F331740
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 220 | 172 | 215 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10110912|rootH1_101109122 |
| Length | 215 |
| Sequence | MRTNVIFVHHPILIDYSCQLLHQIYNYLSMNILSQPWPWYVAGPLIGLMVPLLLLLGNRHFGISANLRHICAACLPAKVPFFSYDWKKESWNLFFAAGIMSGGFLAATLLAAPAPSEVDPRLLTELQAYGISYSGAPVPADLFNWPALLTLKGLLLMVGGGFLIGFGTRYAGGCTSGHAIMGLSNLQWPSLVATCCFMAGGFIVANLVLPYILHL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 4 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 133 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 134 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 140 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 145 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 146 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 147 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 148 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 149 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 150 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 167 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 168 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 169 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 170 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 171 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 172 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.73 |
| Metatranscriptomes | 0 |
| Isolates | 2.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.18 |
| Nodule | 0 |
| Rhizoplane | 0.91 |
| Rhizosphere | 80.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001491 | 3300001979 | Bacteria | 10763 |
| 2 | JGI25154J39366_1000012 | 3300002738 | Bacteria | 287601 |
| 3 | JGI25157J39369_1003580 | 3300002741 | Bacteria | 3111 |
| 4 | rootH1_10110912 | 3300003316 | Bacteria | 2563 |
| 5 | rootH2_10069430 | 3300003320 | Bacteria | 4163 |
| 6 | rootH2_10135839 | 3300003320 | Bacteria | 2298 |
| 7 | rootH2_10144854 | 3300003320 | Bacteria | 1369 |
| 8 | rootL2_10002179 | 3300003322 | Bacteria | 4738 |
| 9 | rootL2_10055485 | 3300003322 | Bacteria | 17147 |
| 10 | rootL2_10098917 | 3300003322 | Bacteria | 2884 |
| 11 | rootH1_10207970 | 3300003323 | Bacteria | 8626 |
| 12 | rootH1_10355571 | 3300003323 | Bacteria | 1250 |
| 13 | rootH1_10367183 | 3300003323 | Unclassified | 1455 |
| 14 | JGI25160J50197_1012935 | 3300003354 | Bacteria | 2868 |
| 15 | Ga0055536_1019446 | 3300003781 | Bacteria | 2135 |
| 16 | Ga0055531_10000160 | 3300003794 | Bacteria | 77077 |
| 17 | Ga0065165_1000857 | 3300005262 | Bacteria | 39843 |
| 18 | Ga0070658_10066933 | 3300005327 | Bacteria | 2935 |
| 19 | Ga0070658_10467564 | 3300005327 | Bacteria | 1088 |
| 20 | Ga0070676_10056750 | 3300005328 | Bacteria | 2315 |
| 21 | Ga0070683_100593084 | 3300005329 | Bacteria | 1060 |
| 22 | Ga0070670_100265881 | 3300005331 | Unclassified | 1496 |
| 23 | Ga0070666_10080944 | 3300005335 | Unclassified | 2220 |
| 24 | Ga0070666_10271463 | 3300005335 | Bacteria | 1204 |
| 25 | Ga0070680_100031043 | 3300005336 | Bacteria | 4294 |
| 26 | Ga0070682_100013579 | 3300005337 | Bacteria | 4690 |
| 27 | Ga0068868_100240261 | 3300005338 | Unclassified | 1522 |
| 28 | Ga0068868_100577745 | 3300005338 | Bacteria | 993 |
| 29 | Ga0068868_101033378 | 3300005338 | Bacteria | 753 |
| 30 | Ga0070668_100129110 | 3300005347 | Unclassified | 2027 |
| 31 | Ga0070669_100074695 | 3300005353 | Unclassified | 2513 |
| 32 | Ga0070673_100110541 | 3300005364 | Unclassified | 2278 |
| 33 | Ga0070688_100148461 | 3300005365 | Bacteria | 1600 |
| 34 | Ga0070659_100023264 | 3300005366 | Bacteria | 4739 |
| 35 | Ga0070659_100582587 | 3300005366 | Unclassified | 960 |
| 36 | Ga0070714_100087557 | 3300005435 | Bacteria | 2724 |
| 37 | Ga0070713_100087729 | 3300005436 | Bacteria | 2669 |
| 38 | Ga0070678_100026313 | 3300005456 | Bacteria | 3931 |
| 39 | Ga0070662_100749252 | 3300005457 | Bacteria | 828 |
