F331342
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 219 | 154 | 438 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_1025715|Ga0436361_1025715_965_1786 |
| Length | 273 |
| Sequence | LRYIHSLCNHPTDQDMINRFANPARFMRFSDAAMPWFAWAALAVLAIGLYLALVVAPPDYQQGESVRIMYIHVPAAWMALSVYLLVAVASAVALVWRHPLADIAASAAAPIGAAFTLICLATGSLWGRPMWGAWWVWDARLTSVLVLFFLYLGYIALVNGFDEPSRGGRAGSVLALVGVVNLPIVKFSVDWWNTLHQPASVVRLGGPTIAISMLVPLLVMAAGFLLLFVTLLMLRMRTTLNERKAMALRLNATPGRARVSTPEPAAAPQPAVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 48 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 50 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 78 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 80 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 82 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 83 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 84 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 86 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 87 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 88 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 89 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 90 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 91 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 92 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 94 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 95 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 96 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 97 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 98 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 99 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 100 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 101 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 102 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 103 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 104 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 105 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 106 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 112 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 113 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 114 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 115 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 116 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 128 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 129 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 130 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 136 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 137 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 138 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 140 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 141 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 142 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 143 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 144 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 145 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 146 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 147 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 148 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 149 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 150 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 151 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 152 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 153 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 154 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.24 |
