F331342

General Info

Members Datasets Scaffolds Average Seq Length
219 154 438 243

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1025715|Ga0436361_1025715_965_1786
Length 273
Sequence LRYIHSLCNHPTDQDMINRFANPARFMRFSDAAMPWFAWAALAVLAIGLYLALVVAPPDYQQGESVRIMYIHVPAAWMALSVYLLVAVASAVALVWRHPLADIAASAAAPIGAAFTLICLATGSLWGRPMWGAWWVWDARLTSVLVLFFLYLGYIALVNGFDEPSRGGRAGSVLALVGVVNLPIVKFSVDWWNTLHQPASVVRLGGPTIAISMLVPLLVMAAGFLLLFVTLLMLRMRTTLNERKAMALRLNATPGRARVSTPEPAAAPQPAVR

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
100 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
140 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
141 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
142 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
143 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
144 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
145 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
146 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
147 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
148 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
149 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
150 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
151 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
152 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
153 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
154 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.24
Metatranscriptomes 0.46
Isolates 7.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.13
Nodule 2.74
Rhizoplane 2.28
Rhizosphere 77.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_1025715 3300039447 Bacteria 2544
2 JGI25162J39368_1002159 3300002737 Bacteria 8202
3 JGI25159J45721_1000017 3300002987 Bacteria 136127
4 JGI25165J46597_1002377 3300003214 Bacteria 6266
5 JGI25153J46596_10001550 3300003215 Bacteria 13655
6 Ga0065704_10144082 3300005289 Bacteria 1489
7 Ga0070677_10003237 3300005333 Bacteria 5241
8 Ga0070666_10340034 3300005335 Bacteria 1073
9 Ga0070680_100002286 3300005336 Bacteria 14173
10 Ga0070687_100178027 3300005343 Bacteria 1271
11 Ga0070669_100058374 3300005353 Bacteria 2831
12 Ga0070675_100060531 3300005354 Bacteria 3126
13 Ga0070671_100054881 3300005355 Bacteria 3313
14 Ga0070671_100212300 3300005355 Bacteria 1642
15 Ga0070674_100063598 3300005356 Bacteria 2583
16 Ga0070673_100215825 3300005364 Bacteria 1658
17 Ga0070688_100087784 3300005365 Bacteria 2026
18 Ga0070667_100118429 3300005367 Bacteria 2302
19 Ga0070709_10011465 3300005434 Bacteria 4941
20 Ga0070709_10036428 3300005434 Bacteria 2997
21 Ga0070709_10337780 3300005434 Bacteria 1110
22 Ga0070714_100014147 3300005435 Bacteria 6406
23 Ga0070714_100041555 3300005435 Bacteria 3881
24 Ga0070714_100105008 3300005435 Bacteria 2493
25 Ga0070714_100113716 3300005435 Bacteria 2400
26 Ga0070714_100340633 3300005435 Bacteria 1406
27 Ga0070713_100010862 3300005436 Bacteria 6602
28 Ga0070713_100070873 3300005436 Bacteria 2944
29 Ga0070713_100128575 3300005436 Bacteria 2231
30 Ga0070713_100147008 3300005436 Bacteria 2093
