F331674

General Info

Members Datasets Scaffolds Average Seq Length
219 142 438 274

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2913844669|2913850641
Length 261
Sequence LFCGGLGARMREYSESIPKPMVNIGYRPILWHVMKYYAHYGHKDFILCLGYKSDLIKSYFLNYNEWLSNNFSLSNGSQIQLFNRDIQDWNITFVDTGLTANIGQRFKAVEKYLEGEEVFLANYSDGLTDLHLPTYINNFYQRDKIGSFLCVRPSQTFHLVDMKEDGLVKNIQDVKQCDIWINGGYFIFKKEIFNYINYGEELVMEPFQRLIAKEELFAYKYTGFFGVMDTFKEKQQLDDMYAQGQRPWEVWGDEQVQVDHV

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.37
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 0
Rhizoplane 0.91
Rhizosphere 95.43
Stem 0
Stem Tuber 0
Unclassified 16.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6238115 2162886011 Bacteria 2881
2 MRS1b_contig_9121370 2162886011 Bacteria 2520
3 Ga0058863_11002120 3300004799 Unclassified 3682
4 Ga0058861_10638598 3300004800 Unclassified 1425
5 Ga0058862_10104198 3300004803 Bacteria 6230
6 Ga0065714_10105840 3300005288 Bacteria 1559
7 Ga0065712_10067800 3300005290 Bacteria 32046
8 Ga0065712_10068254 3300005290 Bacteria 12410
9 Ga0065715_10000174 3300005293 Bacteria 48416
10 Ga0065715_10000178 3300005293 Bacteria 41026
11 Ga0065707_10168475 3300005295 Bacteria 1503
12 Ga0070658_10307144 3300005327 Bacteria 1353
13 Ga0070670_100000314 3300005331 Bacteria 41552
14 Ga0068869_100097500 3300005334 Bacteria 2220
15 Ga0070666_10009183 3300005335 Bacteria 6163
16 Ga0070680_100002073 3300005336 Bacteria 14800
17 Ga0070660_100008558 3300005339 Bacteria 7164
18 Ga0070661_100043042 3300005344 Bacteria 3298
19 Ga0070661_100161320 3300005344 Unclassified 1698
20 Ga0070669_100063411 3300005353 Bacteria 2720
21 Ga0070669_100122434 3300005353 Bacteria 1986
22 Ga0070669_100273108 3300005353 Unclassified 1352
23 Ga0070675_100013515 3300005354 Bacteria 6417
24 Ga0070675_100083412 3300005354 Bacteria 2668
25 Ga0070675_100230821 3300005354 Bacteria 1614
26 Ga0070673_100164879 3300005364 Bacteria 1887
27 Ga0070673_100342927 3300005364 Bacteria 1324
28 Ga0070659_100015307 3300005366 Bacteria 5743
29 Ga0070659_100095475 3300005366 Bacteria 2388
30 Ga0070714_100024491 3300005435 Unclassified 4972
31 Ga0070713_100124238 3300005436 Bacteria 2268
32 Ga0070713_100366428 3300005436 Bacteria 1340
33 Ga0070701_10026698 3300005438 Bacteria 2819
34 Ga0070705_100466962 3300005440 Unclassified 950
35 Ga0070662_100045684 3300005457 Unclassified 3144
36 Ga0070662_100049465 3300005457 Unclassified 3031
37 Ga0070681_10043548 3300005458 Unclassified 4496
38 Ga0070681_10215343 3300005458 Unclassified 1837
39 Ga0070706_100019384 3300005467 Bacteria 6274
40 Ga0070699_100045349 3300005518 Bacteria 3805
41 Ga0070699_100186665 3300005518 Bacteria 1841
42 Ga0070679_100026878 3300005530 Bacteria 5660
43 Ga0070684_100297371 3300005535 Bacteria 1481
44 Ga0070697_100021805 3300005536 Bacteria 5078
45 Ga0070686_100080148 3300005544 Bacteria 2160
46 Ga0070695_100015071 3300005545 Bacteria 4666
47 Ga0070695_100187328 3300005545 Bacteria 1470
48 Ga0070696_100075944 3300005546 Unclassified 2371
49 Ga0070696_100167226 3300005546 Bacteria 1623
50 Ga0070693_100215510 3300005547 Bacteria 1255
51 Ga0070665_100011793 3300005548 Bacteria 8826
52 Ga0070704_100081761 3300005549 Bacteria 2380
53 Ga0068855_100188728 3300005563 Bacteria 2326
54 Ga0070664_100020018 3300005564 Bacteria 5509
55 Ga0068857_100041293 3300005577 Bacteria 4091
56 Ga0068857_100212109 3300005577 Bacteria 1767
57 Ga0068856_100023702 3300005614 Bacteria 5968
58 Ga0068858_100303092 3300005842 Bacteria 1525
59 Ga0068862_100060570 3300005844 Unclassified 3252
60 Ga0081538_10046522 3300005981 Bacteria 2674
61 Ga0081538_10164884 3300005981 Bacteria 977
62 Ga0070716_100092093 3300006173 Bacteria 1837
63 Ga0070712_100223372 3300006175 Bacteria 1492
64 Ga0075366_10029267 3300006195 Bacteria 3236
65 Ga0075370_10052708 3300006353 Bacteria 2309
66 Ga0075428_100012986 3300006844 Bacteria 9261
67 Ga0075428_100036672 3300006844 Bacteria 5400
68 Ga0075428_100083017 3300006844 Bacteria 3496
69 Ga0075431_100008374 3300006847 Bacteria 10346
70 Ga0075431_100233708 3300006847 Bacteria 1872
71 Ga0075433_10001746 3300006852 Bacteria 16235
72 Ga0075433_10021006 3300006852 Bacteria 5469
73 Ga0075433_10048359 3300006852 Bacteria 3698
74 Ga0075433_10137435 3300006852 Bacteria 2172
75 Ga0075433_10314794 3300006852 Bacteria 1385
76 Ga0075434_100001803 3300006871 Bacteria 18515
77 Ga0075434_100029911 3300006871 Bacteria 5361
78 Ga0075434_100048923 3300006871 Unclassified 4196
79 Ga0075434_100068351 3300006871 Bacteria 3539
80 Ga0075434_100077950 3300006871 Bacteria 3309
81 Ga0075434_100081294 3300006871 Bacteria 3237
82 Ga0075429_100053300 3300006880 Unclassified 3520
83 Ga0075429_100055396 3300006880 Bacteria 3450
84 Ga0075429_100075830 3300006880 Bacteria 2929
85 Ga0075436_100008501 3300006914 Bacteria 7017
86 Ga0075436_100066407 3300006914 Bacteria 2493
87 Ga0075435_100046891 3300007076 Bacteria 3468
88 Ga0075435_100062992 3300007076 Unclassified 3011
89 Ga0075435_100100470 3300007076 Unclassified 2396
90 Ga0111539_10028181 3300009094 Bacteria 6856
91 Ga0111539_10041172 3300009094 Bacteria 5555
92 Ga0111539_10245760 3300009094 Bacteria 2083
93 Ga0111539_10429825 3300009094 Bacteria 1538
94 Ga0111539_10835078 3300009094 Unclassified 1072
95 Ga0105245_10223264 3300009098 Bacteria 1819
96 Ga0105245_10241406 3300009098 Bacteria 1751
97 Ga0114129_10001578 3300009147 Bacteria 30952
98 Ga0114129_10013028 3300009147 Bacteria 11844
99 Ga0114129_10080485 3300009147 Bacteria 4528
100 Ga0114129_10107894 3300009147 Bacteria 3844
101 Ga0114129_10327151 3300009147 Bacteria 2036
102 Ga0114129_10628974 3300009147 Bacteria 1387
103 Ga0105241_10169165 3300009174 Bacteria 1804
104 Ga0105242_10192465 3300009176 Bacteria 1807
105 Ga0105248_10361825 3300009177 Bacteria 1633
106 Ga0105239_10358969 3300010375 Bacteria 1645
107 Ga0105246_10019807 3300011119 Unclassified 4309
108 Ga0105246_10575503 3300011119 Bacteria 969
109 Ga0157370_10101008 3300013104 Bacteria 2702