| 40 | Ga0070681_10097313 | 3300005458 | Bacteria | 2890 |
| 41 | Ga0068867_100492261 | 3300005459 | Unclassified | 1052 |
| 42 | Ga0070685_10029551 | 3300005466 | Bacteria | 3046 |
| 43 | Ga0070707_100085196 | 3300005468 | Bacteria | 3054 |
| 44 | Ga0070698_100646179 | 3300005471 | Bacteria | 999 |
| 45 | Ga0070699_100096242 | 3300005518 | Bacteria | 2593 |
| 46 | Ga0070699_100140683 | 3300005518 | Bacteria | 2131 |
| 47 | Ga0070679_100001217 | 3300005530 | Bacteria | 22656 |
| 48 | Ga0070679_100018388 | 3300005530 | Bacteria | 6782 |
| 49 | Ga0070679_100676497 | 3300005530 | Bacteria | 975 |
| 50 | Ga0070684_100089183 | 3300005535 | Bacteria | 2741 |
| 51 | Ga0068853_100005673 | 3300005539 | Bacteria | 9817 |
| 52 | Ga0068853_100277365 | 3300005539 | Bacteria | 1545 |
| 53 | Ga0070672_100092835 | 3300005543 | Unclassified | 2437 |
| 54 | Ga0070695_100595072 | 3300005545 | Bacteria | 867 |
| 55 | Ga0070693_100114282 | 3300005547 | Bacteria | 1665 |
| 56 | Ga0070665_100140792 | 3300005548 | Unclassified | 2416 |
| 57 | Ga0070704_100037319 | 3300005549 | Unclassified | 3319 |
| 58 | Ga0068855_100028805 | 3300005563 | Bacteria | 6644 |
| 59 | Ga0068857_100093740 | 3300005577 | Bacteria | 2689 |
| 60 | Ga0068857_100607486 | 3300005577 | Bacteria | 1034 |
| 61 | Ga0068854_100038212 | 3300005578 | Unclassified | 3374 |
| 62 | Ga0068854_100100397 | 3300005578 | Bacteria | 2169 |
| 63 | Ga0068856_100006123 | 3300005614 | Bacteria | 11807 |
| 64 | Ga0068852_100442726 | 3300005616 | Bacteria | 1285 |
| 65 | Ga0068859_100040787 | 3300005617 | Bacteria | 4662 |
| 66 | Ga0068859_100062079 | 3300005617 | Bacteria | 3766 |
| 67 | Ga0068859_100845031 | 3300005617 | Bacteria | 1002 |
| 68 | Ga0068864_100615155 | 3300005618 | Unclassified | 1055 |
| 69 | Ga0068864_101067333 | 3300005618 | Bacteria | 803 |
| 70 | Ga0068866_10107283 | 3300005718 | Bacteria | 1551 |
| 71 | Ga0068861_100116581 | 3300005719 | Unclassified | 2148 |
| 72 | Ga0068851_10454083 | 3300005834 | Unclassified | 762 |
| 73 | Ga0068860_100600730 | 3300005843 | Unclassified | 1106 |
| 74 | Ga0097621_100182458 | 3300006237 | Unclassified | 1814 |
| 75 | Ga0075370_10085130 | 3300006353 | Bacteria | 1820 |
| 76 | Ga0068871_100104981 | 3300006358 | Unclassified | 2370 |
| 77 | Ga0075428_100087211 | 3300006844 | Bacteria | 3404 |
| 78 | Ga0075428_100615325 | 3300006844 | Bacteria | 1159 |
| 79 | Ga0075431_100025735 | 3300006847 | Bacteria | 6031 |
| 80 | Ga0075431_100953799 | 3300006847 | Bacteria | 826 |
| 81 | Ga0075429_100000543 | 3300006880 | Bacteria | 28757 |
| 82 | Ga0075429_100215459 | 3300006880 | Bacteria | 1682 |
| 83 | Ga0068865_100092584 | 3300006881 | Unclassified | 2196 |
| 84 | Ga0097620_100040786 | 3300006931 | Bacteria | 4662 |
| 85 | Ga0097620_100062080 | 3300006931 | Bacteria | 3766 |
| 86 | Ga0097620_100845001 | 3300006931 | Bacteria | 1002 |
| 87 | Ga0105240_10026778 | 3300009093 | Bacteria | 7562 |
| 88 | Ga0114129_10053721 | 3300009147 | Bacteria | 5650 |
| 89 | Ga0114129_10072491 | 3300009147 | Bacteria | 4801 |
| 90 | Ga0105241_10287821 | 3300009174 | Unclassified | 1406 |
| 91 | Ga0105242_10013547 | 3300009176 | Bacteria | 6308 |
| 92 | Ga0105248_12241627 | 3300009177 | Unclassified | 622 |
| 93 | Ga0105237_10006755 | 3300009545 | Bacteria | 12666 |
| 94 | Ga0105237_10237855 | 3300009545 | Bacteria | 1822 |
| 95 | Ga0105237_10750537 | 3300009545 | Bacteria | 982 |
| 96 | Ga0105249_10053324 | 3300009553 | Bacteria | 3697 |
| 97 | Ga0105239_10012836 | 3300010375 | Bacteria | 9319 |
| 98 | Ga0105239_10014938 | 3300010375 | Bacteria | 8607 |
| 99 | Ga0105239_10177989 | 3300010375 | Bacteria | 2379 |
| 100 | Ga0105246_10166640 | 3300011119 | Unclassified | 1683 |
| 101 | Ga0157373_10006801 | 3300013100 | Bacteria | 8520 |
| 102 | Ga0157370_10251796 | 3300013104 | Bacteria | 1633 |
| 103 | Ga0157370_10429455 | 3300013104 | Bacteria | 1215 |