31 Ga0070713_100250334 3300005436 Bacteria 1616
32 Ga0070711_100024192 3300005439 Bacteria 3958
33 Ga0070711_100156044 3300005439 Bacteria 1726
34 Ga0070678_100094330 3300005456 Bacteria 2303
35 Ga0070681_10041381 3300005458 Bacteria 4618
36 Ga0070681_10213529 3300005458 Bacteria 1845
37 Ga0070681_10485227 3300005458 Bacteria 1149
38 Ga0068867_100159591 3300005459 Bacteria 1777
39 Ga0070707_100024935 3300005468 Bacteria 5670
40 Ga0070698_100008304 3300005471 Bacteria 11226
41 Ga0070698_100011930 3300005471 Bacteria 9221
42 Ga0070698_100323643 3300005471 Bacteria 1473
43 Ga0070699_100012984 3300005518 Bacteria 7176
44 Ga0070699_100353181 3300005518 Bacteria 1325
45 Ga0070679_100003566 3300005530 Bacteria 14250
46 Ga0070679_100317702 3300005530 Bacteria 1507
47 Ga0070679_100686689 3300005530 Bacteria 966
48 Ga0070684_100098249 3300005535 Bacteria 2612
49 Ga0070697_100018034 3300005536 Bacteria 5562
50 Ga0070697_100693938 3300005536 Bacteria 898
51 Ga0070672_100019430 3300005543 Bacteria 4931
52 Ga0068856_100122438 3300005614 Bacteria 2603
53 Ga0068863_100281709 3300005841 Bacteria 1611
54 Ga0070717_10236156 3300006028 Bacteria 1611
55 Ga0070712_100013274 3300006175 Bacteria 5261
56 Ga0075362_10097416 3300006177 Bacteria 1371
57 Ga0075362_10145791 3300006177 Bacteria 1133
58 Ga0075367_10002751 3300006178 Bacteria 8136
59 Ga0075366_10013681 3300006195 Bacteria 4625
60 Ga0075370_10112936 3300006353 Bacteria 1579
61 Ga0075430_100203021 3300006846 Bacteria 1646
62 Ga0075436_100063891 3300006914 Bacteria 2544
63 Ga0105240_10088314 3300009093 Bacteria 3794
64 Ga0157370_10014151 3300013104 Bacteria 8180
65 Ga0157369_10010476 3300013105 Bacteria 10558
66 Ga0157369_10055661 3300013105 Bacteria 4270
67 Ga0157378_10226780 3300013297 Bacteria 1778
68 Ga0157380_10527403 3300014326 Bacteria 1153
69 Ga0182008_10030330 3300014497 Bacteria 2726
70 Ga0206353_10609774 3300020082 Bacteria 1801
71 Ga0213875_10184985 3300021388 Bacteria 979
72 Ga0209563_106652 3300025230 Bacteria 1967
73 Ga0209437_100107 3300025233 Bacteria 218656
74 Ga0209233_1000531 3300025261 Bacteria 21804
75 Ga0207426_1021230 3300025302 Bacteria 2246
76 Ga0207682_10000722 3300025893 Bacteria 15329
77 Ga0207692_10123245 3300025898 Bacteria 1454
78 Ga0207699_10040975 3300025906 Bacteria 2672
79 Ga0207699_10192636 3300025906 Bacteria 1377
80 Ga0207645_10127311 3300025907 Bacteria 1656
81 Ga0207684_10018812 3300025910 Bacteria 5910
82 Ga0207707_10003899 3300025912 Bacteria 13228
83 Ga0207695_10089985 3300025913 Bacteria 3085
84 Ga0207693_10000472 3300025915 Bacteria 36723
85 Ga0207693_10047885 3300025915 Bacteria 3358
86 Ga0207693_10084985 3300025915 Bacteria 2479
87 Ga0207663_10043627 3300025916 Bacteria 2747
88 Ga0207663_10065572 3300025916 Bacteria 2322
89 Ga0207660_10083617 3300025917 Bacteria 2351
90 Ga0207660_10085225 3300025917 Bacteria 2330
91 Ga0207662_10221126 3300025918 Bacteria 1233
92 Ga0207652_10009920 3300025921 Bacteria 7665
93 Ga0207652_10036978 3300025921 Bacteria 4130
94 Ga0207652_10131421 3300025921 Bacteria 2233
95 Ga0207652_10657942 3300025921 Bacteria 937
96 Ga0207646_10006857 3300025922 Bacteria 11704