| Metatranscriptomes | 0.46 |
| Isolates | 7.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.13 |
| Nodule | 2.74 |
| Rhizoplane | 2.28 |
| Rhizosphere | 77.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436361_1025715 | 3300039447 | Bacteria | 2544 |
| 2 | JGI25162J39368_1002159 | 3300002737 | Bacteria | 8202 |
| 3 | JGI25159J45721_1000017 | 3300002987 | Bacteria | 136127 |
| 4 | JGI25165J46597_1002377 | 3300003214 | Bacteria | 6266 |
| 5 | JGI25153J46596_10001550 | 3300003215 | Bacteria | 13655 |
| 6 | Ga0065704_10144082 | 3300005289 | Bacteria | 1489 |
| 7 | Ga0070677_10003237 | 3300005333 | Bacteria | 5241 |
| 8 | Ga0070666_10340034 | 3300005335 | Bacteria | 1073 |
| 9 | Ga0070680_100002286 | 3300005336 | Bacteria | 14173 |
| 10 | Ga0070687_100178027 | 3300005343 | Bacteria | 1271 |
| 11 | Ga0070669_100058374 | 3300005353 | Bacteria | 2831 |
| 12 | Ga0070675_100060531 | 3300005354 | Bacteria | 3126 |
| 13 | Ga0070671_100054881 | 3300005355 | Bacteria | 3313 |
| 14 | Ga0070671_100212300 | 3300005355 | Bacteria | 1642 |
| 15 | Ga0070674_100063598 | 3300005356 | Bacteria | 2583 |
| 16 | Ga0070673_100215825 | 3300005364 | Bacteria | 1658 |
| 17 | Ga0070688_100087784 | 3300005365 | Bacteria | 2026 |
| 18 | Ga0070667_100118429 | 3300005367 | Bacteria | 2302 |
| 19 | Ga0070709_10011465 | 3300005434 | Bacteria | 4941 |
| 20 | Ga0070709_10036428 | 3300005434 | Bacteria | 2997 |
| 21 | Ga0070709_10337780 | 3300005434 | Bacteria | 1110 |
| 22 | Ga0070714_100014147 | 3300005435 | Bacteria | 6406 |
| 23 | Ga0070714_100041555 | 3300005435 | Bacteria | 3881 |
| 24 | Ga0070714_100105008 | 3300005435 | Bacteria | 2493 |
| 25 | Ga0070714_100113716 | 3300005435 | Bacteria | 2400 |
| 26 | Ga0070714_100340633 | 3300005435 | Bacteria | 1406 |
| 27 | Ga0070713_100010862 | 3300005436 | Bacteria | 6602 |
| 28 | Ga0070713_100070873 | 3300005436 | Bacteria | 2944 |
| 29 | Ga0070713_100128575 | 3300005436 | Bacteria | 2231 |
| 30 | Ga0070713_100147008 | 3300005436 | Bacteria | 2093 |
| 31 | Ga0070713_100250334 | 3300005436 | Bacteria | 1616 |
| 32 | Ga0070711_100024192 | 3300005439 | Bacteria | 3958 |
| 33 | Ga0070711_100156044 | 3300005439 | Bacteria | 1726 |
| 34 | Ga0070678_100094330 | 3300005456 | Bacteria | 2303 |
| 35 | Ga0070681_10041381 | 3300005458 | Bacteria | 4618 |
| 36 | Ga0070681_10213529 | 3300005458 | Bacteria | 1845 |
| 37 | Ga0070681_10485227 | 3300005458 | Bacteria | 1149 |
| 38 | Ga0068867_100159591 | 3300005459 | Bacteria | 1777 |
| 39 | Ga0070707_100024935 | 3300005468 | Bacteria | 5670 |
| 40 | Ga0070698_100008304 | 3300005471 | Bacteria | 11226 |
| 41 | Ga0070698_100011930 | 3300005471 | Bacteria | 9221 |
| 42 | Ga0070698_100323643 | 3300005471 | Bacteria | 1473 |
| 43 | Ga0070699_100012984 | 3300005518 | Bacteria | 7176 |
| 44 | Ga0070699_100353181 | 3300005518 | Bacteria | 1325 |
