F331401

General Info

Members Datasets Scaffolds Average Seq Length
219 141 206 347

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0012965|Ga0466959_0012965_3425_4540
Length 371
Sequence MPTTTTVDNLELIMKYFSDNLTDPIYIKPEKETALDRLFKSWIKDERDLPFVYLTVKITFTLWPLAILMYIPGINNWVWWAAAILYQFFNNVTFKGPFGLMLHCTSHRAFFKKKYQFWNNYLPWVIGPLFGQTPESYYSHHIGMHHPENNMPDDDSCTMFYQRDSFRGFLLYLWNFVTFGAYDTARYHIRKKRNKLMIKLIRGEILFAAACVGLSFVNFPATFVVFILPFIISRIIMMVGNWAQHAFICPADPDNAYKNSITCINTKYNHKCWNDGYHISHHLKPSMHWTEHPVYFRKTIKDYIDNDAIVFDGIHFLHVWAYLMLKRYDLLAKNFVNIGDRFQTDAEIISFLKQRTRKMAVQPYVAAAAAA

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
9 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
12 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
119 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.06
Metatranscriptomes 0
Isolates 5.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0
Rhizoplane 0.46
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 9.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003990 3300001979 Bacteria 6404
2 JGI25154J39366_1000002 3300002738 Bacteria 466942
3 JGI25153J46596_10005053 3300003215 Bacteria 6978
4 rootH2_10023120 3300003320 Bacteria 5252
5 rootL2_10007833 3300003322 Bacteria 5792
6 rootL2_10104899 3300003322 Bacteria 3152
7 rootH1_10021247 3300003323 Bacteria 5445
8 rootH1_10082144 3300003323 Bacteria 8105
9 Ga0055531_10000014 3300003794 Bacteria 184532
10 Ga0070658_10018399 3300005327 Bacteria 5592
11 Ga0070658_10033919 3300005327 Bacteria 4108
12 Ga0070658_10115543 3300005327 Unclassified 2226
13 Ga0070658_10160713 3300005327 Bacteria 1884
14 Ga0070683_100050288 3300005329 Unclassified 3858
15 Ga0068869_100052750 3300005334 Bacteria 2954
16 Ga0068869_100082004 3300005334 Bacteria 2409
17 Ga0070680_100018520 3300005336 Bacteria 5503
18 Ga0070680_100043576 3300005336 Bacteria 3645
19 Ga0070680_100082649 3300005336 Bacteria 2651
20 Ga0070682_100060742 3300005337 Bacteria 2391
21 Ga0070660_100012732 3300005339 Bacteria 6013
22 Ga0070660_100032429 3300005339 Bacteria 3931
23 Ga0070668_100019892 3300005347 Bacteria 5058
24 Ga0070668_100056256 3300005347 Bacteria 3037
25 Ga0070669_100037499 3300005353 Bacteria 3516
26 Ga0070675_100039052 3300005354 Bacteria 3871
27 Ga0070674_100038855 3300005356 Bacteria 3210
28 Ga0070673_100080645 3300005364 Bacteria 2637
29 Ga0070659_100030283 3300005366 Bacteria 4187
30 Ga0070659_100047186 3300005366 Bacteria 3378
31 Ga0070667_100016575 3300005367 Bacteria 6097
32 Ga0070714_100208161 3300005435 Unclassified 1792
33 Ga0070663_100011547 3300005455 Bacteria 5550
34 Ga0070663_100230553 3300005455 Bacteria 1458
35 Ga0070663_100265026 3300005455 Unclassified 1364
36 Ga0070678_100001368 3300005456 Bacteria 12967
37 Ga0070681_10063876 3300005458 Unclassified 3654
38 Ga0070681_10082500 3300005458 Bacteria 3170
39 Ga0070681_10109397 3300005458 Bacteria 2703
40 Ga0070679_100001669 3300005530 Bacteria 20001
41 Ga0070679_100126099 3300005530 Bacteria 2542
42 Ga0070679_100163840 3300005530 Unclassified 2197
43 Ga0068853_100079502 3300005539 Bacteria 2868
44 Ga0068853_100121878 3300005539 Bacteria 2327
45 Ga0068853_100208509 3300005539 Bacteria 1780