97 Ga0207646_10476504 3300025922 Bacteria 1125
98 Ga0207681_10094562 3300025923 Bacteria 2142
99 Ga0207700_10103529 3300025928 Bacteria 2276
100 Ga0207700_10168956 3300025928 Bacteria 1823
101 Ga0207700_10428611 3300025928 Bacteria 1163
102 Ga0207664_10003593 3300025929 Bacteria 10371
103 Ga0207664_10017248 3300025929 Bacteria 5288
104 Ga0207664_10026396 3300025929 Bacteria 4390
105 Ga0207664_10071152 3300025929 Bacteria 2801
106 Ga0207669_10250042 3300025937 Bacteria 1319
107 Ga0207665_10005214 3300025939 Bacteria 8683
108 Ga0207691_10003529 3300025940 Bacteria 15210
109 Ga0207679_10623082 3300025945 Bacteria 974
110 Ga0207648_10026626 3300026089 Bacteria 5137
111 Ga0207676_10326820 3300026095 Bacteria 1410
112 Ga0207683_10081921 3300026121 Bacteria 2865
113 Ga0265318_10127661 3300028577 Bacteria 935
114 Ga0265338_10153086 3300028800 Bacteria 1790
115 Ga0265328_10002970 3300031239 Bacteria 7573
116 Ga0265320_10002549 3300031240 Bacteria 12657
117 Ga0265331_10000439 3300031250 Bacteria 40937
118 Ga0265327_10000478 3300031251 Bacteria 70530
119 Ga0265327_10028322 3300031251 Bacteria 3206
120 Ga0265313_10047021 3300031595 Bacteria 2091
121 Ga0265314_10007315 3300031711 Bacteria 9588
122 Ga0265314_10131335 3300031711 Bacteria 1562
123 Ga0307409_100329228 3300031995 Bacteria 1433
124 Ga0373926_0012279 3300035083 Bacteria 2895
125 Ga0373953_0032660 3300035117 Bacteria 2032
126 Ga0373955_0087776 3300035172 Bacteria 1768
127 Ga0373933_0019351 3300035724 Bacteria 3845
128 Ga0373947_0224214 3300035725 Bacteria 1236
129 Ga0373937_0003772 3300036401 Bacteria 12811
130 Ga0373937_0004232 3300036401 Bacteria 12168
131 Ga0373925_0043135 3300037068 Bacteria 3347
132 Ga0373925_0268257 3300037068 Bacteria 1372
133 Ga0395905_0141961 3300037471 Bacteria 2259
134 Ga0395905_0149446 3300037471 Bacteria 2198
135 Ga0395905_0189017 3300037471 Bacteria 1932
136 Ga0436364_0128168 3300037853 Bacteria 71580
137 Ga0436364_0529119 3300037853 Bacteria 4493
138 Ga0436364_0935334 3300037853 Bacteria 2641
139 Ga0436364_0951399 3300037853 Bacteria 78546
140 Ga0436364_1311347 3300037853 Bacteria 979
141 Ga0436365_0013964 3300039437 Bacteria 1601
142 Ga0436365_1706482 3300039437 Bacteria 2302
143 Ga0436360_0337072 3300039438 Bacteria 2320
144 Ga0436360_0786449 3300039438 Bacteria 2210
145 Ga0436360_1009532 3300039438 Bacteria 2800
146 Ga0436361_0195763 3300039447 Bacteria 5114
147 Ga0436361_0481653 3300039447 Bacteria 1617
148 Ga0436361_0499155 3300039447 Bacteria 977
149 Ga0436361_0958692 3300039447 Bacteria 2825
150 Ga0436361_1157770 3300039447 Bacteria 2309
151 Ga0436363_1198921 3300039450 Bacteria 1920
152 Ga0436363_1690371 3300039450 Bacteria 3472
153 Ga0436362_0919298 3300039453 Bacteria 5191
154 Ga0436362_0965066 3300039453 Bacteria 3116
155 Ga0436362_1180744 3300039453 Bacteria 2807
156 Ga0436362_1208773 3300039453 Bacteria 2281
157 Ga0450923_005742 3300042125 Bacteria 2022
158 Ga0439459_0003766 3300042438 Bacteria 2422
159 Ga0466972_0086413 3300044658 Bacteria 1491
160 Ga0453684_0010451 3300044712 Bacteria 15871
161 Ga0466960_0068873 3300044901 Bacteria 1757
162 Ga0451576_0000040 3300045051 Bacteria 349778
163 Ga0451576_0197747 3300045051 Bacteria 2100
164 Ga0466967_0074446 3300045976 Bacteria 3050
165 Ga0495580_0187005 3300046472 Bacteria 1429
166 Ga0495643_0031476 3300046522 Bacteria 2951
167 Ga0495640_0055009 3300046533 Bacteria 2724
168 Ga0495640_0432927 3300046533 Bacteria 805
169 Ga0495599_0157388 3300046678 Bacteria 1405
170 Ga0495602_0043951 3300048088 Bacteria 4056
171 Ga0496112_0075999 3300048915 Bacteria 3322
172 Ga0496112_0348453 3300048915 Bacteria 1424
173 Ga0496113_0063768 3300048916 Bacteria 2785
174 Ga0496113_0361223 3300048916 Bacteria 1165
175 Ga0496115_0079657 3300048918 Bacteria 2666
176 Ga0496124_0000174 3300048927 Bacteria 129228
177 Ga0496126_0070350 3300048929 Bacteria 3118
178 Ga0501033_0004107 3300049570 Bacteria 11733
179 Ga0501034_0307001 3300049571 Bacteria 1522
180 Ga0501034_0381087 3300049571 Bacteria 1335
181 Ga0501037_0325495 3300049573 Bacteria 1064
182 Ga0501043_0452689 3300049579 Bacteria 964
183 Ga0501047_0093317 3300049581 Bacteria 2889
184 Ga0501070_0067241 3300049586 Bacteria 2968
185 Ga0501070_0175934 3300049586 Bacteria 1762
186 Ga0501073_0184169 3300049589 Bacteria 1445
187 Ga0501074_0174579 3300049590 Bacteria 1534
188 Ga0501080_0095252 3300049742 Bacteria 2764
189 Ga0501035_0005127 3300049822 Bacteria 12397
190 Ga0501044_0628174 3300049823 Bacteria 965
191 nmdc:mga03683_28289_c1 3300050489 Bacteria 2228
192 nmdc:mga0yw44_66166_c1 3300050492 Bacteria 2230
193 nmdc:mga0k408_69014_c1 3300050493 Bacteria 2062
194 nmdc:mga0qj67_290293_c1 3300050509 Bacteria 1325
195 nmdc:mga08y16_112613_c1 3300050511 Bacteria 2832
196 nmdc:mga0n895_1140441_c1 3300050512 Bacteria 755
197 nmdc:mga08x19_21355_c1 3300050514 Bacteria 3995
198 Ga0495619_0006137 3300053085 Bacteria 7613
199 Ga0500651_0135984 3300053093 Bacteria 1484
200 Ga0500616_0020147 3300053153 Bacteria 3750
201 Ga0500645_014313 3300053730 Bacteria 2530
202 Ga0500645_046600 3300053730 Bacteria 1272
203 Ga0501082_0441035 3300060353 Bacteria 1137
204 2513578649 2513237085 Bacteria 7695351
205 2599102993 2597490356 Bacteria 7030811
206 2617383265 2617270742 Bacteria 6808054
207 2687578045 2687453129 Bacteria 4387428
208 2778173738 2775507266 Bacteria 7392367
209 2842335446 2842333319 Bacteria 8899485
210 2846952867 2846952575 Bacteria 6587527
211 2848858401 2848858292 Bacteria 7391279
212 2879103312 2879099564 Bacteria 10442239
213 2883296964 2883291878 Bacteria 5894118
214 2883359747 2883354860 Bacteria 5865246
215 2897808650 2897803580 Bacteria 7000062
216 8005490284 8005484373 Bacteria 6297373
217 8018153353 8018150411 Bacteria 5549903
218 8054003758 8054002106 Bacteria 7987183
219 8057160914 8057160832 Bacteria 3268302
220 Ga0436361_1025715
221 JGI25162J39368_1002159
222 JGI25159J45721_1000017
223 JGI25165J46597_1002377
224 JGI25153J46596_10001550
225 Ga0065704_10144082
226 Ga0070677_10003237
227 Ga0070666_10340034
228 Ga0070680_100002286
229 Ga0070687_100178027
230 Ga0070669_100058374
231 Ga0070675_100060531
232 Ga0070671_100054881
233 Ga0070671_100212300
234 Ga0070674_100063598
235 Ga0070673_100215825
236 Ga0070688_100087784
237 Ga0070667_100118429
238 Ga0070709_10011465
239 Ga0070709_10036428
240 Ga0070709_10337780
241 Ga0070714_100014147
242 Ga0070714_100041555
243 Ga0070714_100105008
244 Ga0070714_100113716
245 Ga0070714_100340633
246 Ga0070713_100010862
247 Ga0070713_100070873
248 Ga0070713_100128575
249 Ga0070713_100147008
250 Ga0070713_100250334
251 Ga0070711_100024192
252 Ga0070711_100156044
253 Ga0070678_100094330
254 Ga0070681_10041381
255 Ga0070681_10213529
256 Ga0070681_10485227
257 Ga0068867_100159591
258 Ga0070707_100024935
259 Ga0070698_100008304
260 Ga0070698_100011930
261 Ga0070698_100323643
262 Ga0070699_100012984
263 Ga0070699_100353181
264 Ga0070679_100003566
265 Ga0070679_100317702
266 Ga0070679_100686689
267 Ga0070684_100098249
268 Ga0070697_100018034
269 Ga0070697_100693938
270 Ga0070672_100019430
271 Ga0068856_100122438
272 Ga0068863_100281709
273 Ga0070717_10236156
274 Ga0070712_100013274
275 Ga0075362_10097416
276 Ga0075362_10145791
277 Ga0075367_10002751
278 Ga0075366_10013681
279 Ga0075370_10112936
280 Ga0075430_100203021
281 Ga0075436_100063891
282 Ga0105240_10088314
283 Ga0157370_10014151
284 Ga0157369_10010476
285 Ga0157369_10055661
286 Ga0157378_10226780
287 Ga0157380_10527403
288 Ga0182008_10030330
289 Ga0206353_10609774
290 Ga0213875_10184985
291 Ga0209563_106652
292 Ga0209437_100107
293 Ga0209233_1000531
294 Ga0207426_1021230
295 Ga0207682_10000722
296 Ga0207692_10123245
297 Ga0207699_10040975
298 Ga0207699_10192636
299 Ga0207645_10127311
300 Ga0207684_10018812
301 Ga0207707_10003899
302 Ga0207695_10089985
303 Ga0207693_10000472
304 Ga0207693_10047885
305 Ga0207693_10084985
306 Ga0207663_10043627
307 Ga0207663_10065572
308 Ga0207660_10083617
309 Ga0207660_10085225
310 Ga0207662_10221126
311 Ga0207652_10009920
312 Ga0207652_10036978
313 Ga0207652_10131421
314 Ga0207652_10657942
315 Ga0207646_10006857
316 Ga0207646_10476504
317 Ga0207681_10094562
318 Ga0207700_10103529
319 Ga0207700_10168956
320 Ga0207700_10428611
321 Ga0207664_10003593
322 Ga0207664_10017248
323 Ga0207664_10026396
324 Ga0207664_10071152
325 Ga0207669_10250042
326 Ga0207665_10005214
327 Ga0207691_10003529
328 Ga0207679_10623082
329 Ga0207648_10026626
330 Ga0207676_10326820
331 Ga0207683_10081921
332 Ga0265318_10127661
333 Ga0265338_10153086
334 Ga0265328_10002970
335 Ga0265320_10002549
336 Ga0265331_10000439
337 Ga0265327_10000478
338 Ga0265327_10028322
339 Ga0265313_10047021
340 Ga0265314_10007315
341 Ga0265314_10131335
342 Ga0307409_100329228
343 Ga0373926_0012279
344 Ga0373953_0032660
345 Ga0373955_0087776
346 Ga0373933_0019351
347 Ga0373947_0224214
348 Ga0373937_0003772
349 Ga0373937_0004232
350 Ga0373925_0043135
351 Ga0373925_0268257
352 Ga0395905_0141961
353 Ga0395905_0149446
354 Ga0395905_0189017
355 Ga0436364_0128168
356 Ga0436364_0529119
357 Ga0436364_0935334
358 Ga0436364_0951399
359 Ga0436364_1311347
360 Ga0436365_0013964
361 Ga0436365_1706482
362 Ga0436360_0337072
363 Ga0436360_0786449
364 Ga0436360_1009532
365 Ga0436361_0195763
366 Ga0436361_0481653
367 Ga0436361_0499155
368 Ga0436361_0958692
369 Ga0436361_1157770
370 Ga0436363_1198921
371 Ga0436363_1690371
372 Ga0436362_0919298
373 Ga0436362_0965066
374 Ga0436362_1180744
375 Ga0436362_1208773
376 Ga0450923_005742
377 Ga0439459_0003766
378 Ga0466972_0086413
379 Ga0453684_0010451
380 Ga0466960_0068873
381 Ga0451576_0000040
382 Ga0451576_0197747
383 Ga0466967_0074446
384 Ga0495580_0187005
385 Ga0495643_0031476
386 Ga0495640_0055009
387 Ga0495640_0432927
388 Ga0495599_0157388
389 Ga0495602_0043951
390 Ga0496112_0075999
391 Ga0496112_0348453
392 Ga0496113_0063768
393 Ga0496113_0361223
394 Ga0496115_0079657
395 Ga0496124_0000174
396 Ga0496126_0070350
397 Ga0501033_0004107
398 Ga0501034_0307001
399 Ga0501034_0381087
400 Ga0501037_0325495
401 Ga0501043_0452689
402 Ga0501047_0093317
403 Ga0501070_0067241
404 Ga0501070_0175934
405 Ga0501073_0184169
406 Ga0501074_0174579
407 Ga0501080_0095252
408 Ga0501035_0005127
409 Ga0501044_0628174
410 nmdc:mga03683_28289_c1
411 nmdc:mga0yw44_66166_c1
412 nmdc:mga0k408_69014_c1
413 nmdc:mga0qj67_290293_c1
414 nmdc:mga08y16_112613_c1
415 nmdc:mga0n895_1140441_c1
416 nmdc:mga08x19_21355_c1
417 Ga0495619_0006137
418 Ga0500651_0135984
419 Ga0500616_0020147
420 Ga0500645_014313
421 Ga0500645_046600
422 Ga0501082_0441035
423 2513578649
424 2599102993
425 2617383265
426 2687578045
427 2778173738
428 2842335446
429 2846952867
430 2848858401
431 2879103312
432 2883296964
433 2883359747
434 2897808650
435 8005490284
436 8018153353
437 8054003758
438 8057160914

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

19

196

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.7726 62 178
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.7069 14 228
7jh6-assembly4.cif.gz_D de novo designed two-domain di-zn(ii) and porphyrin-binding protein 0.6821 62 189
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.6614 14 228
6dyk-assembly3.cif.gz_E iron- and nitric oxide-bound structure of the engineered cyt b562 variant, ch3y* 0.6373 98 173
ID Description Score Start End Superfamily
af_H3BS89_163_270_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6688 58 146 1.20.140.150
af_E7FDH3_673_793_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.654 69 183 1.20.120.230
af_Q9Z0U4_602_889_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.63 103 187 1.20.1070.10
af_P53271_109_262_1.20.58.1240 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6285 58 173 1.20.58.1240
af_A0A2R8QLY2_647_783_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6168 58 188 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A724V1H0-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.9003 49 174 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A724V1H0-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.8803 49 174 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A5V1IRB4-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.8795 49 186 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A7X5WB45-F1-model_v4 deleted 0.8782 26 174
AF-A0A5V1IRB4-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.8675 49 186 GO:0005886
GO:0015232
GO:0017004
GO:0020037

Map