| 45 | Ga0070679_100003566 | 3300005530 | Bacteria | 14250 |
| 46 | Ga0070679_100317702 | 3300005530 | Bacteria | 1507 |
| 47 | Ga0070679_100686689 | 3300005530 | Bacteria | 966 |
| 48 | Ga0070684_100098249 | 3300005535 | Bacteria | 2612 |
| 49 | Ga0070697_100018034 | 3300005536 | Bacteria | 5562 |
| 50 | Ga0070697_100693938 | 3300005536 | Bacteria | 898 |
| 51 | Ga0070672_100019430 | 3300005543 | Bacteria | 4931 |
| 52 | Ga0068856_100122438 | 3300005614 | Bacteria | 2603 |
| 53 | Ga0068863_100281709 | 3300005841 | Bacteria | 1611 |
| 54 | Ga0070717_10236156 | 3300006028 | Bacteria | 1611 |
| 55 | Ga0070712_100013274 | 3300006175 | Bacteria | 5261 |
| 56 | Ga0075362_10097416 | 3300006177 | Bacteria | 1371 |
| 57 | Ga0075362_10145791 | 3300006177 | Bacteria | 1133 |
| 58 | Ga0075367_10002751 | 3300006178 | Bacteria | 8136 |
| 59 | Ga0075366_10013681 | 3300006195 | Bacteria | 4625 |
| 60 | Ga0075370_10112936 | 3300006353 | Bacteria | 1579 |
| 61 | Ga0075430_100203021 | 3300006846 | Bacteria | 1646 |
| 62 | Ga0075436_100063891 | 3300006914 | Bacteria | 2544 |
| 63 | Ga0105240_10088314 | 3300009093 | Bacteria | 3794 |
| 64 | Ga0157370_10014151 | 3300013104 | Bacteria | 8180 |
| 65 | Ga0157369_10010476 | 3300013105 | Bacteria | 10558 |
| 66 | Ga0157369_10055661 | 3300013105 | Bacteria | 4270 |
| 67 | Ga0157378_10226780 | 3300013297 | Bacteria | 1778 |
| 68 | Ga0157380_10527403 | 3300014326 | Bacteria | 1153 |
| 69 | Ga0182008_10030330 | 3300014497 | Bacteria | 2726 |
| 70 | Ga0206353_10609774 | 3300020082 | Bacteria | 1801 |
| 71 | Ga0213875_10184985 | 3300021388 | Bacteria | 979 |
| 72 | Ga0209563_106652 | 3300025230 | Bacteria | 1967 |
| 73 | Ga0209437_100107 | 3300025233 | Bacteria | 218656 |
| 74 | Ga0209233_1000531 | 3300025261 | Bacteria | 21804 |
| 75 | Ga0207426_1021230 | 3300025302 | Bacteria | 2246 |
| 76 | Ga0207682_10000722 | 3300025893 | Bacteria | 15329 |
| 77 | Ga0207692_10123245 | 3300025898 | Bacteria | 1454 |
| 78 | Ga0207699_10040975 | 3300025906 | Bacteria | 2672 |
| 79 | Ga0207699_10192636 | 3300025906 | Bacteria | 1377 |
| 80 | Ga0207645_10127311 | 3300025907 | Bacteria | 1656 |
| 81 | Ga0207684_10018812 | 3300025910 | Bacteria | 5910 |
| 82 | Ga0207707_10003899 | 3300025912 | Bacteria | 13228 |
| 83 | Ga0207695_10089985 | 3300025913 | Bacteria | 3085 |
| 84 | Ga0207693_10000472 | 3300025915 | Bacteria | 36723 |
| 85 | Ga0207693_10047885 | 3300025915 | Bacteria | 3358 |
| 86 | Ga0207693_10084985 | 3300025915 | Bacteria | 2479 |
| 87 | Ga0207663_10043627 | 3300025916 | Bacteria | 2747 |
| 88 | Ga0207663_10065572 | 3300025916 | Bacteria | 2322 |
| 89 | Ga0207660_10083617 | 3300025917 | Bacteria | 2351 |
| 90 | Ga0207660_10085225 | 3300025917 | Bacteria | 2330 |
| 91 | Ga0207662_10221126 | 3300025918 | Bacteria | 1233 |
| 92 | Ga0207652_10009920 | 3300025921 | Bacteria | 7665 |
| 93 | Ga0207652_10036978 | 3300025921 | Bacteria | 4130 |
| 94 | Ga0207652_10131421 | 3300025921 | Bacteria | 2233 |
| 95 | Ga0207652_10657942 | 3300025921 | Bacteria | 937 |
| 96 | Ga0207646_10006857 | 3300025922 | Bacteria | 11704 |
| 97 | Ga0207646_10476504 | 3300025922 | Bacteria | 1125 |
| 98 | Ga0207681_10094562 | 3300025923 | Bacteria | 2142 |
| 99 | Ga0207700_10103529 | 3300025928 | Bacteria | 2276 |
| 100 | Ga0207700_10168956 | 3300025928 | Bacteria | 1823 |
| 101 | Ga0207700_10428611 | 3300025928 | Bacteria | 1163 |
| 102 | Ga0207664_10003593 | 3300025929 | Bacteria | 10371 |
| 103 | Ga0207664_10017248 | 3300025929 | Bacteria | 5288 |
| 104 | Ga0207664_10026396 | 3300025929 | Bacteria | 4390 |
| 105 | Ga0207664_10071152 | 3300025929 | Bacteria | 2801 |
| 106 | Ga0207669_10250042 | 3300025937 | Bacteria | 1319 |
| 107 | Ga0207665_10005214 | 3300025939 | Bacteria | 8683 |
| 108 | Ga0207691_10003529 | 3300025940 | Bacteria | 15210 |
| 109 | Ga0207679_10623082 | 3300025945 | Bacteria | 974 |
| 110 | Ga0207648_10026626 | 3300026089 | Bacteria | 5137 |
| 111 | Ga0207676_10326820 | 3300026095 | Bacteria | 1410 |
| 112 | Ga0207683_10081921 | 3300026121 | Bacteria | 2865 |
| 113 | Ga0265318_10127661 | 3300028577 | Bacteria | 935 |
| 114 | Ga0265338_10153086 | 3300028800 | Bacteria | 1790 |
| 115 | Ga0265328_10002970 | 3300031239 | Bacteria | 7573 |
| 116 | Ga0265320_10002549 | 3300031240 | Bacteria | 12657 |
| 117 | Ga0265331_10000439 | 3300031250 | Bacteria | 40937 |
| 118 | Ga0265327_10000478 | 3300031251 | Bacteria | 70530 |
| 119 | Ga0265327_10028322 | 3300031251 | Bacteria | 3206 |
| 120 | Ga0265313_10047021 | 3300031595 | Bacteria | 2091 |
| 121 | Ga0265314_10007315 | 3300031711 | Bacteria | 9588 |
| 122 | Ga0265314_10131335 | 3300031711 | Bacteria | 1562 |
| 123 | Ga0307409_100329228 | 3300031995 | Bacteria | 1433 |
| 124 | Ga0373926_0012279 | 3300035083 | Bacteria | 2895 |
| 125 | Ga0373953_0032660 | 3300035117 | Bacteria | 2032 |
| 126 | Ga0373955_0087776 | 3300035172 | Bacteria | 1768 |
| 127 | Ga0373933_0019351 | 3300035724 | Bacteria | 3845 |
| 128 | Ga0373947_0224214 | 3300035725 | Bacteria | 1236 |
| 129 | Ga0373937_0003772 | 3300036401 | Bacteria | 12811 |
| 130 | Ga0373937_0004232 | 3300036401 | Bacteria | 12168 |
| 131 | Ga0373925_0043135 | 3300037068 | Bacteria | 3347 |
| 132 | Ga0373925_0268257 | 3300037068 | Bacteria | 1372 |
| 133 | Ga0395905_0141961 | 3300037471 | Bacteria | 2259 |
| 134 | Ga0395905_0149446 | 3300037471 | Bacteria | 2198 |
| 135 | Ga0395905_0189017 | 3300037471 | Bacteria | 1932 |
| 136 | Ga0436364_0128168 | 3300037853 | Bacteria | 71580 |
| 137 | Ga0436364_0529119 | 3300037853 | Bacteria | 4493 |
| 138 | Ga0436364_0935334 | 3300037853 | Bacteria | 2641 |
| 139 | Ga0436364_0951399 | 3300037853 | Bacteria | 78546 |
| 140 | Ga0436364_1311347 | 3300037853 | Bacteria | 979 |
| 141 | Ga0436365_0013964 | 3300039437 | Bacteria | 1601 |
| 142 | Ga0436365_1706482 | 3300039437 | Bacteria | 2302 |
| 143 | Ga0436360_0337072 | 3300039438 | Bacteria | 2320 |
| 144 | Ga0436360_0786449 | 3300039438 | Bacteria | 2210 |
| 145 | Ga0436360_1009532 | 3300039438 | Bacteria | 2800 |
| 146 | Ga0436361_0195763 | 3300039447 | Bacteria | 5114 |
| 147 | Ga0436361_0481653 | 3300039447 | Bacteria | 1617 |
| 148 | Ga0436361_0499155 | 3300039447 | Bacteria | 977 |
| 149 | Ga0436361_0958692 | 3300039447 | Bacteria | 2825 |
| 150 | Ga0436361_1157770 | 3300039447 | Bacteria | 2309 |
| 151 | Ga0436363_1198921 | 3300039450 | Bacteria | 1920 |
