F331146

General Info

Members Datasets Scaffolds Average Seq Length
219 172 211 294

Family's Representative Sequence

Representative Sequence 3300024227|Ga0228598_1009087|Ga0228598_10090872
Length 312
Sequence VIHAVMEHQGTHVGIERMCALAGVSRAGYYRHWLASKPRQEETALRDAIQRLSLVQRKNGYREGYRLITIQLQRMGWAVNHKRVARIRREDNLLCVPKQSFRPPTTDSRHGWRVWPNLARHLVPMAVNQLWVADITYIRMSEAFVYLAVVLDGFSRRVVGWAMADHLRAELALSALDMAIGNRHVTQGELIHHSDQGVQYACGDYIARLERAGIQPSRSRAGCPWDNAMAESFMRTLKREEVNGQAYRDRAEAEASIEAFIEVVYNRQRLHSALAYLAPEEFEVKQNAPSCMAASVAGGGLLSPVAIEAHTL

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
39 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
40 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
166 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
167 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
168 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
169 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
170 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
171 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
172 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 0
Isolates 3.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 3.65
Rhizoplane 7.31
Rhizosphere 80.82
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10319556 3300003322 Bacteria 1348
2 Ga0070683_100161796 3300005329 Bacteria 2124
3 Ga0070667_100000006 3300005367 Bacteria 336732
4 Ga0070667_100114418 3300005367 Bacteria 2342
5 Ga0070713_100123643 3300005436 Bacteria 2272
6 Ga0070711_100193756 3300005439 Bacteria 1564
7 Ga0070698_100309586 3300005471 Bacteria 1510
8 Ga0070684_100182904 3300005535 Bacteria 1906
9 Ga0068855_100162676 3300005563 Bacteria 2532
10 Ga0068855_100303703 3300005563 Bacteria 1767
11 Ga0068855_100419084 3300005563 Bacteria 1465
12 Ga0068854_100086758 3300005578 Bacteria 2321
13 Ga0068859_100121855 3300005617 Bacteria 2674
14 Ga0068859_100130794 3300005617 Bacteria 2581
15 Ga0068864_100000930 3300005618 Bacteria 24547
16 Ga0068861_100007919 3300005719 Bacteria 7311
17 Ga0068861_100193978 3300005719 Bacteria 1700
18 Ga0068858_100341390 3300005842 Bacteria 1433
19 Ga0068860_100000120 3300005843 Bacteria 125823
20 Ga0068860_100262542 3300005843 Bacteria 1683
21 Ga0068860_100441278 3300005843 Bacteria 1293
22 Ga0081455_10087346 3300005937 Bacteria 2537
23 Ga0081540_1023492 3300005983 Bacteria 3603
24 Ga0070717_10207999 3300006028 Bacteria 1716
25 Ga0075364_10155418 3300006051 Bacteria 1543
26 Ga0070712_100161475 3300006175 Bacteria 1731
27 Ga0068865_100133854 3300006881 Bacteria 1860
28 Ga0097620_100130794 3300006931 Bacteria 2581
29 Ga0105240_10410635 3300009093 Bacteria 1523
30 Ga0105245_10173059 3300009098 Bacteria 2057
31 Ga0105245_10236399 3300009098 Bacteria 1769
32 Ga0105247_10173449 3300009101 Bacteria 1435
33 Ga0105243_10083150 3300009148 Bacteria 2618
34 Ga0105243_10174026 3300009148 Bacteria 1867
35 Ga0105248_10499594 3300009177 Bacteria 1371
36 Ga0105237_10294213 3300009545 Bacteria 1626
37 Ga0105238_10022447 3300009551 Bacteria 6432
38 Ga0105238_10140623 3300009551 Bacteria 2391
39 Ga0105238_10171473 3300009551 Bacteria 2146
40 Ga0105249_10137333 3300009553 Bacteria 2341
41 Ga0157374_10360554 3300013296 Bacteria 1445
42 Ga0157378_10353772 3300013297 Bacteria 1435
43 Ga0157375_10116076 3300013308 Bacteria 2781
44 Ga0163163_10261973 3300014325 Bacteria 1780
45 Ga0157377_10076438 3300014745 Bacteria 1947
46 Ga0157379_10186838 3300014968 Bacteria 1873
47 Ga0163161_10221287 3300017792 Bacteria 1466
48 Ga0213872_10033721 3300021361 Bacteria 2346
49 Ga0213872_10059388 3300021361 Unclassified 1730
50 Ga0213872_10086285 3300021361 Bacteria 1406
51 Ga0213871_10027528 3300021441 Bacteria 1460