46 Ga0070665_100003878 3300005548 Bacteria 15802
47 Ga0070665_100057386 3300005548 Bacteria 3902
48 Ga0068855_100011144 3300005563 Bacteria 10855
49 Ga0068855_100017624 3300005563 Bacteria 8588
50 Ga0068855_100020447 3300005563 Bacteria 7938
51 Ga0068857_100040594 3300005577 Bacteria 4127
52 Ga0068857_100307750 3300005577 Unclassified 1461
53 Ga0068854_100076330 3300005578 Bacteria 2462
54 Ga0068854_100181034 3300005578 Bacteria 1646
55 Ga0068856_100034378 3300005614 Bacteria 4965
56 Ga0068852_100012798 3300005616 Bacteria 6392
57 Ga0068859_100036789 3300005617 Bacteria 4914
58 Ga0068866_10027469 3300005718 Bacteria 2699
59 Ga0068861_100173486 3300005719 Bacteria 1789
60 Ga0068860_100033439 3300005843 Bacteria 4934
61 Ga0068871_100127852 3300006358 Bacteria 2152
62 Ga0097620_100036787 3300006931 Bacteria 4914
63 Ga0105240_10178982 3300009093 Bacteria 2504
64 Ga0105241_10184020 3300009174 Bacteria 1735
65 Ga0105242_10049599 3300009176 Bacteria 3416
66 Ga0105242_10050527 3300009176 Bacteria 3385
67 Ga0105237_10004241 3300009545 Bacteria 16684
68 Ga0105249_10109721 3300009553 Bacteria 2606
69 Ga0105246_10024410 3300011119 Bacteria 3928
70 Ga0157373_10009343 3300013100 Bacteria 7245
71 Ga0157373_10011030 3300013100 Bacteria 6655
72 Ga0157373_10016442 3300013100 Bacteria 5397
73 Ga0157371_10005500 3300013102 Bacteria 10663
74 Ga0157371_10008563 3300013102 Bacteria 8137
75 Ga0157371_10029844 3300013102 Bacteria 3938
76 Ga0157371_10050216 3300013102 Bacteria 2963
77 Ga0157371_10063148 3300013102 Bacteria 2625
78 Ga0157370_10003733 3300013104 Bacteria 17802
79 Ga0157370_10050833 3300013104 Unclassified 3961
80 Ga0157369_10026754 3300013105 Bacteria 6398
81 Ga0157369_10279744 3300013105 Unclassified 1738
82 Ga0157374_10281966 3300013296 Bacteria 1641
83 Ga0157378_10068481 3300013297 Bacteria 3183
84 Ga0157378_10115002 3300013297 Bacteria 2472
85 Ga0157372_10026959 3300013307 Bacteria 6255
86 Ga0157372_10043235 3300013307 Unclassified 4987
87 Ga0157372_10097382 3300013307 Bacteria 3355
88 Ga0157372_10164769 3300013307 Bacteria 2563
89 Ga0157372_10258609 3300013307 Bacteria 2021
90 Ga0157372_10335417 3300013307 Bacteria 1761
91 Ga0157375_10088627 3300013308 Bacteria 3149
92 Ga0157377_10124856 3300014745 Bacteria 1564
93 Ga0182005_1000124 3300015265 Bacteria 54958
94 Ga0209646_1000005 3300025246 Bacteria 717627
95 Ga0209026_1000169 3300025250 Bacteria 100088
96 Ga0209455_1018721 3300025272 Bacteria 1415
97 Ga0209130_1004484 3300025284 Bacteria 5275
98 Ga0209758_1000904 3300025297 Bacteria 40285
99 Ga0207426_1000233 3300025302 Bacteria 127848
100 Ga0207426_1000600 3300025302 Bacteria 47121
101 Ga0207426_1015610 3300025302 Bacteria 2751
102 Ga0209257_1000004 3300025304 Bacteria 1678347
103 Ga0207682_10025835 3300025893 Bacteria 2330
104 Ga0207642_10089866 3300025899 Bacteria 1514
105 Ga0207680_10035984 3300025903 Bacteria 2848
106 Ga0207647_10040677 3300025904 Bacteria 2926
107 Ga0207647_10084477 3300025904 Bacteria 1900
108 Ga0207647_10101406 3300025904 Bacteria 1707
109 Ga0207645_10001537 3300025907 Bacteria 18871
110 Ga0207643_10022195 3300025908 Bacteria 3493
111 Ga0207705_10015925 3300025909 Bacteria 5398
112 Ga0207705_10039225 3300025909 Unclassified 3393
113 Ga0207705_10072362 3300025909 Bacteria 2500
114 Ga0207705_10086023 3300025909 Bacteria 2297
115 Ga0207707_10088887 3300025912 Bacteria 2699
116 Ga0207707_10140518 3300025912 Bacteria 2111
117 Ga0207707_10269159 3300025912 Bacteria 1477
118 Ga0207671_10000149 3300025914 Bacteria 107722
119 Ga0207660_10149807 3300025917 Bacteria 1791
120 Ga0207660_10278699 3300025917 Bacteria 1326
121 Ga0207657_10016353 3300025919 Bacteria 7157
122 Ga0207657_10078986 3300025919 Bacteria 2769
123 Ga0207652_10000166 3300025921 Bacteria 71226
124 Ga0207652_10005530 3300025921 Bacteria 10245
125 Ga0207652_10028889 3300025921 Bacteria 4629
126 Ga0207652_10105012 3300025921 Bacteria 2499
127 Ga0207650_10123064 3300025925 Bacteria 2022
128 Ga0207659_10204407 3300025926 Bacteria 1579
129 Ga0207690_10030723 3300025932 Bacteria 3430
130 Ga0207690_10132416 3300025932 Bacteria 1827
131 Ga0207706_10060440 3300025933 Bacteria 3337
132 Ga0207669_10090118 3300025937 Bacteria 1993
133 Ga0207704_10023978 3300025938 Bacteria 3298
134 Ga0207689_10007185 3300025942 Bacteria 9783
135 Ga0207689_10027482 3300025942 Bacteria 4761
136 Ga0207661_10015444 3300025944 Bacteria 5619
137 Ga0207667_10001454 3300025949 Bacteria 29736
138 Ga0207667_10043641 3300025949 Bacteria 4757
139 Ga0207667_10152141 3300025949 Bacteria 2381
140 Ga0207651_10059436 3300025960 Bacteria 2648
141 Ga0207640_10151781 3300025981 Bacteria 1703
142 Ga0207658_10150127 3300025986 Bacteria 1897
143 Ga0207639_10112421 3300026041 Bacteria 2222
144 Ga0207678_10013613 3300026067 Bacteria 7146
145 Ga0207702_10122911 3300026078 Bacteria 2326
146 Ga0207648_10039605 3300026089 Bacteria 4143
147 Ga0207648_10080663 3300026089 Bacteria 2838
148 Ga0207674_10055740 3300026116 Bacteria 4017
149 Ga0207674_10076311 3300026116 Bacteria 3359
150 Ga0207675_100036159 3300026118 Unclassified 4606
151 Ga0207683_10018983 3300026121 Bacteria 5867
152 Ga0268266_10012321 3300028379 Bacteria 7395
153 Ga0268265_10313791 3300028380 Bacteria 1417
154 Ga0265318_10001476 3300028577 Bacteria 13761
155 Ga0265338_10034282 3300028800 Unclassified 4910
156 Ga0265338_10116794 3300028800 Bacteria 2136
157 Ga0265320_10000336 3300031240 Bacteria 38371
158 Ga0265320_10027933 3300031240 Unclassified 2935
159 Ga0265325_10001478 3300031241 Bacteria 16558
160 Ga0265329_10027259 3300031242 Unclassified 1879
161 Ga0265340_10004476 3300031247 Bacteria 7803
162 Ga0265327_10000097 3300031251 Bacteria 193156
163 Ga0265327_10000098 3300031251 Bacteria 190693
164 Ga0265316_10008107 3300031344 Bacteria 9790
165 Ga0265314_10012892 3300031711 Bacteria 6792
166 Ga0316576_10029091 3300031727 Bacteria 3901
167 Ga0316576_10068445 3300031727 Bacteria 2615
168 Ga0316576_10118478 3300031727 Bacteria 1988
169 Ga0316578_10053705 3300031728 Unclassified 2361
170 Ga0316577_10031046 3300031733 Bacteria 2984
171 Ga0316577_10043395 3300031733 Bacteria 2516
172 Ga0316580_10028695 3300032139 Unclassified 1720
173 Ga0316574_0014392 3300035398 Unclassified 4571
174 Ga0316574_0106200 3300035398 Unclassified 1799
175 Ga0316582_0068522 3300036647 Bacteria 2291
176 Ga0316584_0036306 3300036712 Unclassified 3657