| 152 | Ga0436363_1690371 | 3300039450 | Bacteria | 3472 |
| 153 | Ga0436362_0919298 | 3300039453 | Bacteria | 5191 |
| 154 | Ga0436362_0965066 | 3300039453 | Bacteria | 3116 |
| 155 | Ga0436362_1180744 | 3300039453 | Bacteria | 2807 |
| 156 | Ga0436362_1208773 | 3300039453 | Bacteria | 2281 |
| 157 | Ga0450923_005742 | 3300042125 | Bacteria | 2022 |
| 158 | Ga0439459_0003766 | 3300042438 | Bacteria | 2422 |
| 159 | Ga0466972_0086413 | 3300044658 | Bacteria | 1491 |
| 160 | Ga0453684_0010451 | 3300044712 | Bacteria | 15871 |
| 161 | Ga0466960_0068873 | 3300044901 | Bacteria | 1757 |
| 162 | Ga0451576_0000040 | 3300045051 | Bacteria | 349778 |
| 163 | Ga0451576_0197747 | 3300045051 | Bacteria | 2100 |
| 164 | Ga0466967_0074446 | 3300045976 | Bacteria | 3050 |
| 165 | Ga0495580_0187005 | 3300046472 | Bacteria | 1429 |
| 166 | Ga0495643_0031476 | 3300046522 | Bacteria | 2951 |
| 167 | Ga0495640_0055009 | 3300046533 | Bacteria | 2724 |
| 168 | Ga0495640_0432927 | 3300046533 | Bacteria | 805 |
| 169 | Ga0495599_0157388 | 3300046678 | Bacteria | 1405 |
| 170 | Ga0495602_0043951 | 3300048088 | Bacteria | 4056 |
| 171 | Ga0496112_0075999 | 3300048915 | Bacteria | 3322 |
| 172 | Ga0496112_0348453 | 3300048915 | Bacteria | 1424 |
| 173 | Ga0496113_0063768 | 3300048916 | Bacteria | 2785 |
| 174 | Ga0496113_0361223 | 3300048916 | Bacteria | 1165 |
| 175 | Ga0496115_0079657 | 3300048918 | Bacteria | 2666 |
| 176 | Ga0496124_0000174 | 3300048927 | Bacteria | 129228 |
| 177 | Ga0496126_0070350 | 3300048929 | Bacteria | 3118 |
| 178 | Ga0501033_0004107 | 3300049570 | Bacteria | 11733 |
| 179 | Ga0501034_0307001 | 3300049571 | Bacteria | 1522 |
| 180 | Ga0501034_0381087 | 3300049571 | Bacteria | 1335 |
| 181 | Ga0501037_0325495 | 3300049573 | Bacteria | 1064 |
| 182 | Ga0501043_0452689 | 3300049579 | Bacteria | 964 |
| 183 | Ga0501047_0093317 | 3300049581 | Bacteria | 2889 |
| 184 | Ga0501070_0067241 | 3300049586 | Bacteria | 2968 |
| 185 | Ga0501070_0175934 | 3300049586 | Bacteria | 1762 |
| 186 | Ga0501073_0184169 | 3300049589 | Bacteria | 1445 |
| 187 | Ga0501074_0174579 | 3300049590 | Bacteria | 1534 |
| 188 | Ga0501080_0095252 | 3300049742 | Bacteria | 2764 |
| 189 | Ga0501035_0005127 | 3300049822 | Bacteria | 12397 |
| 190 | Ga0501044_0628174 | 3300049823 | Bacteria | 965 |
| 191 | nmdc:mga03683_28289_c1 | 3300050489 | Bacteria | 2228 |
| 192 | nmdc:mga0yw44_66166_c1 | 3300050492 | Bacteria | 2230 |
| 193 | nmdc:mga0k408_69014_c1 | 3300050493 | Bacteria | 2062 |
| 194 | nmdc:mga0qj67_290293_c1 | 3300050509 | Bacteria | 1325 |
| 195 | nmdc:mga08y16_112613_c1 | 3300050511 | Bacteria | 2832 |
| 196 | nmdc:mga0n895_1140441_c1 | 3300050512 | Bacteria | 755 |
| 197 | nmdc:mga08x19_21355_c1 | 3300050514 | Bacteria | 3995 |
| 198 | Ga0495619_0006137 | 3300053085 | Bacteria | 7613 |
| 199 | Ga0500651_0135984 | 3300053093 | Bacteria | 1484 |
| 200 | Ga0500616_0020147 | 3300053153 | Bacteria | 3750 |
| 201 | Ga0500645_014313 | 3300053730 | Bacteria | 2530 |
| 202 | Ga0500645_046600 | 3300053730 | Bacteria | 1272 |
| 203 | Ga0501082_0441035 | 3300060353 | Bacteria | 1137 |
| 204 | 2513578649 | 2513237085 | Bacteria | 7695351 |
| 205 | 2599102993 | 2597490356 | Bacteria | 7030811 |