| 104 | Ga0157369_10004629 | 3300013105 | Bacteria | 16161 |
| 105 | Ga0157374_10256059 | 3300013296 | Unclassified | 1723 |
| 106 | Ga0157374_10289241 | 3300013296 | Bacteria | 1619 |
| 107 | Ga0157374_10476372 | 3300013296 | Bacteria | 1251 |
| 108 | Ga0157374_10780650 | 3300013296 | Bacteria | 971 |
| 109 | Ga0157378_10026465 | 3300013297 | Bacteria | 5113 |
| 110 | Ga0157378_10362532 | 3300013297 | Bacteria | 1419 |
| 111 | Ga0157378_10484545 | 3300013297 | Bacteria | 1233 |
| 112 | Ga0163162_10209122 | 3300013306 | Unclassified | 2081 |
| 113 | Ga0163162_10700803 | 3300013306 | Bacteria | 1134 |
| 114 | Ga0157372_10270989 | 3300013307 | Bacteria | 1972 |
| 115 | Ga0157375_10601165 | 3300013308 | Unclassified | 1259 |
| 116 | Ga0163163_10589968 | 3300014325 | Unclassified | 1174 |
| 117 | Ga0157377_10019062 | 3300014745 | Bacteria | 3579 |
| 118 | Ga0157379_10432874 | 3300014968 | Bacteria | 1212 |
| 119 | Ga0157376_10515239 | 3300014969 | Unclassified | 1178 |
| 120 | Ga0163161_10094240 | 3300017792 | Bacteria | 2219 |
| 121 | Ga0209436_106188 | 3300025208 | Unclassified | 2651 |
| 122 | Ga0209646_1000009 | 3300025246 | Bacteria | 652154 |
| 123 | Ga0209026_1000209 | 3300025250 | Bacteria | 81291 |
| 124 | Ga0209676_1001309 | 3300025292 | Bacteria | 25307 |
| 125 | Ga0209758_1007533 | 3300025297 | Bacteria | 7367 |
| 126 | Ga0209050_1063029 | 3300025298 | Bacteria | 866 |
| 127 | Ga0207426_1000834 | 3300025302 | Bacteria | 32701 |
| 128 | Ga0207426_1003571 | 3300025302 | Bacteria | 8281 |
| 129 | Ga0209257_1000013 | 3300025304 | Bacteria | 1047305 |
| 130 | Ga0207697_10097328 | 3300025315 | Bacteria | 1252 |
| 131 | Ga0207682_10104192 | 3300025893 | Unclassified | 1243 |
| 132 | Ga0207688_10027782 | 3300025901 | Bacteria | 3112 |
| 133 | Ga0207680_10513847 | 3300025903 | Unclassified | 854 |
| 134 | Ga0207645_10000723 | 3300025907 | Bacteria | 27486 |
| 135 | Ga0207705_10052753 | 3300025909 | Bacteria | 2928 |
| 136 | Ga0207705_10395065 | 3300025909 | Bacteria | 1069 |
| 137 | Ga0207654_10006179 | 3300025911 | Bacteria | 6022 |
| 138 | Ga0207707_10271252 | 3300025912 | Bacteria | 1470 |
| 139 | Ga0207695_10011532 | 3300025913 | Bacteria | 10695 |
| 140 | Ga0207695_10564416 | 3300025913 | Bacteria | 1020 |
| 141 | Ga0207657_10036720 | 3300025919 | Bacteria | 4383 |
| 142 | Ga0207652_10000310 | 3300025921 | Bacteria | 50166 |
| 143 | Ga0207652_10213149 | 3300025921 | Bacteria | 1739 |
| 144 | Ga0207681_10022020 | 3300025923 | Bacteria | 4060 |
| 145 | Ga0207650_10051818 | 3300025925 | Unclassified | 3038 |
| 146 | Ga0207659_10161292 | 3300025926 | Unclassified | 1761 |
| 147 | Ga0207700_10884468 | 3300025928 | Bacteria | 799 |
| 148 | Ga0207686_10340450 | 3300025934 | Bacteria | 1126 |
| 149 | Ga0207669_10199698 | 3300025937 | Unclassified | 1450 |
| 150 | Ga0207691_10002061 | 3300025940 | Bacteria | 19633 |
| 151 | Ga0207689_10006081 | 3300025942 | Bacteria | 10675 |
| 152 | Ga0207661_10857511 | 3300025944 | Bacteria | 836 |
| 153 | Ga0207667_10005433 | 3300025949 | Bacteria | 15535 |
| 154 | Ga0207712_10244178 | 3300025961 | Bacteria | 1448 |
| 155 | Ga0207640_10686788 | 3300025981 | Bacteria | 876 |
| 156 | Ga0207677_10154400 | 3300026023 | Unclassified | 1775 |
| 157 | Ga0207639_10022547 | 3300026041 | Bacteria | 4536 |
| 158 | Ga0207639_10146184 | 3300026041 | Bacteria | 1975 |
| 159 | Ga0207639_10402692 | 3300026041 | Unclassified | 1233 |
| 160 | Ga0207678_10102105 | 3300026067 | Unclassified | 2448 |
| 161 | Ga0207702_10031027 | 3300026078 | Bacteria | 4455 |
| 162 | Ga0207648_10004472 | 3300026089 | Bacteria | 14342 |
| 163 | Ga0207676_10215694 | 3300026095 | Unclassified | 1706 |
| 164 | Ga0207675_100017388 | 3300026118 | Bacteria | 6712 |
| 165 | Ga0207683_10154170 | 3300026121 | Unclassified | 2074 |
| 166 | Ga0207698_11313443 | 3300026142 | Unclassified | 738 |
| 167 | Ga0209968_1053922 | 3300027526 | Bacteria | 702 |