177 Ga0316584_0047970 3300036712 Bacteria 3191
178 Ga0395899_0003459 3300037312 Bacteria 12516
179 Ga0395899_0049515 3300037312 Bacteria 3123
180 Ga0395900_0052966 3300037418 Bacteria 4177
181 Ga0395900_0155283 3300037418 Unclassified 2337
182 Ga0395898_0004654 3300037466 Bacteria 14957
183 Ga0395898_0042997 3300037466 Bacteria 4453
184 Ga0395898_0078956 3300037466 Bacteria 3175
185 Ga0395905_0140002 3300037471 Archaea 2277
186 Ga0395905_0248375 3300037471 Bacteria 1662
187 Ga0395901_0027598 3300038443 Bacteria 5834
188 Ga0395901_0108266 3300038443 Bacteria 2917
189 Ga0395901_0232528 3300038443 Bacteria 1924
190 Ga0451577_0184549 3300042876 Bacteria 1881
191 Ga0453684_0007529 3300044712 Bacteria 19973
192 Ga0466959_0012965 3300045049 Bacteria 6035
193 Ga0496114_0000400 3300048917 Bacteria 32085
194 Ga0496121_0000008 3300048924 Bacteria 843593
195 Ga0496121_0000043 3300048924 Bacteria 341882
196 Ga0496126_0019171 3300048929 Bacteria 6744
197 Ga0501033_0087719 3300049570 Bacteria 2277
198 Ga0501034_0040912 3300049571 Bacteria 4690
199 Ga0501034_0067580 3300049571 Bacteria 3586
200 Ga0501047_0047191 3300049581 Bacteria 4161
201 Ga0501070_0062026 3300049586 Bacteria 3097
202 Ga0501241_001641 3300049758 Bacteria 4479
203 Ga0501035_0134684 3300049822 Bacteria 2152
204 Ga0501035_0183944 3300049822 Bacteria 1799
205 Ga0501035_0184894 3300049822 Bacteria 1794
206 Ga0500622_0000455 3300053156 Bacteria 38833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10033919 Ga0070658_100339193 310
2 3300005337 Ga0070682_100060742 Ga0070682_1000607422 310
3 3300005339 Ga0070660_100012732 Ga0070660_1000127326 310
4 3300005458 Ga0070681_10109397 Ga0070681_101093971 310
5 3300005530 Ga0070679_100001669 Ga0070679_1000016696 310
6 3300005616 Ga0068852_100012798 Ga0068852_1000127985 310
7 3300013102 Ga0157371_10063148 Ga0157371_100631482 310
8 3300025909 Ga0207705_10015925 Ga0207705_100159253 310
9 3300025909 Ga0207705_10072362 Ga0207705_100723621 310
10 3300025919 Ga0207657_10016353 Ga0207657_100163533 310
11 3300025921 Ga0207652_10005530 Ga0207652_100055303 310
12 3300005327 Ga0070658_10018399 Ga0070658_100183996 313
13 3300005539 Ga0068853_100208509 Ga0068853_1002085092 317
14 3300015265 Ga0182005_1000124 Ga0182005_100012410 324
15 3300005334 Ga0068869_100082004 Ga0068869_1000820043 325
16 3300005347 Ga0070668_100019892 Ga0070668_1000198924 325
17 3300005719 Ga0068861_100173486 Ga0068861_1001734862 325
18 3300025942 Ga0207689_10007185 Ga0207689_100071854 325
19 3300026089 Ga0207648_10080663 Ga0207648_100806631 325
20 3300026118 Ga0207675_100036159 Ga0207675_1000361595 325
21 3300028380 Ga0268265_10313791 Ga0268265_103137911 325
22 3300003322 rootL2_10104899 rootL2_101048991 331
23 3300003794 Ga0055531_10000014 Ga0055531_1000001439 331
24 3300025302 Ga0207426_1015610 Ga0207426_10156101 331
25 3300025304 Ga0209257_1000004 Ga0209257_1000004619 331
26 3300048924 Ga0496121_0000008 Ga0496121_0000008_250352_251431 331
27 3300048929 Ga0496126_0019171 Ga0496126_0019171_421_1497 331
28 3300028577 Ga0265318_10001476 Ga0265318_100014765 332
29 3300028800 Ga0265338_10034282 Ga0265338_100342822 332
30 3300031240 Ga0265320_10027933 Ga0265320_100279331 332
31 3300031241 Ga0265325_10001478 Ga0265325_1000147811 332
32 3300031247 Ga0265340_10004476 Ga0265340_100044764 332
33 3300031344 Ga0265316_10008107 Ga0265316_100081076 332
34 3300025949 Ga0207667_10152141 Ga0207667_101521413 333
35 3300031711 Ga0265314_10012892 Ga0265314_100128924 333
36 3300031242 Ga0265329_10027259 Ga0265329_100272592 336
37 3300031240 Ga0265320_10000336 Ga0265320_1000033621 338
38 3300031727 Ga0316576_10118478 Ga0316576_101184781 341
39 3300031733 Ga0316577_10043395 Ga0316577_100433953 341
40 3300036712 Ga0316584_0036306 Ga0316584_0036306_1559_2602 341
41 3300037471 Ga0395905_0140002 Ga0395905_0140002_678_1727 342
42 iso_pu_bacteria 2896085136 2896090005 342
43 3300013296 Ga0157374_10281966 Ga0157374_102819661 344
44 3300031727 Ga0316576_10029091 Ga0316576_100290912 344
45 3300031727 Ga0316576_10068445 Ga0316576_100684452 344
46 3300031728 Ga0316578_10053705 Ga0316578_100537052 344
47 3300031733 Ga0316577_10031046 Ga0316577_100310463 344
48 3300032139 Ga0316580_10028695 Ga0316580_100286952 344
49 3300035398 Ga0316574_0014392 Ga0316574_0014392_242_1300 344
50 3300035398 Ga0316574_0106200 Ga0316574_0106200_357_1412 344
51 3300036647 Ga0316582_0068522 Ga0316582_0068522_760_1818 344
52 3300036712 Ga0316584_0047970 Ga0316584_0047970_410_1468 344
53 3300005336 Ga0070680_100043576 Ga0070680_1000435763 347
54 3300005336 Ga0070680_100082649 Ga0070680_1000826492 347
55 3300005339 Ga0070660_100032429 Ga0070660_1000324295 347
56 3300005366 Ga0070659_100030283 Ga0070659_1000302835 347
57 3300005458 Ga0070681_10082500 Ga0070681_100825003 347
58 3300005530 Ga0070679_100126099 Ga0070679_1001260992 347
59 3300005539 Ga0068853_100079502 Ga0068853_1000795021 347
60 3300005563 Ga0068855_100011144 Ga0068855_1000111447 347
61 3300005577 Ga0068857_100307750 Ga0068857_1003077502 347
62 3300013100 Ga0157373_10011030 Ga0157373_100110307 347
63 3300013100 Ga0157373_10016442 Ga0157373_100164423 347
64 3300013102 Ga0157371_10029844 Ga0157371_100298444 347
65 3300013102 Ga0157371_10050216 Ga0157371_100502162 347
66 3300013307 Ga0157372_10026959 Ga0157372_100269593 347
67 3300013307 Ga0157372_10097382 Ga0157372_100973822 347
68 3300013307 Ga0157372_10164769 Ga0157372_101647692 347
69 3300025904 Ga0207647_10101406 Ga0207647_101014061 347
70 3300025912 Ga0207707_10088887 Ga0207707_100888871 347
71 3300025912 Ga0207707_10269159 Ga0207707_102691591 347
72 3300025917 Ga0207660_10278699 Ga0207660_102786991 347
73 3300025919 Ga0207657_10078986 Ga0207657_100789861 347
74 3300025921 Ga0207652_10028889 Ga0207652_100288891 347
75 3300025921 Ga0207652_10105012 Ga0207652_101050122 347
76 3300025932 Ga0207690_10132416 Ga0207690_101324162 347
77 3300025949 Ga0207667_10043641 Ga0207667_100436411 347
78 3300026116 Ga0207674_10076311 Ga0207674_100763112 347
79 3300037466 Ga0395898_0042997 Ga0395898_0042997_575_1618 347
80 3300049571 Ga0501034_0040912 Ga0501034_0040912_3082_4125 347
81 3300049586 Ga0501070_0062026 Ga0501070_0062026_41_1084 347
82 3300049822 Ga0501035_0134684 Ga0501035_0134684_79_1122 347
83 3300028800 Ga0265338_10116794 Ga0265338_101167942 348
84 3300037312 Ga0395899_0049515 Ga0395899_0049515_638_1684 348
85 3300037471 Ga0395905_0248375 Ga0395905_0248375_569_1615 348
86 3300048924 Ga0496121_0000043 Ga0496121_0000043_46618_47667 348
87 iso_pu_bacteria 2883068021 2883068209 348
88 3300005327 Ga0070658_10115543 Ga0070658_101155432 349
89 3300005327 Ga0070658_10160713 Ga0070658_101607131 349
90 3300005329 Ga0070683_100050288 Ga0070683_1000502882 349
91 3300005336 Ga0070680_100018520 Ga0070680_1000185204 349
92 3300005435 Ga0070714_100208161 Ga0070714_1002081611 349
93 3300005455 Ga0070663_100011547 Ga0070663_1000115471 349
94 3300005458 Ga0070681_10063876 Ga0070681_100638763 349
95 3300005530 Ga0070679_100163840 Ga0070679_1001638401 349
96 3300005563 Ga0068855_100017624 Ga0068855_1000176245 349
97 3300005563 Ga0068855_100020447 Ga0068855_1000204478 349
98 3300005614 Ga0068856_100034378 Ga0068856_1000343782 349
99 3300013102 Ga0157371_10005500 Ga0157371_100055007 349
100 3300013102 Ga0157371_10008563 Ga0157371_100085632 349
101 3300013104 Ga0157370_10003733 Ga0157370_1000373314 349
102 3300013104 Ga0157370_10050833 Ga0157370_100508332 349
103 3300013105 Ga0157369_10026754 Ga0157369_100267545 349
104 3300013105 Ga0157369_10279744 Ga0157369_102797442 349
105 3300013297 Ga0157378_10068481 Ga0157378_100684811 349
106 3300013307 Ga0157372_10043235 Ga0157372_100432353 349
107 3300013307 Ga0157372_10335417 Ga0157372_103354172 349
108 3300025904 Ga0207647_10084477 Ga0207647_100844772 349
109 3300025909 Ga0207705_10039225 Ga0207705_100392253 349
110 3300025909 Ga0207705_10086023 Ga0207705_100860231 349
111 3300025912 Ga0207707_10140518 Ga0207707_101405182 349
112 3300025917 Ga0207660_10149807 Ga0207660_101498072 349
113 3300025921 Ga0207652_10000166 Ga0207652_1000016653 349
114 3300025944 Ga0207661_10015444 Ga0207661_100154443 349
115 3300025949 Ga0207667_10001454 Ga0207667_1000145427 349
116 3300026067 Ga0207678_10013613 Ga0207678_100136135 349
117 3300026078 Ga0207702_10122911 Ga0207702_101229111 349
118 3300037312 Ga0395899_0003459 Ga0395899_0003459_8196_9245 349
119 3300037418 Ga0395900_0052966 Ga0395900_0052966_1553_2602 349
120 3300037418 Ga0395900_0155283 Ga0395900_0155283_460_1509 349
121 3300037466 Ga0395898_0004654 Ga0395898_0004654_12194_13243 349
122 3300037466 Ga0395898_0078956 Ga0395898_0078956_65_1114 349
123 3300038443 Ga0395901_0232528 Ga0395901_0232528_44_1093 349
124 3300013100 Ga0157373_10009343 Ga0157373_100093435 350
125 3300038443 Ga0395901_0108266 Ga0395901_0108266_1583_2635 350
126 iso_pu_bacteria 2911138879 2911140239 351
127 3300005334 Ga0068869_100052750 Ga0068869_1000527502 353
128 3300005347 Ga0070668_100056256 Ga0070668_1000562562 353
129 3300005353 Ga0070669_100037499 Ga0070669_1000374992 353
130 3300005354 Ga0070675_100039052 Ga0070675_1000390522 353
131 3300005356 Ga0070674_100038855 Ga0070674_1000388552 353
132 3300005364 Ga0070673_100080645 Ga0070673_1000806452 353
133 3300005366 Ga0070659_100047186 Ga0070659_1000471862 353
134 3300005367 Ga0070667_100016575 Ga0070667_1000165752 353
135 3300005455 Ga0070663_100230553 Ga0070663_1002305532 353
136 3300005455 Ga0070663_100265026 Ga0070663_1002650261 353
137 3300005456 Ga0070678_100001368 Ga0070678_1000013684 353
138 3300005539 Ga0068853_100121878 Ga0068853_1001218782 353
139 3300005548 Ga0070665_100057386 Ga0070665_1000573862 353
140 3300005578 Ga0068854_100076330 Ga0068854_1000763302 353
141 3300005617 Ga0068859_100036789 Ga0068859_1000367893 353
142 3300005718 Ga0068866_10027469 Ga0068866_100274692 353
143 3300005843 Ga0068860_100033439 Ga0068860_1000334393 353
144 3300006358 Ga0068871_100127852 Ga0068871_1001278522 353
145 3300006931 Ga0097620_100036787 Ga0097620_1000367873 353
146 3300009174 Ga0105241_10184020 Ga0105241_101840202 353
147 3300009176 Ga0105242_10049599 Ga0105242_100495992 353
148 3300009176 Ga0105242_10050527 Ga0105242_100505274 353
149 3300009553 Ga0105249_10109721 Ga0105249_101097211 353
150 3300011119 Ga0105246_10024410 Ga0105246_100244102 353
151 3300013297 Ga0157378_10115002 Ga0157378_101150022 353
152 3300013308 Ga0157375_10088627 Ga0157375_100886272 353
153 3300014745 Ga0157377_10124856 Ga0157377_101248562 353
154 3300025272 Ga0209455_1018721 Ga0209455_10187211 353
155 3300025893 Ga0207682_10025835 Ga0207682_100258352 353
156 3300025899 Ga0207642_10089866 Ga0207642_100898662 353
157 3300025903 Ga0207680_10035984 Ga0207680_100359842 353
158 3300025907 Ga0207645_10001537 Ga0207645_100015373 353
159 3300025908 Ga0207643_10022195 Ga0207643_100221953 353
160 3300025925 Ga0207650_10123064 Ga0207650_101230642 353
161 3300025926 Ga0207659_10204407 Ga0207659_102044071 353
162 3300025932 Ga0207690_10030723 Ga0207690_100307233 353
163 3300025933 Ga0207706_10060440 Ga0207706_100604402 353
164 3300025937 Ga0207669_10090118 Ga0207669_100901182 353
165 3300025938 Ga0207704_10023978 Ga0207704_100239783 353
166 3300025942 Ga0207689_10027482 Ga0207689_100274823 353
167 3300025960 Ga0207651_10059436 Ga0207651_100594363 353
168 3300025986 Ga0207658_10150127 Ga0207658_101501272 353
169 3300026041 Ga0207639_10112421 Ga0207639_101124212 353
170 3300026089 Ga0207648_10039605 Ga0207648_100396052 353
171 3300026121 Ga0207683_10018983 Ga0207683_100189833 353
172 3300031251 Ga0265327_10000098 Ga0265327_10000098131 353
173 3300038443 Ga0395901_0027598 Ga0395901_0027598_2649_3710 353
174 3300048917 Ga0496114_0000400 Ga0496114_0000400_2143_3213 353
175 iso_pu_bacteria 2818991442 2819576693 353
176 iso_pu_bacteria 2818991460 2819677446 353
177 iso_pu_bacteria 2821136567 2821143079 353
178 iso_pu_bacteria 2884791551 2884797372 353
179 iso_pu_bacteria 2904467357 2904470799 353
180 iso_pu_bacteria 2929177148 2929183519 353
181 iso_pu_bacteria 2945977869 2945979482 353
182 iso_pu_bacteria 2946013367 2946014649 353
183 3300005578 Ga0068854_100181034 Ga0068854_1001810342 354
184 3300009545 Ga0105237_10004241 Ga0105237_100042413 354
185 3300025914 Ga0207671_10000149 Ga0207671_10000149113 354
186 3300025981 Ga0207640_10151781 Ga0207640_101517812 354
187 iso_pu_bacteria 2929921140 2929921210 354
188 iso_pu_bacteria 8003151029 8003152501 354
189 3300003322 rootL2_10007833 rootL2_100078335 355
190 3300003323 rootH1_10082144 rootH1_100821447 355
191 3300013307 Ga0157372_10258609 Ga0157372_102586092 355
192 3300005548 Ga0070665_100003878 Ga0070665_10000387811 356
193 3300009093 Ga0105240_10178982 Ga0105240_101789823 356
194 3300025904 Ga0207647_10040677 Ga0207647_100406772 356
195 3300028379 Ga0268266_10012321 Ga0268266_100123216 356
196 3300031251 Ga0265327_10000097 Ga0265327_10000097117 356
197 3300042876 Ga0451577_0184549 Ga0451577_0184549_191_1270 356
198 3300044712 Ga0453684_0007529 Ga0453684_0007529_13684_14763 356
199 3300049570 Ga0501033_0087719 Ga0501033_0087719_238_1308 356
200 3300049571 Ga0501034_0067580 Ga0501034_0067580_2264_3334 356
201 3300049822 Ga0501035_0183944 Ga0501035_0183944_109_1182 356
202 3300049822 Ga0501035_0184894 Ga0501035_0184894_577_1647 356
203 3300003320 rootH2_10023120 rootH2_100231203 357
204 3300003323 rootH1_10021247 rootH1_100212474 357
205 3300005577 Ga0068857_100040594 Ga0068857_1000405943 357
206 3300025284 Ga0209130_1004484 Ga0209130_10044842 357
207 3300025302 Ga0207426_1000233 Ga0207426_100023364 357
208 3300026116 Ga0207674_10055740 Ga0207674_100557402 357
209 3300045049 Ga0466959_0012965 Ga0466959_0012965_3425_4540 357
210 3300049581 Ga0501047_0047191 Ga0501047_0047191_2791_3864 357
211 3300049758 Ga0501241_001641 Ga0501241_001641_1032_2108 357
212 3300053156 Ga0500622_0000455 Ga0500622_0000455_13227_14303 357
213 3300001979 JGI24740J21852_10003990 JGI24740J21852_100039902 358
214 3300002738 JGI25154J39366_1000002 JGI25154J39366_1000002265 358
215 3300003215 JGI25153J46596_10005053 JGI25153J46596_100050532 358
216 3300025246 Ga0209646_1000005 Ga0209646_1000005110 358
217 3300025250 Ga0209026_1000169 Ga0209026_100016947 358
218 3300025297 Ga0209758_1000904 Ga0209758_10009043 358
219 3300025302 Ga0207426_1000600 Ga0207426_10006008 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

75

313

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e9z-assembly1.cif.gz_B dhf119 filament 0.2922 32 343
6e9z-assembly1.cif.gz_B dhf119 filament 0.2799 32 343
3feq-assembly2.cif.gz_M crystal structure of uncharacterized protein eah89906 0.2733 227 348
5lzr-assembly1.cif.gz_B crystal structure of thermotoga maritima sodium pumping membrane integral pyrophosphatase in complex with tungstate and magnesium 0.2092 65 357
5im2-assembly1.cif.gz_A crystal structure of a trap solute binding protein from rhodoferax ferrireducens t118 (rfer_2570, target efi-510210) in complex with copurified benzoate 0.1945 255 357
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6508 67 290 3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5584 67 290 3.30.40.10
1tplA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.3095 281 343 3.40.640.10
af_Q95XK5_83_224_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.2959 281 357 3.90.190.10
af_Q9C9A2_385_508_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2614 71 194 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A258DQX5-F1-model_v4 Fatty acid desaturase 0.9936 107 321 GO:0006629
GO:0016020
AF-A0A1I1XPM9-F1-model_v4 Fatty acid desaturase 0.9862 1 347 GO:0006629
GO:0016020
AF-A0A838FHI9-F1-model_v4 Fatty acid desaturase 0.9858 1 347 GO:0006629
GO:0016020
AF-A0A519RZK5-F1-model_v4 Fatty acid desaturase 0.9851 57 355 GO:0006629
GO:0016020
AF-A0A352CJ81-F1-model_v4 Fatty acid desaturase 0.9842 31 303 GO:0006629
GO:0016020

Feature Viewer

pLDDT pTM Quality
92.9 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map