
118 3300025245 Ga0207425_1019374 Ga0207425_10193742 199
119 3300025246 Ga0209646_1007620 Ga0209646_10076201 199
120 3300025253 Ga0209677_118348 Ga0209677_1183481 199
121 3300025263 Ga0209565_1000030 Ga0209565_1000030166 199
122 3300025297 Ga0209758_1005806 Ga0209758_10058062 199
123 3300025297 Ga0209758_1102439 Ga0209758_11024391 199
124 3300025298 Ga0209050_1000039 Ga0209050_1000039252 199
125 3300025298 Ga0209050_1012485 Ga0209050_10124854 199
126 3300025299 Ga0209256_1000046 Ga0209256_1000046119 199
127 3300025304 Ga0209257_1000051 Ga0209257_1000051252 199
128 3300025304 Ga0209257_1023326 Ga0209257_10233262 199
129 3300025927 Ga0207687_10006338 Ga0207687_100063385 199
130 3300025932 Ga0207690_10003057 Ga0207690_100030573 199
131 3300025981 Ga0207640_10011348 Ga0207640_100113484 199
132 3300026041 Ga0207639_10395917 Ga0207639_103959172 199
133 3300031238 Ga0265332_10039805 Ga0265332_100398052 199
134 3300031241 Ga0265325_10027723 Ga0265325_100277233 199
135 3300031250 Ga0265331_10133117 Ga0265331_101331172 199
136 3300031595 Ga0265313_10001152 Ga0265313_100011524 199
137 3300031595 Ga0265313_10001905 Ga0265313_100019056 199
138 3300031711 Ga0265314_10114905 Ga0265314_101149053 199
139 3300031911 Ga0307412_10003755 Ga0307412_100037555 199
140 3300032005 Ga0307411_11096449 Ga0307411_110964492 199
141 3300037471 Ga0395905_0218539 Ga0395905_0218539_114_773 199
142 3300039437 Ga0436365_0429708 Ga0436365_0429708_23012_23617 199
143 3300039450 Ga0436363_0028904 Ga0436363_0028904_459_1064 199
144 3300041404 Ga0439436_0027194 Ga0439436_0027194_949_1554 199
145 3300044656 Ga0466969_0040049 Ga0466969_0040049_1127_1783 199
146 3300044684 Ga0466966_0013570 Ga0466966_0013570_1577_2233 199
147 3300044693 Ga0466961_0035982 Ga0466961_0035982_2222_2878 199
148 3300044694 Ga0466963_0079094 Ga0466963_0079094_1046_1702 199
149 3300044719 Ga0466971_0003531 Ga0466971_0003531_422_1078 199
150 3300044765 Ga0466970_0062749 Ga0466970_0062749_19_675 199
151 3300044842 Ga0466957_0061345 Ga0466957_0061345_1304_1960 199
152 3300045049 Ga0466959_0020380 Ga0466959_0020380_439_1095 199
153 3300045836 Ga0466958_0018594 Ga0466958_0018594_3206_3862 199
154 3300046524 Ga0495648_0029401 Ga0495648_0029401_822_1427 199
155 3300046691 Ga0495670_0000012 Ga0495670_0000012_119714_120319 199
156 3300047472 Ga0495686_0022301 Ga0495686_0022301_1927_2526 199
157 3300048923 Ga0496120_0052014 Ga0496120_0052014_1282_1881 199
158 3300048925 Ga0496122_0300225 Ga0496122_0300225_213_812 199
159 3300048926 Ga0496123_0020886 Ga0496123_0020886_1252_1851 199
160 3300048926 Ga0496123_0051259 Ga0496123_0051259_1701_2300 199
161 3300048927 Ga0496124_0000129 Ga0496124_0000129_153909_154508 199
162 3300048927 Ga0496124_0048132 Ga0496124_0048132_1354_1953 199
163 3300048927 Ga0496124_0105754 Ga0496124_0105754_806_1405 199
164 3300048927 Ga0496124_0130694 Ga0496124_0130694_1354_1953 199
165 3300049570 Ga0501033_0007590 Ga0501033_0007590_1152_1760 199
166 3300049571 Ga0501034_0470496 Ga0501034_0470496_52_672 199
167 3300049571 Ga0501034_0589146 Ga0501034_0589146_287_895 199
168 3300049573 Ga0501037_0170107 Ga0501037_0170107_405_1013 199
169 3300049581 Ga0501047_0040138 Ga0501047_0040138_3582_4190 199
170 3300049581 Ga0501047_0096665 Ga0501047_0096665_87_695 199
171 3300049582 Ga0501048_0124091 Ga0501048_0124091_344_952 199
172 3300053094 Ga0500566_0000840 Ga0500566_0000840_13412_14011 199
173 3300053108 Ga0500562_059750 Ga0500562_059750_301_906 199
174 3300053134 Ga0500658_0002595 Ga0500658_0002595_5029_5634 199
175 3300053139 Ga0500568_0130131 Ga0500568_0130131_51_650 199
176 3300054114 Ga0501084_0629035 Ga0501084_0629035_44_652 199
177 3300061719 Ga0466962_0000027 Ga0466962_0000027_69595_70251 199
178 iso_pu_bacteria 2739367756 2739791672 199
179 3300002774 JGI25150J39212_1000096 JGI25150J39212_100009616 200
180 3300003187 JGI25151J46595_10013844 JGI25151J46595_100138444 200
181 3300003215 JGI25153J46596_10000028 JGI25153J46596_1000002852 200
182 3300003771 Ga0055526_1001386 Ga0055526_10013864 200
183 3300003771 Ga0055526_1035458 Ga0055526_10354582 200
184 3300003773 Ga0055537_1002843 Ga0055537_10028436 200
185 3300003781 Ga0055536_1075157 Ga0055536_10751571 200
186 3300003791 Ga0055530_10014546 Ga0055530_100145462 200
187 3300003792 Ga0055540_1000927 Ga0055540_100092716 200
188 3300003794 Ga0055531_10020916 Ga0055531_100209163 200
189 3300003794 Ga0055531_10021358 Ga0055531_100213583 200
190 3300025245 Ga0207425_1000005 Ga0207425_100000552 200
191 3300025258 Ga0209129_1001276 Ga0209129_10012762 200
192 3300025263 Ga0209565_1000056 Ga0209565_100005610 200
193 3300025292 Ga0209676_1003020 Ga0209676_100302011 200
194 3300025292 Ga0209676_1009518 Ga0209676_10095182 200
195 3300025294 Ga0209025_1000464 Ga0209025_100046447 200
196 3300025295 Ga0209564_1000899 Ga0209564_100089915 200
197 3300025295 Ga0209564_1009325 Ga0209564_10093252 200
198 3300025297 Ga0209758_1000002 Ga0209758_10000021292 200
199 3300025298 Ga0209050_1000005 Ga0209050_1000005208 200
200 3300025298 Ga0209050_1018462 Ga0209050_10184621 200
201 3300025298 Ga0209050_1027669 Ga0209050_10276692 200
202 3300025303 Ga0209051_1002826 Ga0209051_10028269 200
203 3300025304 Ga0209257_1003535 Ga0209257_10035359 200
204 3300025304 Ga0209257_1003538 Ga0209257_10035389 200
205 3300025304 Ga0209257_1017180 Ga0209257_10171804 200
206 3300031728 Ga0316578_10022110 Ga0316578_100221102 200
207 3300036712 Ga0316584_0095813 Ga0316584_0095813_310_936 200
208 3300046616 Ga0495668_0245198 Ga0495668_0245198_320_940 200
209 3300046684 Ga0495669_0000004 Ga0495669_0000004_134975_135595 200
210 3300048905 Ga0496102_0817158 Ga0496102_0817158_103_705 200
211 3300048918 Ga0496115_0000314 Ga0496115_0000314_16909_17511 200
212 3300049581 Ga0501047_0054362 Ga0501047_0054362_1588_2208 200
213 3300053087 Ga0500643_001430 Ga0500643_001430_4909_5529 200
214 3300053096 Ga0500641_0001403 Ga0500641_0001403_4649_5269 200
215 3300053103 Ga0500555_022966 Ga0500555_022966_949_1569 200
216 3300053104 Ga0500556_0009350 Ga0500556_0009350_679_1299 200
217 3300053153 Ga0500616_0029331 Ga0500616_0029331_1937_2557 200
218 3300053156 Ga0500622_0014065 Ga0500622_0014065_1673_2293 200
219 3300053156 Ga0500622_0046082 Ga0500622_0046082_374_994 200
220 3300053730 Ga0500645_005545 Ga0500645_005545_604_1224 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13759

2OG-FeII_Oxy_5

Putative 2OG-Fe(II) oxygenase

128

228

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bvc-assembly1.cif.gz_A crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism 0.9491 1 200
3bvc-assembly1.cif.gz_A crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism 0.9445 1 200
2rg4-assembly1.cif.gz_A crystal structure of the uncharacterized protein q2cbj1_9rhob from oceanicola granulosus htcc2516 0.9226 1 199
2rg4-assembly1.cif.gz_A crystal structure of the uncharacterized protein q2cbj1_9rhob from oceanicola granulosus htcc2516 0.9136 1 199
4p7w-assembly1.cif.gz_A l-proline-bound l-proline cis-4-hydroxylase 0.8059 94 197
ID Description Score Start End Superfamily
2rg4B01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9488 10 199 2.60.120.620
2rg4B01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.925 10 199 2.60.120.620
af_Q9FLT3_18_198_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8213 96 199 2.60.120.10
af_I1JF86_104_298_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7965 97 198 2.60.120.10
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7915 96 196 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2A2M300-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9887 5 198 GO:0004045
AF-A0A1Y5H7F6-F1-model_v4 2OG-Fe(II) oxygenase 0.9882 33 200
AF-A0A7Y7DRK8-F1-model_v4 deleted 0.9863 100 200
AF-A0A4Q3DL76-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9842 68 198
AF-A0A4Q5T8P3-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9772 51 198

Feature Viewer

pLDDT pTM Quality
94.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map