| 168 | Ga0268266_10037568 | 3300028379 | Bacteria | 4124 |
| 169 | Ga0268264_10061292 | 3300028381 | Unclassified | 3155 |
| 170 | Ga0265327_10007143 | 3300031251 | Bacteria | 8712 |
| 171 | Ga0307513_10056045 | 3300031456 | Unclassified | 4212 |
| 172 | Ga0307508_10003014 | 3300031616 | Bacteria | 17367 |
| 173 | Ga0307516_10004755 | 3300031730 | Bacteria | 16578 |
| 174 | Ga0307410_10533071 | 3300031852 | Unclassified | 971 |
| 175 | Ga0307412_10059438 | 3300031911 | Bacteria | 2562 |
| 176 | Ga0307416_100220617 | 3300032002 | Bacteria | 1818 |
| 177 | Ga0307411_10210177 | 3300032005 | Bacteria | 1502 |
| 178 | Ga0307415_100321376 | 3300032126 | Unclassified | 1291 |
| 179 | Ga0307507_10147968 | 3300033179 | Bacteria | 1777 |
| 180 | Ga0395899_0032530 | 3300037312 | Bacteria | 3918 |
| 181 | Ga0395900_0017831 | 3300037418 | Bacteria | 7246 |
| 182 | Ga0395898_1466270 | 3300037466 | Unclassified | 609 |
| 183 | Ga0439439_0032024 | 3300041406 | Bacteria | 1342 |
| 184 | Ga0451793_1644305 | 3300041452 | Bacteria | 655 |
| 185 | Ga0439449_0011525 | 3300042007 | Bacteria | 3326 |
| 186 | Ga0439457_004420 | 3300042014 | Bacteria | 3663 |
| 187 | Ga0439462_0017858 | 3300042015 | Bacteria | 1839 |
| 188 | Ga0439462_0080456 | 3300042015 | Bacteria | 890 |
| 189 | Ga0451577_0109062 | 3300042876 | Unclassified | 2475 |
| 190 | Ga0451577_0336024 | 3300042876 | Bacteria | 1370 |
| 191 | Ga0466972_0051921 | 3300044658 | Bacteria | 1977 |
| 192 | Ga0495638_0245634 | 3300046460 | Unclassified | 989 |
| 193 | Ga0495605_0030793 | 3300046474 | Unclassified | 2747 |
| 194 | Ga0495608_0033107 | 3300046511 | Bacteria | 3495 |
| 195 | Ga0495667_0000126 | 3300046559 | Bacteria | 55102 |
| 196 | Ga0495668_0005306 | 3300046616 | Bacteria | 8812 |
| 197 | Ga0495661_0192979 | 3300046665 | Bacteria | 1071 |
| 198 | Ga0495686_0033353 | 3300047472 | Bacteria | 3325 |
| 199 | Ga0496105_0368553 | 3300048908 | Bacteria | 1145 |
| 200 | Ga0496126_0066016 | 3300048929 | Bacteria | 3236 |
| 201 | Ga0501034_0000043 | 3300049571 | Bacteria | 229049 |
| 202 | Ga0501034_0062004 | 3300049571 | Bacteria | 3754 |
| 203 | Ga0501047_0017094 | 3300049581 | Bacteria | 6937 |
| 204 | Ga0501035_0501499 | 3300049822 | Bacteria | 999 |
| 205 | nmdc:mga05p37_321791_c2 | 3300050507 | Bacteria | 1305 |
| 206 | nmdc:mga05p37_81924_c3 | 3300050507 | Unclassified | 777 |
| 207 | nmdc:mga09592_140131_c1 | 3300050508 | Bacteria | 2084 |
| 208 | nmdc:mga09592_4905_c1 | 3300050508 | Bacteria | 10847 |
| 209 | nmdc:mga0qj67_185425_c1 | 3300050509 | Bacteria | 1690 |
| 210 | Ga0500646_0085194 | 3300053090 | Unclassified | 970 |
| 211 | Ga0500607_152644 | 3300053121 | Bacteria | 1068 |
| 212 | Ga0500652_018790 | 3300053131 | Bacteria | 2557 |
| 213 | Ga0500658_0016284 | 3300053134 | Bacteria | 2769 |
| 214 | Ga0500568_0000274 | 3300053139 | Bacteria | 43327 |
| 215 | Ga0500577_0001794 | 3300053142 | Bacteria | 5489 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0032530 | Ga0395899_0032530_1440_1940 | 157 |
| 2 | 3300037418 | Ga0395900_0017831 | Ga0395900_0017831_3352_3852 | 157 |
| 3 | 3300037466 | Ga0395898_1466270 | Ga0395898_1466270_68_568 | 157 |
| 4 | 3300050507 | nmdc:mga05p37_321791_c2 | nmdc:mga05p37_321791_c2_770_1273 | 160 |
| 5 | 3300042015 | Ga0439462_0080456 | Ga0439462_0080456_298_861 | 171 |
| 6 | 3300044658 | Ga0466972_0051921 | Ga0466972_0051921_1439_1966 | 175 |
| 7 | 3300003320 | rootH2_10069430 | rootH2_100694305 | 176 |
| 8 | 3300003322 | rootL2_10002179 | rootL2_100021795 | 176 |
| 9 | 3300010375 | Ga0105239_10177989 | Ga0105239_101779894 | 176 |
| 10 | 3300005327 | Ga0070658_10066933 | Ga0070658_100669334 | 177 |
| 11 | 3300005530 | Ga0070679_100001217 | Ga0070679_10000121717 | 177 |
| 12 | 3300025909 | Ga0207705_10052753 | Ga0207705_100527534 | 177 |
| 13 | 3300025921 | Ga0207652_10000310 | Ga0207652_1000031017 | 177 |
| 14 | 3300032126 | Ga0307415_100321376 | Ga0307415_1003213762 | 178 |