| 206 | 2617383265 | 2617270742 | Bacteria | 6808054 |
| 207 | 2687578045 | 2687453129 | Bacteria | 4387428 |
| 208 | 2778173738 | 2775507266 | Bacteria | 7392367 |
| 209 | 2842335446 | 2842333319 | Bacteria | 8899485 |
| 210 | 2846952867 | 2846952575 | Bacteria | 6587527 |
| 211 | 2848858401 | 2848858292 | Bacteria | 7391279 |
| 212 | 2879103312 | 2879099564 | Bacteria | 10442239 |
| 213 | 2883296964 | 2883291878 | Bacteria | 5894118 |
| 214 | 2883359747 | 2883354860 | Bacteria | 5865246 |
| 215 | 2897808650 | 2897803580 | Bacteria | 7000062 |
| 216 | 8005490284 | 8005484373 | Bacteria | 6297373 |
| 217 | 8018153353 | 8018150411 | Bacteria | 5549903 |
| 218 | 8054003758 | 8054002106 | Bacteria | 7987183 |
| 219 | 8057160914 | 8057160832 | Bacteria | 3268302 |
| 220 | Ga0436361_1025715 | |||
| 221 | JGI25162J39368_1002159 | |||
| 222 | JGI25159J45721_1000017 | |||
| 223 | JGI25165J46597_1002377 | |||
| 224 | JGI25153J46596_10001550 | |||
| 225 | Ga0065704_10144082 | |||
| 226 | Ga0070677_10003237 | |||
| 227 | Ga0070666_10340034 | |||
| 228 | Ga0070680_100002286 | |||
| 229 | Ga0070687_100178027 | |||
| 230 | Ga0070669_100058374 | |||
| 231 | Ga0070675_100060531 | |||
| 232 | Ga0070671_100054881 | |||
| 233 | Ga0070671_100212300 | |||
| 234 | Ga0070674_100063598 | |||
| 235 | Ga0070673_100215825 | |||
| 236 | Ga0070688_100087784 | |||
| 237 | Ga0070667_100118429 | |||
| 238 | Ga0070709_10011465 | |||
| 239 | Ga0070709_10036428 | |||
| 240 | Ga0070709_10337780 | |||
| 241 | Ga0070714_100014147 | |||
| 242 | Ga0070714_100041555 | |||
| 243 | Ga0070714_100105008 | |||
| 244 | Ga0070714_100113716 | |||
| 245 | Ga0070714_100340633 | |||
| 246 | Ga0070713_100010862 | |||
| 247 | Ga0070713_100070873 | |||
| 248 | Ga0070713_100128575 | |||
| 249 | Ga0070713_100147008 | |||
| 250 | Ga0070713_100250334 | |||
| 251 | Ga0070711_100024192 | |||
| 252 | Ga0070711_100156044 | |||
| 253 | Ga0070678_100094330 | |||
| 254 | Ga0070681_10041381 | |||
| 255 | Ga0070681_10213529 | |||
| 256 | Ga0070681_10485227 | |||
| 257 | Ga0068867_100159591 | |||
| 258 | Ga0070707_100024935 | |||
| 259 | Ga0070698_100008304 | |||
| 260 | Ga0070698_100011930 | |||
| 261 | Ga0070698_100323643 | |||
| 262 | Ga0070699_100012984 | |||
| 263 | Ga0070699_100353181 | |||
| 264 | Ga0070679_100003566 | |||
| 265 | Ga0070679_100317702 | |||
| 266 | Ga0070679_100686689 | |||
| 267 | Ga0070684_100098249 | |||
| 268 | Ga0070697_100018034 | |||
| 269 | Ga0070697_100693938 | |||
| 270 | Ga0070672_100019430 | |||
| 271 | Ga0068856_100122438 | |||
| 272 | Ga0068863_100281709 | |||
| 273 | Ga0070717_10236156 | |||
| 274 | Ga0070712_100013274 | |||
| 275 | Ga0075362_10097416 | |||
| 276 | Ga0075362_10145791 | |||
| 277 | Ga0075367_10002751 | |||
| 278 | Ga0075366_10013681 | |||
| 279 | Ga0075370_10112936 | |||
| 280 | Ga0075430_100203021 | |||
| 281 | Ga0075436_100063891 | |||
| 282 | Ga0105240_10088314 | |||
| 283 | Ga0157370_10014151 | |||
| 284 | Ga0157369_10010476 | |||
| 285 | Ga0157369_10055661 | |||
| 286 | Ga0157378_10226780 | |||
| 287 | Ga0157380_10527403 | |||
| 288 | Ga0182008_10030330 | |||
| 289 | Ga0206353_10609774 | |||
| 290 | Ga0213875_10184985 | |||
| 291 | Ga0209563_106652 | |||
| 292 | Ga0209437_100107 | |||
| 293 | Ga0209233_1000531 | |||
| 294 | Ga0207426_1021230 | |||
| 295 | Ga0207682_10000722 | |||
| 296 | Ga0207692_10123245 | |||
| 297 | Ga0207699_10040975 | |||
| 298 | Ga0207699_10192636 | |||
| 299 | Ga0207645_10127311 | |||
| 300 | Ga0207684_10018812 | |||
| 301 | Ga0207707_10003899 | |||
| 302 | Ga0207695_10089985 | |||
| 303 | Ga0207693_10000472 | |||
| 304 | Ga0207693_10047885 | |||
| 305 | Ga0207693_10084985 | |||
| 306 | Ga0207663_10043627 | |||
| 307 | Ga0207663_10065572 | |||
| 308 | Ga0207660_10083617 | |||
| 309 | Ga0207660_10085225 | |||
| 310 | Ga0207662_10221126 | |||
| 311 | Ga0207652_10009920 | |||
| 312 | Ga0207652_10036978 | |||
| 313 | Ga0207652_10131421 | |||
| 314 | Ga0207652_10657942 | |||
| 315 | Ga0207646_10006857 | |||
| 316 | Ga0207646_10476504 | |||
| 317 | Ga0207681_10094562 | |||
| 318 | Ga0207700_10103529 | |||
| 319 | Ga0207700_10168956 | |||
| 320 | Ga0207700_10428611 | |||
| 321 | Ga0207664_10003593 | |||
| 322 | Ga0207664_10017248 | |||
| 323 | Ga0207664_10026396 | |||
| 324 | Ga0207664_10071152 | |||
| 325 | Ga0207669_10250042 | |||
| 326 | Ga0207665_10005214 | |||
| 327 | Ga0207691_10003529 | |||
| 328 | Ga0207679_10623082 | |||
| 329 | Ga0207648_10026626 | |||
| 330 | Ga0207676_10326820 | |||
| 331 | Ga0207683_10081921 | |||
| 332 | Ga0265318_10127661 | |||
| 333 | Ga0265338_10153086 | |||
| 334 | Ga0265328_10002970 | |||
| 335 | Ga0265320_10002549 | |||
| 336 | Ga0265331_10000439 | |||
| 337 | Ga0265327_10000478 | |||
| 338 | Ga0265327_10028322 | |||
| 339 | Ga0265313_10047021 | |||
| 340 | Ga0265314_10007315 | |||
| 341 | Ga0265314_10131335 | |||
| 342 | Ga0307409_100329228 | |||
| 343 | Ga0373926_0012279 | |||
| 344 | Ga0373953_0032660 | |||
| 345 | Ga0373955_0087776 | |||
| 346 | Ga0373933_0019351 | |||
| 347 | Ga0373947_0224214 | |||
| 348 | Ga0373937_0003772 | |||
| 349 | Ga0373937_0004232 | |||
| 350 | Ga0373925_0043135 | |||
| 351 | Ga0373925_0268257 | |||
| 352 | Ga0395905_0141961 | |||
| 353 | Ga0395905_0149446 | |||
| 354 | Ga0395905_0189017 | |||
| 355 | Ga0436364_0128168 | |||
| 356 | Ga0436364_0529119 | |||
| 357 | Ga0436364_0935334 | |||
| 358 | Ga0436364_0951399 | |||
| 359 | Ga0436364_1311347 | |||
| 360 | Ga0436365_0013964 | |||
| 361 | Ga0436365_1706482 | |||
| 362 | Ga0436360_0337072 | |||
| 363 | Ga0436360_0786449 | |||
| 364 | Ga0436360_1009532 | |||
| 365 | Ga0436361_0195763 | |||
| 366 | Ga0436361_0481653 | |||
| 367 | Ga0436361_0499155 | |||
| 368 | Ga0436361_0958692 | |||
| 369 | Ga0436361_1157770 | |||
| 370 | Ga0436363_1198921 | |||
| 371 | Ga0436363_1690371 | |||
| 372 | Ga0436362_0919298 | |||
| 373 | Ga0436362_0965066 | |||
| 374 | Ga0436362_1180744 | |||
| 375 | Ga0436362_1208773 | |||
| 376 | Ga0450923_005742 | |||
| 377 | Ga0439459_0003766 | |||
| 378 | Ga0466972_0086413 | |||
| 379 | Ga0453684_0010451 | |||
| 380 | Ga0466960_0068873 | |||
| 381 | Ga0451576_0000040 | |||
| 382 | Ga0451576_0197747 | |||
| 383 | Ga0466967_0074446 | |||
| 384 | Ga0495580_0187005 | |||
| 385 | Ga0495643_0031476 | |||
| 386 | Ga0495640_0055009 | |||
| 387 | Ga0495640_0432927 | |||
| 388 | Ga0495599_0157388 | |||
| 389 | Ga0495602_0043951 | |||
| 390 | Ga0496112_0075999 | |||
| 391 | Ga0496112_0348453 | |||
| 392 | Ga0496113_0063768 | |||
| 393 | Ga0496113_0361223 | |||
| 394 | Ga0496115_0079657 | |||
| 395 | Ga0496124_0000174 | |||
| 396 | Ga0496126_0070350 | |||
| 397 | Ga0501033_0004107 | |||
| 398 | Ga0501034_0307001 | |||
| 399 | Ga0501034_0381087 | |||
| 400 | Ga0501037_0325495 | |||
| 401 | Ga0501043_0452689 | |||
| 402 | Ga0501047_0093317 | |||
| 403 | Ga0501070_0067241 | |||
| 404 | Ga0501070_0175934 | |||
| 405 | Ga0501073_0184169 | |||
| 406 | Ga0501074_0174579 | |||
| 407 | Ga0501080_0095252 | |||
| 408 | Ga0501035_0005127 | |||
| 409 | Ga0501044_0628174 | |||
| 410 | nmdc:mga03683_28289_c1 | |||
| 411 | nmdc:mga0yw44_66166_c1 | |||
| 412 | nmdc:mga0k408_69014_c1 | |||
| 413 | nmdc:mga0qj67_290293_c1 | |||
| 414 | nmdc:mga08y16_112613_c1 | |||
| 415 | nmdc:mga0n895_1140441_c1 | |||
| 416 | nmdc:mga08x19_21355_c1 | |||
| 417 | Ga0495619_0006137 | |||
| 418 | Ga0500651_0135984 | |||
| 419 | Ga0500616_0020147 | |||
| 420 | Ga0500645_014313 | |||
| 421 | Ga0500645_046600 | |||
| 422 | Ga0501082_0441035 | |||
| 423 | 2513578649 | |||
| 424 | 2599102993 | |||
| 425 | 2617383265 | |||
| 426 | 2687578045 | |||
| 427 | 2778173738 | |||
| 428 | 2842335446 | |||
| 429 | 2846952867 | |||
| 430 | 2848858401 | |||
| 431 | 2879103312 | |||
| 432 | 2883296964 | |||
| 433 | 2883359747 | |||
| 434 | 2897808650 | |||
| 435 | 8005490284 | |||
| 436 | 8018153353 | |||
| 437 | 8054003758 | |||
| 438 | 8057160914 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zmq-assembly1.cif.gz_A | cytochrome c heme lyase ccmf | 0.7726 | 62 | 178 |
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.7069 | 14 | 228 |
| 7jh6-assembly4.cif.gz_D | de novo designed two-domain di-zn(ii) and porphyrin-binding protein | 0.6821 | 62 | 189 |
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.6614 | 14 | 228 |
| 6dyk-assembly3.cif.gz_E | iron- and nitric oxide-bound structure of the engineered cyt b562 variant, ch3y* | 0.6373 | 98 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_H3BS89_163_270_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6688 | 58 | 146 | 1.20.140.150 |
| af_E7FDH3_673_793_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.654 | 69 | 183 | 1.20.120.230 |
| af_Q9Z0U4_602_889_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.63 | 103 | 187 | 1.20.1070.10 |
| af_P53271_109_262_1.20.58.1240 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.6285 | 58 | 173 | 1.20.58.1240 |
| af_A0A2R8QLY2_647_783_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.6168 | 58 | 188 | 1.20.120.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A724V1H0-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.9003 | 49 | 174 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A724V1H0-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.8803 | 49 | 174 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A5V1IRB4-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.8795 | 49 | 186 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A7X5WB45-F1-model_v4 | deleted | 0.8782 | 26 | 174 |
|
| AF-A0A5V1IRB4-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.8675 | 49 | 186 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |