F331651

General Info

Members Datasets Scaffolds Average Seq Length
219 151 438 214

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675903058|2676477622
Length 255
Sequence AGGGSRTVRGRANPPGRTKQEPKPQSRQGSQDRQAANGRPLRIILVDDHEMVLEGLKALLARFRGRVRIVAQSVSADAAEPMVAALDPDLVVSDVRLRGSVSGLDLCRRLVETTPGRRVVLLSAYDDEQYLFQALRAGAAGYLLKSIDREELVRMLERAARGETVVDPSMAGRAVASAARLQAGEFWPGAHLGLSQRESEVLGFLVSGLSNRAIAGKLVLGEETVKTHVRSIFRKLSVNDRAGAVAVALREGIFR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
79 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
92 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
103 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
104 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
105 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
148 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
149 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
150 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
151 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.89
Metatranscriptomes 1.83
Isolates 2.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0.46
Rhizoplane 2.74
Rhizosphere 92.24
Stem 0
Stem Tuber 0.46
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10278510 3300005327 Bacteria 1423
2 Ga0070683_100002182 3300005329 Bacteria 15487
3 Ga0070683_100023326 3300005329 Bacteria 5534
4 Ga0070683_100143157 3300005329 Bacteria 2265
5 Ga0070683_100299738 3300005329 Bacteria 1529
6 Ga0070683_100338530 3300005329 Bacteria 1432
7 Ga0070680_100032416 3300005336 Bacteria 4206
8 Ga0070682_100039763 3300005337 Bacteria 2891
9 Ga0070661_100023586 3300005344 Bacteria 4411
10 Ga0070703_10020445 3300005406 Bacteria 1926
11 Ga0070709_10209248 3300005434 Bacteria 1386
12 Ga0070714_100083887 3300005435 Bacteria 2780
13 Ga0070700_100042163 3300005441 Bacteria 2801
14 Ga0070708_100023394 3300005445 Bacteria 5255
15 Ga0070708_100183567 3300005445 Bacteria 1956
16 Ga0070708_100197435 3300005445 Bacteria 1883
17 Ga0070663_100175342 3300005455 Bacteria 1660
18 Ga0070681_10042805 3300005458 Bacteria 4537
19 Ga0070681_10043775 3300005458 Bacteria 4482
20 Ga0070681_10049965 3300005458 Bacteria 4174
21 Ga0070681_10051041 3300005458 Bacteria 4126
22 Ga0070681_10126604 3300005458 Bacteria 2487
23 Ga0070706_100048566 3300005467 Bacteria 3917
24 Ga0070706_100074125 3300005467 Bacteria 3151
25 Ga0070707_100083867 3300005468 Bacteria 3079
26 Ga0070707_100144670 3300005468 Bacteria 2314
27 Ga0070707_100858736 3300005468 Bacteria 872
28 Ga0070698_100009399 3300005471 Bacteria 10478
29 Ga0070698_100016505 3300005471 Bacteria 7792
30 Ga0070698_100020381 3300005471 Bacteria 6950
31 Ga0070698_100793199 3300005471 Bacteria 891
32 Ga0070698_101003346 3300005471 Bacteria 782
33 Ga0070699_100005161 3300005518 Bacteria 11486
34 Ga0070699_100023745 3300005518 Bacteria 5282
35 Ga0070699_100206327 3300005518 Bacteria 1748
36 Ga0070679_100010951 3300005530 Bacteria 8619
37 Ga0070679_100034551 3300005530 Bacteria 5011
38 Ga0070679_100546406 3300005530 Bacteria 1102
39 Ga0070684_100007340 3300005535 Bacteria 8568
40 Ga0070684_100180750 3300005535 Bacteria 1918
41 Ga0070697_100002553 3300005536 Bacteria 14017
42 Ga0070697_100131217 3300005536 Bacteria 2101
43 Ga0070696_100318273 3300005546 Bacteria 1197
44 Ga0070665_100375742 3300005548 Bacteria 1428
45 Ga0070704_100181462 3300005549 Bacteria 1684
46 Ga0068855_100330837 3300005563 Bacteria 1682
47 Ga0068857_100064485 3300005577 Bacteria 3257
48 Ga0068856_100015023 3300005614 Bacteria 7479
49 Ga0068856_100224007 3300005614 Bacteria 1896
50 Ga0068852_100125435 3300005616 Bacteria 2357
51 Ga0068858_100327408 3300005842 Bacteria 1465
52 Ga0081455_10003730 3300005937 Bacteria 17412
53 Ga0081455_10010980 3300005937 Bacteria 9129
54 Ga0081455_10016635 3300005937 Bacteria 7091
55 Ga0081538_10006370 3300005981 Bacteria 10412
56 Ga0070717_10003502 3300006028 Bacteria 11235
57 Ga0070717_10463830 3300006028 Bacteria 1143
58 Ga0070716_100012401 3300006173 Bacteria 4320
59 Ga0070716_100168026 3300006173 Bacteria 1429
60 Ga0070712_100052050 3300006175 Bacteria 2854
61 Ga0075428_100120099 3300006844 Bacteria 2861
62 Ga0075433_10061545 3300006852 Bacteria 3288
63 Ga0075433_10114013 3300006852 Bacteria 2398
64 Ga0075434_100539477 3300006871 Bacteria 1186
65 Ga0099826_10059980 3300006948 Bacteria 2482
66 Ga0075435_100034455 3300007076 Bacteria 4012
67 Ga0105240_10140054 3300009093 Bacteria 2893
68 Ga0111539_10517178 3300009094 Bacteria 1390
69 Ga0111539_10679711 3300009094 Bacteria 1198
70 Ga0105245_10001301 3300009098 Bacteria 22534
71 Ga0114129_10977055 3300009147 Bacteria 1068
72 Ga0105242_10733103 3300009176 Bacteria 971
73 Ga0105237_10141374 3300009545 Bacteria 2401
74 Ga0105238_10008183 3300009551 Bacteria 10459
75 Ga0105239_10074566 3300010375 Bacteria 3730
76 Ga0157370_10013213 3300013104 Bacteria 8514
77 Ga0157369_10024992 3300013105 Bacteria 6635
78 Ga0157369_10028056 3300013105 Bacteria 6234
79 Ga0157372_11346390 3300013307 Bacteria 823
80 Ga0182008_10075586 3300014497 Bacteria 1657
81 Ga0206354_10785456 3300020081 Bacteria 1863
82 Ga0206354_11504235 3300020081 Bacteria 3366
83 Ga0206353_10567461 3300020082 Bacteria 1888
84 Ga0206353_11905071 3300020082 Bacteria 1542
85 Ga0213876_10014302 3300021384 Bacteria 4207
86 Ga0207653_10023973 3300025885 Bacteria 1946
87 Ga0207699_10203932 3300025906 Bacteria 1341
88 Ga0207705_10201439 3300025909 Bacteria 1508
89 Ga0207684_10819313 3300025910 Bacteria 786
90 Ga0207707_10008182 3300025912 Bacteria 9074
91 Ga0207707_10016660 3300025912 Bacteria 6406
92 Ga0207707_10022349 3300025912 Bacteria 5529
93 Ga0207695_10869825 3300025913 Bacteria 781
94 Ga0207671_10130038 3300025914 Bacteria 1932
95 Ga0207693_10024223 3300025915 Bacteria 4819
96 Ga0207660_10013194 3300025917 Bacteria 5411
97 Ga0207657_10086730 3300025919 Bacteria 2619
98 Ga0207649_10072436 3300025920 Bacteria 2204
99 Ga0207652_10012430 3300025921 Bacteria 6880
100 Ga0207652_10018964 3300025921 Bacteria 5649
101 Ga0207646_10067203 3300025922 Bacteria 3200
102 Ga0207646_10139896 3300025922 Bacteria 2180
103 Ga0207646_10384690 3300025922 Bacteria 1267
104 Ga0207687_10015500 3300025927 Bacteria 4998
105 Ga0207700_10000001 3300025928 Bacteria 1122509
106 Ga0207700_10062079 3300025928 Bacteria 2837
107 Ga0207664_10027769 3300025929 Bacteria 4295
108 Ga0207664_10789423 3300025929 Bacteria 854
109 Ga0207690_10011813 3300025932 Bacteria 5223
110 Ga0207665_10005204 3300025939 Bacteria 8687
111 Ga0207661_10021087 3300025944 Bacteria 4880
112 Ga0207661_10135347 3300025944 Bacteria 2115
113 Ga0207661_10180028 3300025944 Bacteria 1846
114 Ga0207667_10579788 3300025949 Bacteria 1132
115 Ga0207675_100463021 3300026118 Bacteria 1258
116 Ga0209966_1001549 3300027695 Bacteria 3995
117 Ga0207428_10103918 3300027907 Bacteria 2193
118 Ga0307515_10033931 3300028794 Bacteria 8380
119 Ga0307513_10004993 3300031456 Bacteria 17587
120 Ga0307514_10127127 3300031649 Bacteria 1763
121 Ga0316575_10010390 3300031665 Bacteria 3420
122 Ga0316575_10039481 3300031665 Bacteria 1863
123 Ga0316576_10004285 3300031727 Bacteria 8533
124 Ga0316576_10041745 3300031727 Bacteria 3304
125 Ga0316578_10001479 3300031728 Bacteria 9592
126 Ga0316577_10005191 3300031733 Bacteria 6806
127 Ga0316577_10009526 3300031733 Bacteria 5228
128 Ga0373932_0092015 3300035112 Bacteria 975
129 Ga0373941_0048740 3300035115 Bacteria 1339
130 Ga0373953_0149897 3300035117 Bacteria 1000
131 Ga0373960_0020530 3300035121 Bacteria 1748
132 Ga0316574_0011809 3300035398 Bacteria 4974
133 Ga0373931_0043830 3300035691 Bacteria 2358
134 Ga0373947_0302929 3300035725 Bacteria 1066
135 Ga0373937_0533025 3300036401 Bacteria 1115
136 Ga0316582_0003167 3300036647 Bacteria 7987
137 Ga0316582_0108614 3300036647 Bacteria 1844
138 Ga0316584_0020832 3300036712 Bacteria 4760
139 Ga0316584_0591416 3300036712 Bacteria 770
140 Ga0373925_0407902 3300037068 Bacteria 1109
141 Ga0395899_0026867 3300037312 Bacteria 4342
142 Ga0395899_0294049 3300037312 Bacteria 1101
143 Ga0395899_0535101 3300037312 Bacteria 755
144 Ga0395900_0002748 3300037418 Bacteria 19211
145 Ga0395900_0022679 3300037418 Bacteria 6425
146 Ga0395900_0053295 3300037418 Bacteria 4163
147 Ga0395898_0027569 3300037466 Bacteria 5699
148 Ga0395898_0052094 3300037466 Bacteria 3999
149 Ga0395898_0074213 3300037466 Bacteria 3286
150 Ga0395898_0354798 3300037466 Bacteria 1398
151 Ga0395905_0025980 3300037471 Bacteria 5521
152 Ga0395901_0021914 3300038443 Bacteria 6549
153 Ga0395901_0066147 3300038443 Bacteria 3765
154 Ga0395901_0173323 3300038443 Bacteria 2263
155 Ga0395901_0525328 3300038443 Bacteria 1202
156 Ga0436365_1764223 3300039437 Bacteria 7655
157 Ga0436363_1357223 3300039450 Bacteria 1306
158 Ga0436362_0684840 3300039453 Bacteria 794
159 Ga0439439_0038473 3300041406 Bacteria 1235
160 Ga0439448_0013578 3300042005 Bacteria 2449
161 Ga0439450_022749 3300042008 Bacteria 1356
162 Ga0439459_0015801 3300042438 Bacteria 1387
163 Ga0466966_0471754 3300044684 Bacteria 754
164 Ga0466961_0124501 3300044693 Bacteria 1618
165 Ga0466964_0029745 3300044706 Bacteria 2158
166 Ga0466971_0240538 3300044719 Bacteria 861
167 Ga0466959_0151762 3300045049 Bacteria 1633
168 Ga0466958_0014969 3300045836 Bacteria 4437
169 Ga0466967_0011044 3300045976 Bacteria 6815
170 Ga0466967_0011187 3300045976 Bacteria 6782
171 Ga0466967_0130848 3300045976 Bacteria 2329
172 Ga0495592_0013039 3300046454 Bacteria 6325
173 Ga0495629_0043058 3300046459 Bacteria 3171
174 Ga0495582_0329632 3300046473 Bacteria 879
175 Ga0495605_0003380 3300046474 Bacteria 9526
176 Ga0495594_0021866 3300046499 Bacteria 3417
177 Ga0495618_0038390 3300046514 Bacteria 3010
178 Ga0495666_0202974 3300046526 Bacteria 911
179 Ga0495656_0277169 3300046615 Bacteria 854
180 Ga0495634_0101552 3300046642 Bacteria 1858
181 Ga0495588_0168360 3300046674 Bacteria 1159
182 Ga0495647_0288165 3300046681 Bacteria 738
183 Ga0495624_0055320 3300046690 Bacteria 2500
184 Ga0495676_0022300 3300047321 Bacteria 5512
185 Ga0495686_0000579 3300047472 Bacteria 51834
186 Ga0496102_0019027 3300048905 Bacteria 6043
187 Ga0496104_0026253 3300048907 Bacteria 5376
188 Ga0496105_0082471 3300048908 Bacteria 2656
189 Ga0496109_0221120 3300048912 Bacteria 1781
190 Ga0496112_0040297 3300048915 Bacteria 4567
191 Ga0496115_0110911 3300048918 Bacteria 2254
192 Ga0496126_0199505 3300048929 Bacteria 1690
193 Ga0501047_0008121 3300049581 Bacteria 9906
194 Ga0501047_0085293 3300049581 Bacteria 3034
195 Ga0501047_0830837 3300049581 Bacteria 738
196 Ga0501070_0128080 3300049586 Bacteria 2098
197 Ga0501073_0244776 3300049589 Bacteria 1238
198 Ga0501073_0352415 3300049589 Bacteria 1016
199 Ga0501080_0068255 3300049742 Bacteria 3307
200 Ga0501080_0412759 3300049742 Bacteria 1214
201 nmdc:mga06r32_425612_c1 3300050510 Bacteria 1309
202 nmdc:mga08y16_30689_c1 3300050511 Bacteria 5654
203 nmdc:mga08y16_506746_c1 3300050511 Bacteria 1226
204 nmdc:mga0n895_683167_c1 3300050512 Bacteria 1024
205 nmdc:mga0rr50_351558_c1 3300050513 Bacteria 1240
206 nmdc:mga0rr50_9774_c1 3300050513 Bacteria 6054
207 nmdc:mga0a205_18394_c1 3300050515 Bacteria 6570
208 nmdc:mga0a205_384785_c1 3300050515 Bacteria 1268
209 nmdc:mga0a205_409696_c1 3300050515 Bacteria 1219
210 nmdc:mga0sz30_54640_c1 3300050516 Bacteria 1699
211 Ga0495655_0024022 3300053083 Bacteria 1412
212 Ga0501084_0970523 3300054114 Bacteria 714
213 Ga0530510_0115679 3300061734 Bacteria 1966
214 Ga0530510_0951339 3300061734 Bacteria 657
215 2676477622 2675903058 Bacteria 6822861
216 2515854982 2515154155 Bacteria 7985436
217 2827634462 2827628540 Bacteria 6858585
218 2899370669 2899370129 Bacteria 6781179
219 2902798044 2902792274 Bacteria 7270173
220 Ga0070658_10278510
221 Ga0070683_100002182
222 Ga0070683_100023326
223 Ga0070683_100143157
224 Ga0070683_100299738
225 Ga0070683_100338530
226 Ga0070680_100032416
227 Ga0070682_100039763
228 Ga0070661_100023586
229 Ga0070703_10020445
230 Ga0070709_10209248
231 Ga0070714_100083887
232 Ga0070700_100042163
233 Ga0070708_100023394
234 Ga0070708_100183567
235 Ga0070708_100197435
236 Ga0070663_100175342
237 Ga0070681_10042805
238 Ga0070681_10043775
239 Ga0070681_10049965
240 Ga0070681_10051041
241 Ga0070681_10126604
242 Ga0070706_100048566
243 Ga0070706_100074125
244 Ga0070707_100083867
245 Ga0070707_100144670
246 Ga0070707_100858736
247 Ga0070698_100009399
248 Ga0070698_100016505
249 Ga0070698_100020381
250 Ga0070698_100793199
251 Ga0070698_101003346
252 Ga0070699_100005161
253 Ga0070699_100023745
254 Ga0070699_100206327
255 Ga0070679_100010951
256 Ga0070679_100034551
257 Ga0070679_100546406
258 Ga0070684_100007340
259 Ga0070684_100180750
260 Ga0070697_100002553
261 Ga0070697_100131217
262 Ga0070696_100318273
263 Ga0070665_100375742
264 Ga0070704_100181462
265 Ga0068855_100330837
266 Ga0068857_100064485
267 Ga0068856_100015023
268 Ga0068856_100224007
269 Ga0068852_100125435
270 Ga0068858_100327408
271 Ga0081455_10003730
272 Ga0081455_10010980
273 Ga0081455_10016635
274 Ga0081538_10006370
275 Ga0070717_10003502
276 Ga0070717_10463830
277 Ga0070716_100012401
278 Ga0070716_100168026
279 Ga0070712_100052050
280 Ga0075428_100120099
281 Ga0075433_10061545
282 Ga0075433_10114013
283 Ga0075434_100539477
284 Ga0099826_10059980
285 Ga0075435_100034455
286 Ga0105240_10140054
287 Ga0111539_10517178
288 Ga0111539_10679711
289 Ga0105245_10001301
290 Ga0114129_10977055
291 Ga0105242_10733103
292 Ga0105237_10141374
293 Ga0105238_10008183
294 Ga0105239_10074566
295 Ga0157370_10013213
296 Ga0157369_10024992
297 Ga0157369_10028056
298 Ga0157372_11346390
299 Ga0182008_10075586
300 Ga0206354_10785456
301 Ga0206354_11504235
302 Ga0206353_10567461
303 Ga0206353_11905071
304 Ga0213876_10014302
305 Ga0207653_10023973
306 Ga0207699_10203932
307 Ga0207705_10201439
308 Ga0207684_10819313
309 Ga0207707_10008182
310 Ga0207707_10016660
311 Ga0207707_10022349
312 Ga0207695_10869825
313 Ga0207671_10130038
314 Ga0207693_10024223
315 Ga0207660_10013194
316 Ga0207657_10086730
317 Ga0207649_10072436
318 Ga0207652_10012430
319 Ga0207652_10018964
320 Ga0207646_10067203
321 Ga0207646_10139896
322 Ga0207646_10384690
323 Ga0207687_10015500
324 Ga0207700_10000001
325 Ga0207700_10062079
326 Ga0207664_10027769
327 Ga0207664_10789423
328 Ga0207690_10011813
329 Ga0207665_10005204
330 Ga0207661_10021087
331 Ga0207661_10135347
332 Ga0207661_10180028
333 Ga0207667_10579788
334 Ga0207675_100463021
335 Ga0209966_1001549
336 Ga0207428_10103918
337 Ga0307515_10033931
338 Ga0307513_10004993
339 Ga0307514_10127127
340 Ga0316575_10010390
341 Ga0316575_10039481
342 Ga0316576_10004285
343 Ga0316576_10041745
344 Ga0316578_10001479
345 Ga0316577_10005191
346 Ga0316577_10009526
347 Ga0373932_0092015
348 Ga0373941_0048740
349 Ga0373953_0149897
350 Ga0373960_0020530
351 Ga0316574_0011809
352 Ga0373931_0043830
353 Ga0373947_0302929
354 Ga0373937_0533025
355 Ga0316582_0003167
356 Ga0316582_0108614
357 Ga0316584_0020832
358 Ga0316584_0591416
359 Ga0373925_0407902
360 Ga0395899_0026867
361 Ga0395899_0294049
362 Ga0395899_0535101
363 Ga0395900_0002748
364 Ga0395900_0022679
365 Ga0395900_0053295
366 Ga0395898_0027569
367 Ga0395898_0052094
368 Ga0395898_0074213
369 Ga0395898_0354798
370 Ga0395905_0025980
371 Ga0395901_0021914
372 Ga0395901_0066147
373 Ga0395901_0173323
374 Ga0395901_0525328
375 Ga0436365_1764223
376 Ga0436363_1357223
377 Ga0436362_0684840
378 Ga0439439_0038473
379 Ga0439448_0013578
380 Ga0439450_022749
381 Ga0439459_0015801
382 Ga0466966_0471754
383 Ga0466961_0124501
384 Ga0466964_0029745
385 Ga0466971_0240538
386 Ga0466959_0151762
387 Ga0466958_0014969
388 Ga0466967_0011044
389 Ga0466967_0011187
390 Ga0466967_0130848
391 Ga0495592_0013039
392 Ga0495629_0043058
393 Ga0495582_0329632
394 Ga0495605_0003380
395 Ga0495594_0021866
396 Ga0495618_0038390
397 Ga0495666_0202974
398 Ga0495656_0277169
399 Ga0495634_0101552
400 Ga0495588_0168360
401 Ga0495647_0288165
402 Ga0495624_0055320
403 Ga0495676_0022300
404 Ga0495686_0000579
405 Ga0496102_0019027
406 Ga0496104_0026253
407 Ga0496105_0082471
408 Ga0496109_0221120
409 Ga0496112_0040297
410 Ga0496115_0110911
411 Ga0496126_0199505
412 Ga0501047_0008121
413 Ga0501047_0085293
414 Ga0501047_0830837
415 Ga0501070_0128080
416 Ga0501073_0244776
417 Ga0501073_0352415
418 Ga0501080_0068255
419 Ga0501080_0412759
420 nmdc:mga06r32_425612_c1
421 nmdc:mga08y16_30689_c1
422 nmdc:mga08y16_506746_c1
423 nmdc:mga0n895_683167_c1
424 nmdc:mga0rr50_351558_c1
425 nmdc:mga0rr50_9774_c1
426 nmdc:mga0a205_18394_c1
427 nmdc:mga0a205_384785_c1
428 nmdc:mga0a205_409696_c1
429 nmdc:mga0sz30_54640_c1
430 Ga0495655_0024022
431 Ga0501084_0970523
432 Ga0530510_0115679
433 Ga0530510_0951339
434 2676477622
435 2515854982
436 2827634462
437 2899370669
438 2902798044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

192

248

0.97

PF00072

Response_reg

Response regulator receiver domain

43

157

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9714 6 118
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9713 5 124
4le2-assembly4.cif.gz_D-2 crystal structure of the unphosphorylated receiver domain of desr in the active state 0.9682 6 135
4le2-assembly3.cif.gz_B-2 crystal structure of the unphosphorylated receiver domain of desr in the active state 0.9636 4 134
5iul-assembly1.cif.gz_C crystal structure of the desk-desr complex in the phosphotransfer state with high mg2+ (150 mm) and bef3 0.9592 6 132
ID Description Score Start End Superfamily
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9714 6 118 3.40.50.2300
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.968 7 124 3.40.50.2300
4le0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9662 6 139 3.40.50.2300
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9587 7 121 3.40.50.2300
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9529 155 206 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0F9FFZ2-F1-model_v4 Response regulatory domain-containing protein 0.9879 6 137 GO:0000160
GO:0003677
AF-A0A6L4AE68-F1-model_v4 Response regulator transcription factor 0.977 6 132 GO:0000160
GO:0003677
AF-A0A662BH94-F1-model_v4 DNA-binding response regulator 0.9649 4 141 GO:0000160
GO:0003677
AF-K9TAR8-F1-model_v4 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain 0.9511 1 136 GO:0000160
GO:0003677
GO:0016020
AF-A0A0S8EZD3-F1-model_v4 LuxR family transcriptional regulator 0.9506 6 145 GO:0000160
GO:0003677
GO:0006355

Map