| 15 | 3300005338 | Ga0068868_101033378 | Ga0068868_1010333781 | 179 |
| 16 | 3300005468 | Ga0070707_100085196 | Ga0070707_1000851963 | 179 |
| 17 | 3300005518 | Ga0070699_100140683 | Ga0070699_1001406833 | 179 |
| 18 | 3300005545 | Ga0070695_100595072 | Ga0070695_1005950721 | 179 |
| 19 | 3300005549 | Ga0070704_100037319 | Ga0070704_1000373193 | 179 |
| 20 | 3300005617 | Ga0068859_100040787 | Ga0068859_1000407873 | 179 |
| 21 | 3300006931 | Ga0097620_100040786 | Ga0097620_1000407863 | 179 |
| 22 | 3300009553 | Ga0105249_10053324 | Ga0105249_100533243 | 179 |
| 23 | 3300025961 | Ga0207712_10244178 | Ga0207712_102441782 | 179 |
| 24 | 3300005338 | Ga0068868_100240261 | Ga0068868_1002402612 | 180 |
| 25 | 3300005366 | Ga0070659_100582587 | Ga0070659_1005825872 | 180 |
| 26 | 3300005518 | Ga0070699_100096242 | Ga0070699_1000962422 | 180 |
| 27 | 3300005719 | Ga0068861_100116581 | Ga0068861_1001165812 | 180 |
| 28 | 3300006880 | Ga0075429_100000543 | Ga0075429_10000054322 | 180 |
| 29 | 3300009147 | Ga0114129_10072491 | Ga0114129_100724914 | 180 |
| 30 | 3300025901 | Ga0207688_10027782 | Ga0207688_100277821 | 180 |
| 31 | 3300025937 | Ga0207669_10199698 | Ga0207669_101996982 | 180 |
| 32 | 3300026118 | Ga0207675_100017388 | Ga0207675_1000173884 | 180 |
| 33 | 3300026121 | Ga0207683_10154170 | Ga0207683_101541702 | 180 |
| 34 | 3300031616 | Ga0307508_10003014 | Ga0307508_100030145 | 180 |
| 35 | 3300050508 | nmdc:mga09592_4905_c1 | nmdc:mga09592_4905_c1_1192_1755 | 180 |
| 36 | 3300050509 | nmdc:mga0qj67_185425_c1 | nmdc:mga0qj67_185425_c1_469_1032 | 180 |
| 37 | 3300005331 | Ga0070670_100265881 | Ga0070670_1002658812 | 181 |
| 38 | 3300005335 | Ga0070666_10080944 | Ga0070666_100809443 | 181 |
| 39 | 3300005347 | Ga0070668_100129110 | Ga0070668_1001291102 | 181 |
| 40 | 3300005353 | Ga0070669_100074695 | Ga0070669_1000746952 | 181 |
| 41 | 3300005364 | Ga0070673_100110541 | Ga0070673_1001105412 | 181 |
| 42 | 3300005456 | Ga0070678_100026313 | Ga0070678_1000263132 | 181 |
| 43 | 3300005459 | Ga0068867_100492261 | Ga0068867_1004922612 | 181 |
| 44 | 3300005543 | Ga0070672_100092835 | Ga0070672_1000928352 | 181 |
| 45 | 3300005548 | Ga0070665_100140792 | Ga0070665_1001407923 | 181 |
| 46 | 3300005578 | Ga0068854_100038212 | Ga0068854_1000382124 | 181 |
| 47 | 3300005616 | Ga0068852_100442726 | Ga0068852_1004427262 | 181 |
| 48 | 3300005617 | Ga0068859_100062079 | Ga0068859_1000620792 | 181 |
| 49 | 3300005618 | Ga0068864_100615155 | Ga0068864_1006151552 | 181 |
| 50 | 3300005718 | Ga0068866_10107283 | Ga0068866_101072832 | 181 |
| 51 | 3300005834 | Ga0068851_10454083 | Ga0068851_104540831 | 181 |
| 52 | 3300005843 | Ga0068860_100600730 | Ga0068860_1006007302 | 181 |
| 53 | 3300006237 | Ga0097621_100182458 | Ga0097621_1001824582 | 181 |
| 54 | 3300006358 | Ga0068871_100104981 | Ga0068871_1001049811 | 181 |
| 55 | 3300006881 | Ga0068865_100092584 | Ga0068865_1000925842 | 181 |
| 56 | 3300006931 | Ga0097620_100062080 | Ga0097620_1000620802 | 181 |
| 57 | 3300009174 | Ga0105241_10287821 | Ga0105241_102878212 | 181 |
| 58 | 3300009176 | Ga0105242_10013547 | Ga0105242_100135475 | 181 |
| 59 | 3300011119 | Ga0105246_10166640 | Ga0105246_101666402 | 181 |
| 60 | 3300013296 | Ga0157374_10256059 | Ga0157374_102560592 | 181 |
| 61 | 3300013297 | Ga0157378_10484545 | Ga0157378_104845452 | 181 |
| 62 | 3300013306 | Ga0163162_10209122 | Ga0163162_102091222 | 181 |
| 63 | 3300013308 | Ga0157375_10601165 | Ga0157375_106011652 | 181 |
| 64 | 3300014325 | Ga0163163_10589968 | Ga0163163_105899682 | 181 |
| 65 | 3300014745 | Ga0157377_10019062 | Ga0157377_100190621 | 181 |
| 66 | 3300014969 | Ga0157376_10515239 | Ga0157376_105152392 | 181 |
| 67 | 3300025315 | Ga0207697_10097328 | Ga0207697_100973282 | 181 |
| 68 | 3300025893 | Ga0207682_10104192 | Ga0207682_101041922 | 181 |
| 69 | 3300025907 | Ga0207645_10000723 | Ga0207645_1000072325 | 181 |
| 70 | 3300025923 | Ga0207681_10022020 | Ga0207681_100220203 | 181 |
| 71 | 3300025925 | Ga0207650_10051818 | Ga0207650_100518182 | 181 |
| 72 | 3300025926 | Ga0207659_10161292 | Ga0207659_101612922 | 181 |
| 73 | 3300025934 | Ga0207686_10340450 | Ga0207686_103404501 | 181 |
| 74 | 3300025940 | Ga0207691_10002061 | Ga0207691_100020614 | 181 |
| 75 | 3300025942 | Ga0207689_10006081 | Ga0207689_100060813 | 181 |
| 76 | 3300025981 | Ga0207640_10686788 | Ga0207640_106867882 | 181 |
| 77 | 3300026023 | Ga0207677_10154400 | Ga0207677_101544002 | 181 |
| 78 | 3300026041 | Ga0207639_10402692 | Ga0207639_104026922 | 181 |
| 79 | 3300026067 | Ga0207678_10102105 | Ga0207678_101021051 | 181 |
| 80 | 3300026089 | Ga0207648_10004472 | Ga0207648_1000447212 | 181 |
| 81 | 3300026095 | Ga0207676_10215694 | Ga0207676_102156942 | 181 |
| 82 | 3300026142 | Ga0207698_11313443 | Ga0207698_113134432 | 181 |
| 83 | 3300028379 | Ga0268266_10037568 | Ga0268266_100375683 | 181 |
| 84 | 3300028381 | Ga0268264_10061292 | Ga0268264_100612923 | 181 |
| 85 | 3300017792 | Ga0163161_10094240 | Ga0163161_100942402 | 183 |
| 86 | iso_pu_bacteria | 2522125168 | 2522553440 | 183 |
| 87 | iso_pu_bacteria | 2904467357 | 2904473907 | 183 |
| 88 | iso_pu_bacteria | 2929921140 | 2929924299 | 183 |
| 89 | iso_pu_bacteria | 8003151029 | 8003155581 | 183 |
| 90 | 3300053139 | Ga0500568_0000274 | Ga0500568_0000274_20780_21340 | 184 |
| 91 | 3300032005 | Ga0307411_10210177 | Ga0307411_102101772 | 185 |
| 92 | iso_pu_bacteria | 2738541278 | 2738725530 | 185 |
| 93 | 3300003794 | Ga0055531_10000160 | Ga0055531_1000016065 | 186 |
| 94 | 3300005338 | Ga0068868_100577745 | Ga0068868_1005777452 | 186 |
| 95 | 3300005366 | Ga0070659_100023264 | Ga0070659_1000232643 | 186 |
| 96 | 3300005435 | Ga0070714_100087557 | Ga0070714_1000875572 | 186 |
| 97 | 3300005436 | Ga0070713_100087729 | Ga0070713_1000877293 | 186 |
| 98 | 3300005530 | Ga0070679_100676497 | Ga0070679_1006764972 | 186 |
| 99 | 3300005577 | Ga0068857_100093740 | Ga0068857_1000937401 | 186 |
| 100 | 3300006353 | Ga0075370_10085130 | Ga0075370_100851302 | 186 |
| 101 | 3300009545 | Ga0105237_10006755 | Ga0105237_1000675510 | 186 |
| 102 | 3300009545 | Ga0105237_10750537 | Ga0105237_107505372 | 186 |
| 103 | 3300010375 | Ga0105239_10012836 | Ga0105239_100128365 | 186 |
| 104 | 3300013296 | Ga0157374_10476372 | Ga0157374_104763722 | 186 |
| 105 | 3300013306 | Ga0163162_10700803 | Ga0163162_107008032 | 186 |
| 106 | 3300013307 | Ga0157372_10270989 | Ga0157372_102709892 | 186 |
| 107 | 3300025304 | Ga0209257_1000013 | Ga0209257_1000013833 | 186 |
| 108 | 3300025919 | Ga0207657_10036720 | Ga0207657_100367203 | 186 |
| 109 | 3300025928 | Ga0207700_10884468 | Ga0207700_108844682 | 186 |
| 110 | 3300031251 | Ga0265327_10007143 | Ga0265327_100071437 | 186 |
| 111 | 3300041406 | Ga0439439_0032024 | Ga0439439_0032024_684_1244 | 186 |
| 112 | 3300042007 | Ga0439449_0011525 | Ga0439449_0011525_1081_1641 | 186 |
| 113 | 3300042014 | Ga0439457_004420 | Ga0439457_004420_1433_1993 | 186 |
| 114 | 3300042015 | Ga0439462_0017858 | Ga0439462_0017858_1135_1695 | 186 |
| 115 | 3300046511 | Ga0495608_0033107 | Ga0495608_0033107_1696_2268 | 186 |
| 116 | 3300046559 | Ga0495667_0000126 | Ga0495667_0000126_19326_19898 | 186 |
| 117 | 3300048908 | Ga0496105_0368553 | Ga0496105_0368553_218_778 | 186 |
| 118 | 3300048929 | Ga0496126_0066016 | Ga0496126_0066016_470_1030 | 186 |
| 119 | 3300001979 | JGI24740J21852_10001491 | JGI24740J21852_100014918 | 187 |
| 120 | 3300002738 | JGI25154J39366_1000012 | JGI25154J39366_1000012184 | 187 |
| 121 | 3300002741 | JGI25157J39369_1003580 | JGI25157J39369_10035804 | 187 |
| 122 | 3300003316 | rootH1_10110912 | rootH1_101109122 | 187 |
| 123 | 3300003320 | rootH2_10135839 | rootH2_101358392 | 187 |
| 124 | 3300003320 | rootH2_10144854 | rootH2_101448541 | 187 |
| 125 | 3300003322 | rootL2_10055485 | rootL2_1005548517 | 187 |
| 126 | 3300003322 | rootL2_10098917 | rootL2_100989172 | 187 |
| 127 | 3300003323 | rootH1_10207970 | rootH1_102079703 | 187 |
| 128 | 3300003323 | rootH1_10355571 | rootH1_103555712 | 187 |
| 129 | 3300003323 | rootH1_10367183 | rootH1_103671832 | 187 |
| 130 | 3300003354 | JGI25160J50197_1012935 | JGI25160J50197_10129353 | 187 |
| 131 | 3300003781 | Ga0055536_1019446 | Ga0055536_10194463 | 187 |
| 132 | 3300005262 | Ga0065165_1000857 | Ga0065165_100085715 | 187 |
| 133 | 3300005327 | Ga0070658_10467564 | Ga0070658_104675642 | 187 |
| 134 | 3300005328 | Ga0070676_10056750 | Ga0070676_100567501 | 187 |
| 135 | 3300005329 | Ga0070683_100593084 | Ga0070683_1005930842 | 187 |
| 136 | 3300005335 | Ga0070666_10271463 | Ga0070666_102714631 | 187 |
| 137 | 3300005336 | Ga0070680_100031043 | Ga0070680_1000310434 | 187 |
| 138 | 3300005337 | Ga0070682_100013579 | Ga0070682_1000135793 | 187 |
| 139 | 3300005365 | Ga0070688_100148461 | Ga0070688_1001484613 | 187 |
| 140 | 3300005457 | Ga0070662_100749252 | Ga0070662_1007492521 | 187 |
| 141 | 3300005458 | Ga0070681_10097313 | Ga0070681_100973132 | 187 |
| 142 | 3300005466 | Ga0070685_10029551 | Ga0070685_100295514 | 187 |
| 143 | 3300005471 | Ga0070698_100646179 | Ga0070698_1006461791 | 187 |
| 144 | 3300005530 | Ga0070679_100018388 | Ga0070679_1000183882 | 187 |
| 145 | 3300005535 | Ga0070684_100089183 | Ga0070684_1000891832 | 187 |
| 146 | 3300005539 | Ga0068853_100005673 | Ga0068853_1000056733 | 187 |
| 147 | 3300005539 | Ga0068853_100277365 | Ga0068853_1002773652 | 187 |
| 148 | 3300005547 | Ga0070693_100114282 | Ga0070693_1001142821 | 187 |
| 149 | 3300005563 | Ga0068855_100028805 | Ga0068855_1000288057 | 187 |
| 150 | 3300005577 | Ga0068857_100607486 | Ga0068857_1006074862 | 187 |
| 151 | 3300005578 | Ga0068854_100100397 | Ga0068854_1001003972 | 187 |
| 152 | 3300005614 | Ga0068856_100006123 | Ga0068856_1000061236 | 187 |
| 153 | 3300005617 | Ga0068859_100845031 | Ga0068859_1008450312 | 187 |
| 154 | 3300005618 | Ga0068864_101067333 | Ga0068864_1010673331 | 187 |
| 155 | 3300006844 | Ga0075428_100087211 | Ga0075428_1000872112 | 187 |
| 156 | 3300006844 | Ga0075428_100615325 | Ga0075428_1006153252 | 187 |
| 157 | 3300006847 | Ga0075431_100025735 | Ga0075431_1000257354 | 187 |
| 158 | 3300006847 | Ga0075431_100953799 | Ga0075431_1009537992 | 187 |
| 159 | 3300006880 | Ga0075429_100215459 | Ga0075429_1002154592 | 187 |
| 160 | 3300006931 | Ga0097620_100845001 | Ga0097620_1008450012 | 187 |
| 161 | 3300009093 | Ga0105240_10026778 | Ga0105240_100267785 | 187 |
| 162 | 3300009147 | Ga0114129_10053721 | Ga0114129_100537213 | 187 |
| 163 | 3300009177 | Ga0105248_12241627 | Ga0105248_122416271 | 187 |
| 164 | 3300009545 | Ga0105237_10237855 | Ga0105237_102378553 | 187 |
| 165 | 3300010375 | Ga0105239_10014938 | Ga0105239_100149386 | 187 |
| 166 | 3300013100 | Ga0157373_10006801 | Ga0157373_100068016 | 187 |
| 167 | 3300013104 | Ga0157370_10251796 | Ga0157370_102517963 | 187 |
| 168 | 3300013104 | Ga0157370_10429455 | Ga0157370_104294552 | 187 |
| 169 | 3300013105 | Ga0157369_10004629 | Ga0157369_100046297 | 187 |
| 170 | 3300013296 | Ga0157374_10289241 | Ga0157374_102892411 | 187 |
| 171 | 3300013296 | Ga0157374_10780650 | Ga0157374_107806502 | 187 |
| 172 | 3300013297 | Ga0157378_10026465 | Ga0157378_100264653 | 187 |
| 173 | 3300013297 | Ga0157378_10362532 | Ga0157378_103625322 | 187 |
| 174 | 3300014968 | Ga0157379_10432874 | Ga0157379_104328741 | 187 |
| 175 | 3300025208 | Ga0209436_106188 | Ga0209436_1061882 | 187 |
| 176 | 3300025246 | Ga0209646_1000009 | Ga0209646_100000990 | 187 |
| 177 | 3300025250 | Ga0209026_1000209 | Ga0209026_100020917 | 187 |
| 178 | 3300025292 | Ga0209676_1001309 | Ga0209676_10013096 | 187 |
| 179 | 3300025297 | Ga0209758_1007533 | Ga0209758_10075339 | 187 |
| 180 | 3300025298 | Ga0209050_1063029 | Ga0209050_10630292 | 187 |
| 181 | 3300025302 | Ga0207426_1000834 | Ga0207426_100083412 | 187 |
| 182 | 3300025302 | Ga0207426_1003571 | Ga0207426_10035718 | 187 |
| 183 | 3300025903 | Ga0207680_10513847 | Ga0207680_105138472 | 187 |
| 184 | 3300025909 | Ga0207705_10395065 | Ga0207705_103950652 | 187 |
| 185 | 3300025911 | Ga0207654_10006179 | Ga0207654_100061792 | 187 |
| 186 | 3300025912 | Ga0207707_10271252 | Ga0207707_102712522 | 187 |
| 187 | 3300025913 | Ga0207695_10011532 | Ga0207695_100115326 | 187 |
| 188 | 3300025913 | Ga0207695_10564416 | Ga0207695_105644161 | 187 |
| 189 | 3300025921 | Ga0207652_10213149 | Ga0207652_102131492 | 187 |
| 190 | 3300025944 | Ga0207661_10857511 | Ga0207661_108575112 | 187 |
| 191 | 3300025949 | Ga0207667_10005433 | Ga0207667_100054339 | 187 |
| 192 | 3300026041 | Ga0207639_10022547 | Ga0207639_100225473 | 187 |
| 193 | 3300026041 | Ga0207639_10146184 | Ga0207639_101461842 | 187 |
| 194 | 3300026078 | Ga0207702_10031027 | Ga0207702_100310272 | 187 |
| 195 | 3300027526 | Ga0209968_1053922 | Ga0209968_10539221 | 187 |
| 196 | 3300031456 | Ga0307513_10056045 | Ga0307513_100560453 | 187 |
| 197 | 3300031730 | Ga0307516_10004755 | Ga0307516_100047552 | 187 |
| 198 | 3300031852 | Ga0307410_10533071 | Ga0307410_105330712 | 187 |
| 199 | 3300031911 | Ga0307412_10059438 | Ga0307412_100594382 | 187 |
| 200 | 3300032002 | Ga0307416_100220617 | Ga0307416_1002206172 | 187 |
| 201 | 3300033179 | Ga0307507_10147968 | Ga0307507_101479682 | 187 |
| 202 | 3300041452 | Ga0451793_1644305 | Ga0451793_1644305_38_619 | 187 |
| 203 | 3300042876 | Ga0451577_0109062 | Ga0451577_0109062_1482_2051 | 187 |
| 204 | 3300042876 | Ga0451577_0336024 | Ga0451577_0336024_507_1070 | 187 |
| 205 | 3300046460 | Ga0495638_0245634 | Ga0495638_0245634_96_665 | 187 |
| 206 | 3300046474 | Ga0495605_0030793 | Ga0495605_0030793_842_1408 | 187 |
| 207 | 3300046616 | Ga0495668_0005306 | Ga0495668_0005306_3025_3588 | 187 |
| 208 | 3300046665 | Ga0495661_0192979 | Ga0495661_0192979_68_634 | 187 |
| 209 | 3300047472 | Ga0495686_0033353 | Ga0495686_0033353_1628_2197 | 187 |
| 210 | 3300049571 | Ga0501034_0000043 | Ga0501034_0000043_58148_58711 | 187 |
| 211 | 3300049571 | Ga0501034_0062004 | Ga0501034_0062004_2138_2701 | 187 |
| 212 | 3300049581 | Ga0501047_0017094 | Ga0501047_0017094_6237_6806 | 187 |
| 213 | 3300049822 | Ga0501035_0501499 | Ga0501035_0501499_312_881 | 187 |
| 214 | 3300050507 | nmdc:mga05p37_81924_c3 | nmdc:mga05p37_81924_c3_42_605 | 187 |
| 215 | 3300050508 | nmdc:mga09592_140131_c1 | nmdc:mga09592_140131_c1_717_1280 | 187 |
| 216 | 3300053090 | Ga0500646_0085194 | Ga0500646_0085194_109_672 | 187 |
| 217 | 3300053121 | Ga0500607_152644 | Ga0500607_152644_344_907 | 187 |
| 218 | 3300053131 | Ga0500652_018790 | Ga0500652_018790_1428_1991 | 187 |
| 219 | 3300053134 | Ga0500658_0016284 | Ga0500658_0016284_889_1452 | 187 |
| 220 | 3300053142 | Ga0500577_0001794 | Ga0500577_0001794_2683_3246 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P33359_41_239_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.2569 | 38 | 186 | 1.10.3720.10 |
| 3lpzA01 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.256 | 58 | 100 | 1.25.40.10 |
| af_A8DZA0_713_830_1.20.1390.10 | Mainly Alpha;Up-down Bundle;PWI domain;PWI domain | 0.2295 | 88 | 165 | 1.20.1390.10 |
| af_P33359_41_239_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.2189 | 38 | 186 | 1.10.3720.10 |
| af_Q5TZA6_281_441_3.30.710.10 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.1811 | 44 | 186 | 3.30.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520B1T2-F1-model_v4 | YeeE/YedE family protein | 0.8565 | 1 | 110 |
GO:0005886
|
| AF-A0A4Q3SZV7-F1-model_v4 | deleted | 0.8535 | 1 | 101 |
|
| AF-A0A7C7KD14-F1-model_v4 | deleted | 0.8521 | 1 | 121 |
|
| AF-A0A520B1T2-F1-model_v4 | YeeE/YedE family protein | 0.8498 | 1 | 110 |
GO:0005886
|
| AF-A0A4Q3SZV7-F1-model_v4 | deleted | 0.8389 | 1 | 101 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar