F331740

General Info

Members Datasets Scaffolds Average Seq Length
220 172 215 185

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10110912|rootH1_101109122
Length 215
Sequence MRTNVIFVHHPILIDYSCQLLHQIYNYLSMNILSQPWPWYVAGPLIGLMVPLLLLLGNRHFGISANLRHICAACLPAKVPFFSYDWKKESWNLFFAAGIMSGGFLAATLLAAPAPSEVDPRLLTELQAYGISYSGAPVPADLFNWPALLTLKGLLLMVGGGFLIGFGTRYAGGCTSGHAIMGLSNLQWPSLVATCCFMAGGFIVANLVLPYILHL

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
4 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
148 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
168 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
169 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
172 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 0
Rhizoplane 0.91
Rhizosphere 80.45
Stem 0
Stem Tuber 0
Unclassified 10.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001491 3300001979 Bacteria 10763
2 JGI25154J39366_1000012 3300002738 Bacteria 287601
3 JGI25157J39369_1003580 3300002741 Bacteria 3111
4 rootH1_10110912 3300003316 Bacteria 2563
5 rootH2_10069430 3300003320 Bacteria 4163
6 rootH2_10135839 3300003320 Bacteria 2298
7 rootH2_10144854 3300003320 Bacteria 1369
8 rootL2_10002179 3300003322 Bacteria 4738
9 rootL2_10055485 3300003322 Bacteria 17147
10 rootL2_10098917 3300003322 Bacteria 2884
11 rootH1_10207970 3300003323 Bacteria 8626
12 rootH1_10355571 3300003323 Bacteria 1250
13 rootH1_10367183 3300003323 Unclassified 1455
14 JGI25160J50197_1012935 3300003354 Bacteria 2868
15 Ga0055536_1019446 3300003781 Bacteria 2135
16 Ga0055531_10000160 3300003794 Bacteria 77077
17 Ga0065165_1000857 3300005262 Bacteria 39843
18 Ga0070658_10066933 3300005327 Bacteria 2935
19 Ga0070658_10467564 3300005327 Bacteria 1088
20 Ga0070676_10056750 3300005328 Bacteria 2315
21 Ga0070683_100593084 3300005329 Bacteria 1060
22 Ga0070670_100265881 3300005331 Unclassified 1496
23 Ga0070666_10080944 3300005335 Unclassified 2220
24 Ga0070666_10271463 3300005335 Bacteria 1204
25 Ga0070680_100031043 3300005336 Bacteria 4294
26 Ga0070682_100013579 3300005337 Bacteria 4690
27 Ga0068868_100240261 3300005338 Unclassified 1522
28 Ga0068868_100577745 3300005338 Bacteria 993
29 Ga0068868_101033378 3300005338 Bacteria 753
30 Ga0070668_100129110 3300005347 Unclassified 2027
31 Ga0070669_100074695 3300005353 Unclassified 2513
32 Ga0070673_100110541 3300005364 Unclassified 2278
33 Ga0070688_100148461 3300005365 Bacteria 1600
34 Ga0070659_100023264 3300005366 Bacteria 4739
35 Ga0070659_100582587 3300005366 Unclassified 960
36 Ga0070714_100087557 3300005435 Bacteria 2724
37 Ga0070713_100087729 3300005436 Bacteria 2669
38 Ga0070678_100026313 3300005456 Bacteria 3931
39 Ga0070662_100749252 3300005457 Bacteria 828
40 Ga0070681_10097313 3300005458 Bacteria 2890
41 Ga0068867_100492261 3300005459 Unclassified 1052
42 Ga0070685_10029551 3300005466 Bacteria 3046
43 Ga0070707_100085196 3300005468 Bacteria 3054
44 Ga0070698_100646179 3300005471 Bacteria 999
45 Ga0070699_100096242 3300005518 Bacteria 2593
46 Ga0070699_100140683 3300005518 Bacteria 2131
47 Ga0070679_100001217 3300005530 Bacteria 22656
48 Ga0070679_100018388 3300005530 Bacteria 6782
49 Ga0070679_100676497 3300005530 Bacteria 975
50 Ga0070684_100089183 3300005535 Bacteria 2741
51 Ga0068853_100005673 3300005539 Bacteria 9817
52 Ga0068853_100277365 3300005539 Bacteria 1545
53 Ga0070672_100092835 3300005543 Unclassified 2437
54 Ga0070695_100595072 3300005545 Bacteria 867
55 Ga0070693_100114282 3300005547 Bacteria 1665
56 Ga0070665_100140792 3300005548 Unclassified 2416
57 Ga0070704_100037319 3300005549 Unclassified 3319
58 Ga0068855_100028805 3300005563 Bacteria 6644
59 Ga0068857_100093740 3300005577 Bacteria 2689
60 Ga0068857_100607486 3300005577 Bacteria 1034
61 Ga0068854_100038212 3300005578 Unclassified 3374
62 Ga0068854_100100397 3300005578 Bacteria 2169
63 Ga0068856_100006123 3300005614 Bacteria 11807
64 Ga0068852_100442726 3300005616 Bacteria 1285
65 Ga0068859_100040787 3300005617 Bacteria 4662
66 Ga0068859_100062079 3300005617 Bacteria 3766
67 Ga0068859_100845031 3300005617 Bacteria 1002
68 Ga0068864_100615155 3300005618 Unclassified 1055
69 Ga0068864_101067333 3300005618 Bacteria 803
70 Ga0068866_10107283 3300005718 Bacteria 1551
71 Ga0068861_100116581 3300005719 Unclassified 2148
72 Ga0068851_10454083 3300005834 Unclassified 762
73 Ga0068860_100600730 3300005843 Unclassified 1106
74 Ga0097621_100182458 3300006237 Unclassified 1814
75 Ga0075370_10085130 3300006353 Bacteria 1820
76 Ga0068871_100104981 3300006358 Unclassified 2370
77 Ga0075428_100087211 3300006844 Bacteria 3404
78 Ga0075428_100615325 3300006844 Bacteria 1159
79 Ga0075431_100025735 3300006847 Bacteria 6031
80 Ga0075431_100953799 3300006847 Bacteria 826
81 Ga0075429_100000543 3300006880 Bacteria 28757
82 Ga0075429_100215459 3300006880 Bacteria 1682
83 Ga0068865_100092584 3300006881 Unclassified 2196
84 Ga0097620_100040786 3300006931 Bacteria 4662
85 Ga0097620_100062080 3300006931 Bacteria 3766
86 Ga0097620_100845001 3300006931 Bacteria 1002
87 Ga0105240_10026778 3300009093 Bacteria 7562
88 Ga0114129_10053721 3300009147 Bacteria 5650
89 Ga0114129_10072491 3300009147 Bacteria 4801
90 Ga0105241_10287821 3300009174 Unclassified 1406
91 Ga0105242_10013547 3300009176 Bacteria 6308
92 Ga0105248_12241627 3300009177 Unclassified 622
93 Ga0105237_10006755 3300009545 Bacteria 12666
94 Ga0105237_10237855 3300009545 Bacteria 1822
95 Ga0105237_10750537 3300009545 Bacteria 982
96 Ga0105249_10053324 3300009553 Bacteria 3697
97 Ga0105239_10012836 3300010375 Bacteria 9319
98 Ga0105239_10014938 3300010375 Bacteria 8607
99 Ga0105239_10177989 3300010375 Bacteria 2379
100 Ga0105246_10166640 3300011119 Unclassified 1683
101 Ga0157373_10006801 3300013100 Bacteria 8520
102 Ga0157370_10251796 3300013104 Bacteria 1633
103 Ga0157370_10429455 3300013104 Bacteria 1215
104 Ga0157369_10004629 3300013105 Bacteria 16161
105 Ga0157374_10256059 3300013296 Unclassified 1723
106 Ga0157374_10289241 3300013296 Bacteria 1619
107 Ga0157374_10476372 3300013296 Bacteria 1251
108 Ga0157374_10780650 3300013296 Bacteria 971
109 Ga0157378_10026465 3300013297 Bacteria 5113
110 Ga0157378_10362532 3300013297 Bacteria 1419
111 Ga0157378_10484545 3300013297 Bacteria 1233
112 Ga0163162_10209122 3300013306 Unclassified 2081
113 Ga0163162_10700803 3300013306 Bacteria 1134
114 Ga0157372_10270989 3300013307 Bacteria 1972
115 Ga0157375_10601165 3300013308 Unclassified 1259
116 Ga0163163_10589968 3300014325 Unclassified 1174
117 Ga0157377_10019062 3300014745 Bacteria 3579
118 Ga0157379_10432874 3300014968 Bacteria 1212
119 Ga0157376_10515239 3300014969 Unclassified 1178
120 Ga0163161_10094240 3300017792 Bacteria 2219
121 Ga0209436_106188 3300025208 Unclassified 2651
122 Ga0209646_1000009 3300025246 Bacteria 652154
123 Ga0209026_1000209 3300025250 Bacteria 81291
124 Ga0209676_1001309 3300025292 Bacteria 25307
125 Ga0209758_1007533 3300025297 Bacteria 7367
126 Ga0209050_1063029 3300025298 Bacteria 866
127 Ga0207426_1000834 3300025302 Bacteria 32701
128 Ga0207426_1003571 3300025302 Bacteria 8281
129 Ga0209257_1000013 3300025304 Bacteria 1047305
130 Ga0207697_10097328 3300025315 Bacteria 1252
131 Ga0207682_10104192 3300025893 Unclassified 1243
132 Ga0207688_10027782 3300025901 Bacteria 3112
133 Ga0207680_10513847 3300025903 Unclassified 854
134 Ga0207645_10000723 3300025907 Bacteria 27486
135 Ga0207705_10052753 3300025909 Bacteria 2928
136 Ga0207705_10395065 3300025909 Bacteria 1069
137 Ga0207654_10006179 3300025911 Bacteria 6022
138 Ga0207707_10271252 3300025912 Bacteria 1470
139 Ga0207695_10011532 3300025913 Bacteria 10695
140 Ga0207695_10564416 3300025913 Bacteria 1020
141 Ga0207657_10036720 3300025919 Bacteria 4383
142 Ga0207652_10000310 3300025921 Bacteria 50166
143 Ga0207652_10213149 3300025921 Bacteria 1739
144 Ga0207681_10022020 3300025923 Bacteria 4060
145 Ga0207650_10051818 3300025925 Unclassified 3038
146 Ga0207659_10161292 3300025926 Unclassified 1761
147 Ga0207700_10884468 3300025928 Bacteria 799
148 Ga0207686_10340450 3300025934 Bacteria 1126
149 Ga0207669_10199698 3300025937 Unclassified 1450
150 Ga0207691_10002061 3300025940 Bacteria 19633
151 Ga0207689_10006081 3300025942 Bacteria 10675
152 Ga0207661_10857511 3300025944 Bacteria 836
153 Ga0207667_10005433 3300025949 Bacteria 15535
154 Ga0207712_10244178 3300025961 Bacteria 1448
155 Ga0207640_10686788 3300025981 Bacteria 876
156 Ga0207677_10154400 3300026023 Unclassified 1775
157 Ga0207639_10022547 3300026041 Bacteria 4536
158 Ga0207639_10146184 3300026041 Bacteria 1975
159 Ga0207639_10402692 3300026041 Unclassified 1233
160 Ga0207678_10102105 3300026067 Unclassified 2448
161 Ga0207702_10031027 3300026078 Bacteria 4455
162 Ga0207648_10004472 3300026089 Bacteria 14342
163 Ga0207676_10215694 3300026095 Unclassified 1706
164 Ga0207675_100017388 3300026118 Bacteria 6712
165 Ga0207683_10154170 3300026121 Unclassified 2074
166 Ga0207698_11313443 3300026142 Unclassified 738
167 Ga0209968_1053922 3300027526 Bacteria 702
168 Ga0268266_10037568 3300028379 Bacteria 4124
169 Ga0268264_10061292 3300028381 Unclassified 3155
170 Ga0265327_10007143 3300031251 Bacteria 8712
171 Ga0307513_10056045 3300031456 Unclassified 4212
172 Ga0307508_10003014 3300031616 Bacteria 17367
173 Ga0307516_10004755 3300031730 Bacteria 16578
174 Ga0307410_10533071 3300031852 Unclassified 971
175 Ga0307412_10059438 3300031911 Bacteria 2562
176 Ga0307416_100220617 3300032002 Bacteria 1818
177 Ga0307411_10210177 3300032005 Bacteria 1502
178 Ga0307415_100321376 3300032126 Unclassified 1291
179 Ga0307507_10147968 3300033179 Bacteria 1777
180 Ga0395899_0032530 3300037312 Bacteria 3918
181 Ga0395900_0017831 3300037418 Bacteria 7246
182 Ga0395898_1466270 3300037466 Unclassified 609
183 Ga0439439_0032024 3300041406 Bacteria 1342
184 Ga0451793_1644305 3300041452 Bacteria 655
185 Ga0439449_0011525 3300042007 Bacteria 3326
186 Ga0439457_004420 3300042014 Bacteria 3663
187 Ga0439462_0017858 3300042015 Bacteria 1839
188 Ga0439462_0080456 3300042015 Bacteria 890
189 Ga0451577_0109062 3300042876 Unclassified 2475
190 Ga0451577_0336024 3300042876 Bacteria 1370
191 Ga0466972_0051921 3300044658 Bacteria 1977
192 Ga0495638_0245634 3300046460 Unclassified 989
193 Ga0495605_0030793 3300046474 Unclassified 2747
194 Ga0495608_0033107 3300046511 Bacteria 3495
195 Ga0495667_0000126 3300046559 Bacteria 55102
196 Ga0495668_0005306 3300046616 Bacteria 8812
197 Ga0495661_0192979 3300046665 Bacteria 1071
198 Ga0495686_0033353 3300047472 Bacteria 3325
199 Ga0496105_0368553 3300048908 Bacteria 1145
200 Ga0496126_0066016 3300048929 Bacteria 3236
201 Ga0501034_0000043 3300049571 Bacteria 229049
202 Ga0501034_0062004 3300049571 Bacteria 3754
203 Ga0501047_0017094 3300049581 Bacteria 6937
204 Ga0501035_0501499 3300049822 Bacteria 999
205 nmdc:mga05p37_321791_c2 3300050507 Bacteria 1305
206 nmdc:mga05p37_81924_c3 3300050507 Unclassified 777
207 nmdc:mga09592_140131_c1 3300050508 Bacteria 2084
208 nmdc:mga09592_4905_c1 3300050508 Bacteria 10847
209 nmdc:mga0qj67_185425_c1 3300050509 Bacteria 1690
210 Ga0500646_0085194 3300053090 Unclassified 970
211 Ga0500607_152644 3300053121 Bacteria 1068
212 Ga0500652_018790 3300053131 Bacteria 2557
213 Ga0500658_0016284 3300053134 Bacteria 2769
214 Ga0500568_0000274 3300053139 Bacteria 43327
215 Ga0500577_0001794 3300053142 Bacteria 5489

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0032530 Ga0395899_0032530_1440_1940 157
2 3300037418 Ga0395900_0017831 Ga0395900_0017831_3352_3852 157
3 3300037466 Ga0395898_1466270 Ga0395898_1466270_68_568 157
4 3300050507 nmdc:mga05p37_321791_c2 nmdc:mga05p37_321791_c2_770_1273 160
5 3300042015 Ga0439462_0080456 Ga0439462_0080456_298_861 171
6 3300044658 Ga0466972_0051921 Ga0466972_0051921_1439_1966 175
7 3300003320 rootH2_10069430 rootH2_100694305 176
8 3300003322 rootL2_10002179 rootL2_100021795 176
9 3300010375 Ga0105239_10177989 Ga0105239_101779894 176
10 3300005327 Ga0070658_10066933 Ga0070658_100669334 177
11 3300005530 Ga0070679_100001217 Ga0070679_10000121717 177
12 3300025909 Ga0207705_10052753 Ga0207705_100527534 177
13 3300025921 Ga0207652_10000310 Ga0207652_1000031017 177
14 3300032126 Ga0307415_100321376 Ga0307415_1003213762 178
15 3300005338 Ga0068868_101033378 Ga0068868_1010333781 179
16 3300005468 Ga0070707_100085196 Ga0070707_1000851963 179
17 3300005518 Ga0070699_100140683 Ga0070699_1001406833 179
18 3300005545 Ga0070695_100595072 Ga0070695_1005950721 179
19 3300005549 Ga0070704_100037319 Ga0070704_1000373193 179
20 3300005617 Ga0068859_100040787 Ga0068859_1000407873 179
21 3300006931 Ga0097620_100040786 Ga0097620_1000407863 179
22 3300009553 Ga0105249_10053324 Ga0105249_100533243 179
23 3300025961 Ga0207712_10244178 Ga0207712_102441782 179
24 3300005338 Ga0068868_100240261 Ga0068868_1002402612 180
25 3300005366 Ga0070659_100582587 Ga0070659_1005825872 180
26 3300005518 Ga0070699_100096242 Ga0070699_1000962422 180
27 3300005719 Ga0068861_100116581 Ga0068861_1001165812 180
28 3300006880 Ga0075429_100000543 Ga0075429_10000054322 180
29 3300009147 Ga0114129_10072491 Ga0114129_100724914 180
30 3300025901 Ga0207688_10027782 Ga0207688_100277821 180
31 3300025937 Ga0207669_10199698 Ga0207669_101996982 180
32 3300026118 Ga0207675_100017388 Ga0207675_1000173884 180
33 3300026121 Ga0207683_10154170 Ga0207683_101541702 180
34 3300031616 Ga0307508_10003014 Ga0307508_100030145 180
35 3300050508 nmdc:mga09592_4905_c1 nmdc:mga09592_4905_c1_1192_1755 180
36 3300050509 nmdc:mga0qj67_185425_c1 nmdc:mga0qj67_185425_c1_469_1032 180
37 3300005331 Ga0070670_100265881 Ga0070670_1002658812 181
38 3300005335 Ga0070666_10080944 Ga0070666_100809443 181
39 3300005347 Ga0070668_100129110 Ga0070668_1001291102 181
40 3300005353 Ga0070669_100074695 Ga0070669_1000746952 181
41 3300005364 Ga0070673_100110541 Ga0070673_1001105412 181
42 3300005456 Ga0070678_100026313 Ga0070678_1000263132 181
43 3300005459 Ga0068867_100492261 Ga0068867_1004922612 181
44 3300005543 Ga0070672_100092835 Ga0070672_1000928352 181
45 3300005548 Ga0070665_100140792 Ga0070665_1001407923 181
46 3300005578 Ga0068854_100038212 Ga0068854_1000382124 181
47 3300005616 Ga0068852_100442726 Ga0068852_1004427262 181
48 3300005617 Ga0068859_100062079 Ga0068859_1000620792 181
49 3300005618 Ga0068864_100615155 Ga0068864_1006151552 181
50 3300005718 Ga0068866_10107283 Ga0068866_101072832 181
51 3300005834 Ga0068851_10454083 Ga0068851_104540831 181
52 3300005843 Ga0068860_100600730 Ga0068860_1006007302 181
53 3300006237 Ga0097621_100182458 Ga0097621_1001824582 181
54 3300006358 Ga0068871_100104981 Ga0068871_1001049811 181
55 3300006881 Ga0068865_100092584 Ga0068865_1000925842 181
56 3300006931 Ga0097620_100062080 Ga0097620_1000620802 181
57 3300009174 Ga0105241_10287821 Ga0105241_102878212 181
58 3300009176 Ga0105242_10013547 Ga0105242_100135475 181
59 3300011119 Ga0105246_10166640 Ga0105246_101666402 181
60 3300013296 Ga0157374_10256059 Ga0157374_102560592 181
61 3300013297 Ga0157378_10484545 Ga0157378_104845452 181
62 3300013306 Ga0163162_10209122 Ga0163162_102091222 181
63 3300013308 Ga0157375_10601165 Ga0157375_106011652 181
64 3300014325 Ga0163163_10589968 Ga0163163_105899682 181
65 3300014745 Ga0157377_10019062 Ga0157377_100190621 181
66 3300014969 Ga0157376_10515239 Ga0157376_105152392 181
67 3300025315 Ga0207697_10097328 Ga0207697_100973282 181
68 3300025893 Ga0207682_10104192 Ga0207682_101041922 181
69 3300025907 Ga0207645_10000723 Ga0207645_1000072325 181
70 3300025923 Ga0207681_10022020 Ga0207681_100220203 181
71 3300025925 Ga0207650_10051818 Ga0207650_100518182 181
72 3300025926 Ga0207659_10161292 Ga0207659_101612922 181
73 3300025934 Ga0207686_10340450 Ga0207686_103404501 181
74 3300025940 Ga0207691_10002061 Ga0207691_100020614 181
75 3300025942 Ga0207689_10006081 Ga0207689_100060813 181
76 3300025981 Ga0207640_10686788 Ga0207640_106867882 181
77 3300026023 Ga0207677_10154400 Ga0207677_101544002 181
78 3300026041 Ga0207639_10402692 Ga0207639_104026922 181
79 3300026067 Ga0207678_10102105 Ga0207678_101021051 181
80 3300026089 Ga0207648_10004472 Ga0207648_1000447212 181
81 3300026095 Ga0207676_10215694 Ga0207676_102156942 181
82 3300026142 Ga0207698_11313443 Ga0207698_113134432 181
83 3300028379 Ga0268266_10037568 Ga0268266_100375683 181
84 3300028381 Ga0268264_10061292 Ga0268264_100612923 181
85 3300017792 Ga0163161_10094240 Ga0163161_100942402 183
86 iso_pu_bacteria 2522125168 2522553440 183
87 iso_pu_bacteria 2904467357 2904473907 183
88 iso_pu_bacteria 2929921140 2929924299 183
89 iso_pu_bacteria 8003151029 8003155581 183
90 3300053139 Ga0500568_0000274 Ga0500568_0000274_20780_21340 184
91 3300032005 Ga0307411_10210177 Ga0307411_102101772 185
92 iso_pu_bacteria 2738541278 2738725530 185
93 3300003794 Ga0055531_10000160 Ga0055531_1000016065 186
94 3300005338 Ga0068868_100577745 Ga0068868_1005777452 186
95 3300005366 Ga0070659_100023264 Ga0070659_1000232643 186
96 3300005435 Ga0070714_100087557 Ga0070714_1000875572 186
97 3300005436 Ga0070713_100087729 Ga0070713_1000877293 186
98 3300005530 Ga0070679_100676497 Ga0070679_1006764972 186
99 3300005577 Ga0068857_100093740 Ga0068857_1000937401 186
100 3300006353 Ga0075370_10085130 Ga0075370_100851302 186
101 3300009545 Ga0105237_10006755 Ga0105237_1000675510 186
102 3300009545 Ga0105237_10750537 Ga0105237_107505372 186
103 3300010375 Ga0105239_10012836 Ga0105239_100128365 186
104 3300013296 Ga0157374_10476372 Ga0157374_104763722 186
105 3300013306 Ga0163162_10700803 Ga0163162_107008032 186
106 3300013307 Ga0157372_10270989 Ga0157372_102709892 186
107 3300025304 Ga0209257_1000013 Ga0209257_1000013833 186
108 3300025919 Ga0207657_10036720 Ga0207657_100367203 186
109 3300025928 Ga0207700_10884468 Ga0207700_108844682 186
110 3300031251 Ga0265327_10007143 Ga0265327_100071437 186
111 3300041406 Ga0439439_0032024 Ga0439439_0032024_684_1244 186
112 3300042007 Ga0439449_0011525 Ga0439449_0011525_1081_1641 186
113 3300042014 Ga0439457_004420 Ga0439457_004420_1433_1993 186
114 3300042015 Ga0439462_0017858 Ga0439462_0017858_1135_1695 186
115 3300046511 Ga0495608_0033107 Ga0495608_0033107_1696_2268 186
116 3300046559 Ga0495667_0000126 Ga0495667_0000126_19326_19898 186
117 3300048908 Ga0496105_0368553 Ga0496105_0368553_218_778 186
118 3300048929 Ga0496126_0066016 Ga0496126_0066016_470_1030 186
119 3300001979 JGI24740J21852_10001491 JGI24740J21852_100014918 187
120 3300002738 JGI25154J39366_1000012 JGI25154J39366_1000012184 187
121 3300002741 JGI25157J39369_1003580 JGI25157J39369_10035804 187
122 3300003316 rootH1_10110912 rootH1_101109122 187
123 3300003320 rootH2_10135839 rootH2_101358392 187
124 3300003320 rootH2_10144854 rootH2_101448541 187
125 3300003322 rootL2_10055485 rootL2_1005548517 187
126 3300003322 rootL2_10098917 rootL2_100989172 187
127 3300003323 rootH1_10207970 rootH1_102079703 187
128 3300003323 rootH1_10355571 rootH1_103555712 187
129 3300003323 rootH1_10367183 rootH1_103671832 187
130 3300003354 JGI25160J50197_1012935 JGI25160J50197_10129353 187
131 3300003781 Ga0055536_1019446 Ga0055536_10194463 187
132 3300005262 Ga0065165_1000857 Ga0065165_100085715 187
133 3300005327 Ga0070658_10467564 Ga0070658_104675642 187
134 3300005328 Ga0070676_10056750 Ga0070676_100567501 187
135 3300005329 Ga0070683_100593084 Ga0070683_1005930842 187
136 3300005335 Ga0070666_10271463 Ga0070666_102714631 187
137 3300005336 Ga0070680_100031043 Ga0070680_1000310434 187
138 3300005337 Ga0070682_100013579 Ga0070682_1000135793 187
139 3300005365 Ga0070688_100148461 Ga0070688_1001484613 187
140 3300005457 Ga0070662_100749252 Ga0070662_1007492521 187
141 3300005458 Ga0070681_10097313 Ga0070681_100973132 187
142 3300005466 Ga0070685_10029551 Ga0070685_100295514 187
143 3300005471 Ga0070698_100646179 Ga0070698_1006461791 187
144 3300005530 Ga0070679_100018388 Ga0070679_1000183882 187
145 3300005535 Ga0070684_100089183 Ga0070684_1000891832 187
146 3300005539 Ga0068853_100005673 Ga0068853_1000056733 187
147 3300005539 Ga0068853_100277365 Ga0068853_1002773652 187
148 3300005547 Ga0070693_100114282 Ga0070693_1001142821 187
149 3300005563 Ga0068855_100028805 Ga0068855_1000288057 187
150 3300005577 Ga0068857_100607486 Ga0068857_1006074862 187
151 3300005578 Ga0068854_100100397 Ga0068854_1001003972 187
152 3300005614 Ga0068856_100006123 Ga0068856_1000061236 187
153 3300005617 Ga0068859_100845031 Ga0068859_1008450312 187
154 3300005618 Ga0068864_101067333 Ga0068864_1010673331 187
155 3300006844 Ga0075428_100087211 Ga0075428_1000872112 187
156 3300006844 Ga0075428_100615325 Ga0075428_1006153252 187
157 3300006847 Ga0075431_100025735 Ga0075431_1000257354 187
158 3300006847 Ga0075431_100953799 Ga0075431_1009537992 187
159 3300006880 Ga0075429_100215459 Ga0075429_1002154592 187
160 3300006931 Ga0097620_100845001 Ga0097620_1008450012 187
161 3300009093 Ga0105240_10026778 Ga0105240_100267785 187
162 3300009147 Ga0114129_10053721 Ga0114129_100537213 187
163 3300009177 Ga0105248_12241627 Ga0105248_122416271 187
164 3300009545 Ga0105237_10237855 Ga0105237_102378553 187
165 3300010375 Ga0105239_10014938 Ga0105239_100149386 187
166 3300013100 Ga0157373_10006801 Ga0157373_100068016 187
167 3300013104 Ga0157370_10251796 Ga0157370_102517963 187
168 3300013104 Ga0157370_10429455 Ga0157370_104294552 187
169 3300013105 Ga0157369_10004629 Ga0157369_100046297 187
170 3300013296 Ga0157374_10289241 Ga0157374_102892411 187
171 3300013296 Ga0157374_10780650 Ga0157374_107806502 187
172 3300013297 Ga0157378_10026465 Ga0157378_100264653 187
173 3300013297 Ga0157378_10362532 Ga0157378_103625322 187
174 3300014968 Ga0157379_10432874 Ga0157379_104328741 187
175 3300025208 Ga0209436_106188 Ga0209436_1061882 187
176 3300025246 Ga0209646_1000009 Ga0209646_100000990 187
177 3300025250 Ga0209026_1000209 Ga0209026_100020917 187
178 3300025292 Ga0209676_1001309 Ga0209676_10013096 187
179 3300025297 Ga0209758_1007533 Ga0209758_10075339 187
180 3300025298 Ga0209050_1063029 Ga0209050_10630292 187
181 3300025302 Ga0207426_1000834 Ga0207426_100083412 187
182 3300025302 Ga0207426_1003571 Ga0207426_10035718 187
183 3300025903 Ga0207680_10513847 Ga0207680_105138472 187
184 3300025909 Ga0207705_10395065 Ga0207705_103950652 187
185 3300025911 Ga0207654_10006179 Ga0207654_100061792 187
186 3300025912 Ga0207707_10271252 Ga0207707_102712522 187
187 3300025913 Ga0207695_10011532 Ga0207695_100115326 187
188 3300025913 Ga0207695_10564416 Ga0207695_105644161 187
189 3300025921 Ga0207652_10213149 Ga0207652_102131492 187
190 3300025944 Ga0207661_10857511 Ga0207661_108575112 187
191 3300025949 Ga0207667_10005433 Ga0207667_100054339 187
192 3300026041 Ga0207639_10022547 Ga0207639_100225473 187
193 3300026041 Ga0207639_10146184 Ga0207639_101461842 187
194 3300026078 Ga0207702_10031027 Ga0207702_100310272 187
195 3300027526 Ga0209968_1053922 Ga0209968_10539221 187
196 3300031456 Ga0307513_10056045 Ga0307513_100560453 187
197 3300031730 Ga0307516_10004755 Ga0307516_100047552 187
198 3300031852 Ga0307410_10533071 Ga0307410_105330712 187
199 3300031911 Ga0307412_10059438 Ga0307412_100594382 187
200 3300032002 Ga0307416_100220617 Ga0307416_1002206172 187
201 3300033179 Ga0307507_10147968 Ga0307507_101479682 187
202 3300041452 Ga0451793_1644305 Ga0451793_1644305_38_619 187
203 3300042876 Ga0451577_0109062 Ga0451577_0109062_1482_2051 187
204 3300042876 Ga0451577_0336024 Ga0451577_0336024_507_1070 187
205 3300046460 Ga0495638_0245634 Ga0495638_0245634_96_665 187
206 3300046474 Ga0495605_0030793 Ga0495605_0030793_842_1408 187
207 3300046616 Ga0495668_0005306 Ga0495668_0005306_3025_3588 187
208 3300046665 Ga0495661_0192979 Ga0495661_0192979_68_634 187
209 3300047472 Ga0495686_0033353 Ga0495686_0033353_1628_2197 187
210 3300049571 Ga0501034_0000043 Ga0501034_0000043_58148_58711 187
211 3300049571 Ga0501034_0062004 Ga0501034_0062004_2138_2701 187
212 3300049581 Ga0501047_0017094 Ga0501047_0017094_6237_6806 187
213 3300049822 Ga0501035_0501499 Ga0501035_0501499_312_881 187
214 3300050507 nmdc:mga05p37_81924_c3 nmdc:mga05p37_81924_c3_42_605 187
215 3300050508 nmdc:mga09592_140131_c1 nmdc:mga09592_140131_c1_717_1280 187
216 3300053090 Ga0500646_0085194 Ga0500646_0085194_109_672 187
217 3300053121 Ga0500607_152644 Ga0500607_152644_344_907 187
218 3300053131 Ga0500652_018790 Ga0500652_018790_1428_1991 187
219 3300053134 Ga0500658_0016284 Ga0500658_0016284_889_1452 187
220 3300053142 Ga0500577_0001794 Ga0500577_0001794_2683_3246 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04143

Sulf_transp

Sulphur transport

135

203

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_P33359_41_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.2569 38 186 1.10.3720.10
3lpzA01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.256 58 100 1.25.40.10
af_A8DZA0_713_830_1.20.1390.10 Mainly Alpha;Up-down Bundle;PWI domain;PWI domain 0.2295 88 165 1.20.1390.10
af_P33359_41_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.2189 38 186 1.10.3720.10
af_Q5TZA6_281_441_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.1811 44 186 3.30.710.10
ID Description Score Start End GO Terms
AF-A0A520B1T2-F1-model_v4 YeeE/YedE family protein 0.8565 1 110 GO:0005886
AF-A0A4Q3SZV7-F1-model_v4 deleted 0.8535 1 101
AF-A0A7C7KD14-F1-model_v4 deleted 0.8521 1 121
AF-A0A520B1T2-F1-model_v4 YeeE/YedE family protein 0.8498 1 110 GO:0005886
AF-A0A4Q3SZV7-F1-model_v4 deleted 0.8389 1 101

Feature Viewer

pLDDT pTM Quality
73.53 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map