110 Ga0157378_10029428 3300013297 Unclassified 4848
111 Ga0157378_10074679 3300013297 Bacteria 3051
112 Ga0157378_10185434 3300013297 Unclassified 1959
113 Ga0157378_10349652 3300013297 Bacteria 1444
114 Ga0157378_10531668 3300013297 Bacteria 1179
115 Ga0163162_10528737 3300013306 Bacteria 1308
116 Ga0157372_10128905 3300013307 Unclassified 2910
117 Ga0157372_10530899 3300013307 Bacteria 1372
118 Ga0157375_10495820 3300013308 Bacteria 1386
119 Ga0157380_10444805 3300014326 Bacteria 1243
120 Ga0157376_10196815 3300014969 Bacteria 1852
121 Ga0213876_10101728 3300021384 Bacteria 1524
122 Ga0207697_10004290 3300025315 Bacteria 6837
123 Ga0207680_10024949 3300025903 Bacteria 3291
124 Ga0207699_10055436 3300025906 Bacteria 2359
125 Ga0207705_10277276 3300025909 Bacteria 1283
126 Ga0207684_10011829 3300025910 Bacteria 7608
127 Ga0207684_10485963 3300025910 Bacteria 1059
128 Ga0207707_10002716 3300025912 Bacteria 15805
129 Ga0207660_10354187 3300025917 Bacteria 1177
130 Ga0207662_10010530 3300025918 Bacteria 5110
131 Ga0207657_10027964 3300025919 Bacteria 5154
132 Ga0207649_10141085 3300025920 Bacteria 1649
133 Ga0207652_10007322 3300025921 Bacteria 8893
134 Ga0207681_10099106 3300025923 Bacteria 2098
135 Ga0207681_10231539 3300025923 Bacteria 1434
136 Ga0207650_10000193 3300025925 Bacteria 70652
137 Ga0207659_10052624 3300025926 Bacteria 2901
138 Ga0207659_10063479 3300025926 Bacteria 2670
139 Ga0207659_10289822 3300025926 Bacteria 1341
140 Ga0207687_10436753 3300025927 Bacteria 1083
141 Ga0207700_10344283 3300025928 Unclassified 1297
142 Ga0207664_10074944 3300025929 Unclassified 2735
143 Ga0207644_10060347 3300025931 Bacteria 2744
144 Ga0207690_10014311 3300025932 Unclassified 4791
145 Ga0207706_10006882 3300025933 Bacteria 10514
146 Ga0207706_10048143 3300025933 Unclassified 3770
147 Ga0207706_10067389 3300025933 Unclassified 3149
148 Ga0207691_10003776 3300025940 Bacteria 14704
149 Ga0207689_10102127 3300025942 Bacteria 2355
150 Ga0207679_10001111 3300025945 Bacteria 17128
151 Ga0207667_10379189 3300025949 Bacteria 1441
152 Ga0207651_10239242 3300025960 Bacteria 1478
153 Ga0207668_10099584 3300025972 Bacteria 2157
154 Ga0207703_10096328 3300026035 Unclassified 2498
155 Ga0207702_10053132 3300026078 Bacteria 3430
156 Ga0207648_10580259 3300026089 Bacteria 1032
157 Ga0209588_1029673 3300027671 Bacteria 1745
158 Ga0268266_10035220 3300028379 Bacteria 4258
159 Ga0268265_10315950 3300028380 Bacteria 1412
160 Ga0265337_1002218 3300028556 Bacteria 9031
161 Ga0265332_10021596 3300031238 Bacteria 2843
162 Ga0265320_10000988 3300031240 Bacteria 21174
163 Ga0265325_10000842 3300031241 Bacteria 22229
164 Ga0265340_10001356 3300031247 Bacteria 14040
165 Ga0265339_10011185 3300031249 Bacteria 5537
166 Ga0265331_10000792 3300031250 Bacteria 26282
167 Ga0307408_100052650 3300031548 Bacteria 2937
168 Ga0265313_10001268 3300031595 Bacteria 23991
169 Ga0265314_10000078 3300031711 Bacteria 145069
170 Ga0265314_10091771 3300031711 Bacteria 1976
171 Ga0265342_10008213 3300031712 Bacteria 7520
172 Ga0307516_10001844 3300031730 Bacteria 29094
173 Ga0373934_0034103 3300035086 Bacteria 2000
174 Ga0436365_0492170 3300039437 Plasmid 2995
175 Ga0451807_0568858 3300041486 Bacteria 6420
176 Ga0466960_0206910 3300044901 Bacteria 1074
177 Ga0451576_0039464 3300045051 Unclassified 4997
178 Ga0495580_0008087 3300046472 Bacteria 8390
179 Ga0495622_0162876 3300046557 Bacteria 1005
180 Ga0495602_0078862 3300048088 Bacteria 2780
181 Ga0496112_0052630 3300048915 Bacteria 3996
182 Ga0501042_0035652 3300049578 Bacteria 3529
183 Ga0501048_0088554 3300049582 Unclassified 2184
184 Ga0501071_0003611 3300049587 Bacteria 9696
185 Ga0501075_0051155 3300049591 Bacteria 3106
186 Ga0501076_0014004 3300049592 Bacteria 6026
187 Ga0501077_0137683 3300049593 Unclassified 1548
188 nmdc:mga06z11_49521_c1 3300050494 Bacteria 2144
189 nmdc:mga07m45_109907_c1 3300050496 Bacteria 1587
190 nmdc:mga05p37_101051_c1 3300050507 Bacteria 3552
191 nmdc:mga05p37_106262_c1 3300050507 Bacteria 3454
192 nmdc:mga05p37_156675_c1 3300050507 Bacteria 2783
193 nmdc:mga05p37_2631_c1 3300050507 Bacteria 20907
194 nmdc:mga05p37_29296_c1 3300050507 Bacteria 6718
195 nmdc:mga05p37_658_c1 3300050507 Bacteria 38217
196 nmdc:mga09592_16313_c1 3300050508 Bacteria 6075
197 nmdc:mga09592_49683_c1 3300050508 Unclassified 3536
198 nmdc:mga0qj67_214972_c1 3300050509 Bacteria 1561
199 nmdc:mga0qj67_233250_c1 3300050509 Bacteria 1493
200 nmdc:mga06r32_25685_c1 3300050510 Bacteria 5483
201 nmdc:mga06r32_4149_c1 3300050510 Bacteria 12976
202 nmdc:mga08y16_18932_c1 3300050511 Bacteria 7250
203 nmdc:mga08y16_31467_c1 3300050511 Bacteria 5580
204 nmdc:mga08y16_361453_c1 3300050511 Unclassified 1490
205 nmdc:mga0n895_218123_c1 3300050512 Bacteria 1937
206 nmdc:mga0n895_229457_c1 3300050512 Unclassified 1885
207 nmdc:mga0n895_4107_c1 3300050512 Bacteria 11858
208 nmdc:mga0n895_86322_c1 3300050512 Bacteria 3134
209 nmdc:mga0rr50_139214_c1 3300050513 Unclassified 1951
210 nmdc:mga0rr50_225505_c1 3300050513 Bacteria 1549
211 nmdc:mga0rr50_240257_c1 3300050513 Bacteria 1501
212 nmdc:mga0rr50_51603_c1 3300050513 Unclassified 3053
213 nmdc:mga08x19_94917_c1 3300050514 Bacteria 1973
214 nmdc:mga0a205_119772_c1 3300050515 Unclassified 2531
215 nmdc:mga0a205_153289_c1 3300050515 Bacteria 2203
216 nmdc:mga0a205_19188_c1 3300050515 Bacteria 6444
217 nmdc:mga0a205_381345_c1 3300050515 Bacteria 1275
218 Ga0501082_0218568 3300060353 Unclassified 1658
219 2913850641 2913844669 Bacteria 8381711
220 MRS1b_contig_6238115
221 MRS1b_contig_9121370
222 Ga0058863_11002120
223 Ga0058861_10638598
224 Ga0058862_10104198
225 Ga0065714_10105840
226 Ga0065712_10067800
227 Ga0065712_10068254
228 Ga0065715_10000174
229 Ga0065715_10000178
230 Ga0065707_10168475
231 Ga0070658_10307144
232 Ga0070670_100000314
233 Ga0068869_100097500
234 Ga0070666_10009183
235 Ga0070680_100002073
236 Ga0070660_100008558
237 Ga0070661_100043042
238 Ga0070661_100161320
239 Ga0070669_100063411
240 Ga0070669_100122434
241 Ga0070669_100273108
242 Ga0070675_100013515
243 Ga0070675_100083412
244 Ga0070675_100230821
245 Ga0070673_100164879
246 Ga0070673_100342927
247 Ga0070659_100015307
248 Ga0070659_100095475
249 Ga0070714_100024491
250 Ga0070713_100124238
251 Ga0070713_100366428
252 Ga0070701_10026698
253 Ga0070705_100466962
254 Ga0070662_100045684
255 Ga0070662_100049465
256 Ga0070681_10043548
257 Ga0070681_10215343
258 Ga0070706_100019384
259 Ga0070699_100045349
260 Ga0070699_100186665
261 Ga0070679_100026878
262 Ga0070684_100297371
263 Ga0070697_100021805
264 Ga0070686_100080148
265 Ga0070695_100015071
266 Ga0070695_100187328
267 Ga0070696_100075944
268 Ga0070696_100167226
269 Ga0070693_100215510
270 Ga0070665_100011793
271 Ga0070704_100081761
272 Ga0068855_100188728
273 Ga0070664_100020018
274 Ga0068857_100041293
275 Ga0068857_100212109
276 Ga0068856_100023702
277 Ga0068858_100303092
278 Ga0068862_100060570
279 Ga0081538_10046522
280 Ga0081538_10164884
281 Ga0070716_100092093
282 Ga0070712_100223372
283 Ga0075366_10029267
284 Ga0075370_10052708
285 Ga0075428_100012986
286 Ga0075428_100036672
287 Ga0075428_100083017
288 Ga0075431_100008374
289 Ga0075431_100233708
290 Ga0075433_10001746
291 Ga0075433_10021006
292 Ga0075433_10048359
293 Ga0075433_10137435
294 Ga0075433_10314794
295 Ga0075434_100001803
296 Ga0075434_100029911
297 Ga0075434_100048923
298 Ga0075434_100068351
299 Ga0075434_100077950
300 Ga0075434_100081294
301 Ga0075429_100053300
302 Ga0075429_100055396
303 Ga0075429_100075830
304 Ga0075436_100008501
305 Ga0075436_100066407
306 Ga0075435_100046891
307 Ga0075435_100062992
308 Ga0075435_100100470
309 Ga0111539_10028181
310 Ga0111539_10041172
311 Ga0111539_10245760
312 Ga0111539_10429825
313 Ga0111539_10835078
314 Ga0105245_10223264
315 Ga0105245_10241406
316 Ga0114129_10001578
317 Ga0114129_10013028
318 Ga0114129_10080485
319 Ga0114129_10107894
320 Ga0114129_10327151
321 Ga0114129_10628974
322 Ga0105241_10169165
323 Ga0105242_10192465
324 Ga0105248_10361825
325 Ga0105239_10358969
326 Ga0105246_10019807
327 Ga0105246_10575503
328 Ga0157370_10101008
329 Ga0157378_10029428
330 Ga0157378_10074679
331 Ga0157378_10185434
332 Ga0157378_10349652
333 Ga0157378_10531668
334 Ga0163162_10528737
335 Ga0157372_10128905
336 Ga0157372_10530899
337 Ga0157375_10495820
338 Ga0157380_10444805
339 Ga0157376_10196815
340 Ga0213876_10101728
341 Ga0207697_10004290
342 Ga0207680_10024949
343 Ga0207699_10055436
344 Ga0207705_10277276
345 Ga0207684_10011829
346 Ga0207684_10485963
347 Ga0207707_10002716
348 Ga0207660_10354187
349 Ga0207662_10010530
350 Ga0207657_10027964
351 Ga0207649_10141085
352 Ga0207652_10007322
353 Ga0207681_10099106
354 Ga0207681_10231539
355 Ga0207650_10000193
356 Ga0207659_10052624
357 Ga0207659_10063479
358 Ga0207659_10289822
359 Ga0207687_10436753
360 Ga0207700_10344283
361 Ga0207664_10074944
362 Ga0207644_10060347
363 Ga0207690_10014311
364 Ga0207706_10006882
365 Ga0207706_10048143
366 Ga0207706_10067389
367 Ga0207691_10003776
368 Ga0207689_10102127
369 Ga0207679_10001111
370 Ga0207667_10379189
371 Ga0207651_10239242
372 Ga0207668_10099584
373 Ga0207703_10096328
374 Ga0207702_10053132
375 Ga0207648_10580259
376 Ga0209588_1029673
377 Ga0268266_10035220
378 Ga0268265_10315950
379 Ga0265337_1002218
380 Ga0265332_10021596
381 Ga0265320_10000988
382 Ga0265325_10000842
383 Ga0265340_10001356
384 Ga0265339_10011185
385 Ga0265331_10000792
386 Ga0307408_100052650
387 Ga0265313_10001268
388 Ga0265314_10000078
389 Ga0265314_10091771
390 Ga0265342_10008213
391 Ga0307516_10001844
392 Ga0373934_0034103
393 Ga0436365_0492170
394 Ga0451807_0568858
395 Ga0466960_0206910
396 Ga0451576_0039464
397 Ga0495580_0008087
398 Ga0495622_0162876
399 Ga0495602_0078862
400 Ga0496112_0052630
401 Ga0501042_0035652
402 Ga0501048_0088554
403 Ga0501071_0003611
404 Ga0501075_0051155
405 Ga0501076_0014004
406 Ga0501077_0137683
407 nmdc:mga06z11_49521_c1
408 nmdc:mga07m45_109907_c1
409 nmdc:mga05p37_101051_c1
410 nmdc:mga05p37_106262_c1
411 nmdc:mga05p37_156675_c1
412 nmdc:mga05p37_2631_c1
413 nmdc:mga05p37_29296_c1
414 nmdc:mga05p37_658_c1
415 nmdc:mga09592_16313_c1
416 nmdc:mga09592_49683_c1
417 nmdc:mga0qj67_214972_c1
418 nmdc:mga0qj67_233250_c1
419 nmdc:mga06r32_25685_c1
420 nmdc:mga06r32_4149_c1
421 nmdc:mga08y16_18932_c1
422 nmdc:mga08y16_31467_c1
423 nmdc:mga08y16_361453_c1
424 nmdc:mga0n895_218123_c1
425 nmdc:mga0n895_229457_c1
426 nmdc:mga0n895_4107_c1
427 nmdc:mga0n895_86322_c1
428 nmdc:mga0rr50_139214_c1
429 nmdc:mga0rr50_225505_c1
430 nmdc:mga0rr50_240257_c1
431 nmdc:mga0rr50_51603_c1
432 nmdc:mga08x19_94917_c1
433 nmdc:mga0a205_119772_c1
434 nmdc:mga0a205_153289_c1
435 nmdc:mga0a205_19188_c1
436 nmdc:mga0a205_381345_c1
437 Ga0501082_0218568
438 2913850641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

1

226

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8719 2 256
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8668 2 256
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8558 2 256
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8539 2 256
4y7v-assembly1.cif.gz_A structural analysis of muru 0.8277 1 247
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8719 2 256 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8558 2 256 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8313 95 233 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8277 1 247 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8206 1 247 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V9WC51-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9894 135 257 GO:0047343
AF-A0A1Q7ZZV2-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9856 26 257 GO:0047343
AF-A0A2V7ESB7-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9842 1 257 GO:0009058
GO:0047343
AF-A0A3B8ZAJ3-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9841 1 261 GO:0009058
GO:0047343
AF-A0A2V7G304-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.981 90 257 GO:0047343

Map