52 Ga0213871_10028750 3300021441 Bacteria 1436
53 Ga0224572_1022932 3300024225 Unclassified 1199
54 Ga0228598_1009087 3300024227 Bacteria 1997
55 Ga0209758_1058584 3300025297 Bacteria 1287
56 Ga0207642_10069252 3300025899 Bacteria 1673
57 Ga0207710_10084168 3300025900 Bacteria 1480
58 Ga0207693_10138624 3300025915 Bacteria 1913
59 Ga0207694_10097766 3300025924 Bacteria 2323
60 Ga0207687_10002928 3300025927 Bacteria 11595
61 Ga0207687_10064503 3300025927 Bacteria 2598
62 Ga0207709_10073177 3300025935 Bacteria 2183
63 Ga0207709_10211783 3300025935 Bacteria 1391
64 Ga0207670_10225774 3300025936 Bacteria 1436
65 Ga0207704_10279535 3300025938 Bacteria 1268
66 Ga0207711_10091053 3300025941 Bacteria 2682
67 Ga0207711_10346967 3300025941 Bacteria 1374
68 Ga0207689_10448384 3300025942 Bacteria 1078
69 Ga0207661_10316798 3300025944 Bacteria 1401
70 Ga0207667_10399335 3300025949 Bacteria 1400
71 Ga0207651_10364850 3300025960 Bacteria 1220
72 Ga0207658_10000010 3300025986 Bacteria 240224
73 Ga0207658_10109084 3300025986 Bacteria 2184
74 Ga0207703_10314000 3300026035 Bacteria 1433
75 Ga0207639_10400462 3300026041 Bacteria 1236
76 Ga0207676_10000239 3300026095 Bacteria 47772
77 Ga0207675_100054451 3300026118 Bacteria 3732
78 Ga0268264_10000070 3300028381 Bacteria 268524
79 Ga0268264_10316243 3300028381 Bacteria 1475
80 Ga0307517_10039405 3300028786 Bacteria 5189
81 Ga0265338_10026564 3300028800 Bacteria 5835
82 Ga0265324_10036788 3300029957 Bacteria 1701
83 Ga0265330_10055544 3300031235 Bacteria 1729
84 Ga0265332_10063141 3300031238 Bacteria 1582
85 Ga0265328_10089215 3300031239 Bacteria 1138
86 Ga0265325_10078229 3300031241 Bacteria 1647
87 Ga0265329_10037193 3300031242 Bacteria 1568
88 Ga0265339_10098666 3300031249 Bacteria 1523
89 Ga0265327_10050831 3300031251 Bacteria 2166
90 Ga0265316_10086224 3300031344 Bacteria 2400
91 Ga0265316_10121711 3300031344 Bacteria 1970
92 Ga0265316_10355048 3300031344 Bacteria 1061
93 Ga0265314_10148307 3300031711 Bacteria 1441
94 Ga0265314_10157302 3300031711 Bacteria 1386
95 Ga0265342_10069632 3300031712 Bacteria 2053
96 Ga0307413_10112033 3300031824 Bacteria 1828
97 Ga0373926_0012495 3300035083 Bacteria 2871
98 Ga0373934_0069200 3300035086 Bacteria 1410
99 Ga0373944_0023412 3300035089 Bacteria 1801
100 Ga0373936_0041683 3300035113 Bacteria 1841
101 Ga0373945_0033263 3300035116 Bacteria 1831
102 Ga0373953_0029107 3300035117 Bacteria 2134
103 Ga0373956_0039263 3300035119 Bacteria 2097
104 Ga0373943_0016792 3300035170 Bacteria 3344
105 Ga0373955_0106620 3300035172 Bacteria 1615
106 Ga0373927_0035614 3300035695 Bacteria 3236
107 Ga0373947_0119120 3300035725 Bacteria 1675
108 Ga0373937_0025598 3300036401 Bacteria 5328
109 Ga0373925_0005736 3300037068 Bacteria 9229
110 Ga0436360_0172232 3300039438 Bacteria 2060
111 Ga0436360_0645242 3300039438 Bacteria 1989
112 Ga0436360_1321273 3300039438 Bacteria 1466
113 Ga0436360_1353296 3300039438 Bacteria 1573
114 Ga0436361_0059597 3300039447 Unclassified 1371
115 Ga0436361_0165650 3300039447 Bacteria 1731
116 Ga0436361_0239055 3300039447 Bacteria 1750
117 Ga0436361_0270290 3300039447 Bacteria 1698
118 Ga0436361_0764009 3300039447 Bacteria 4040
119 Ga0436361_0766278 3300039447 Bacteria 5123
120 Ga0436361_1049570 3300039447 Unclassified 2898
121 Ga0436361_1126565 3300039447 Bacteria 10670
122 Ga0436363_0755379 3300039450 Bacteria 1556
123 Ga0436362_0511815 3300039453 Bacteria 2538
124 Ga0436362_0683647 3300039453 Bacteria 2027
125 Ga0436362_1179636 3300039453 Bacteria 1612
126 Ga0451807_1929891 3300041486 Bacteria 956
127 Ga0466961_0255677 3300044693 Bacteria 1075
128 Ga0466963_0080476 3300044694 Bacteria 2205
129 Ga0466963_0313847 3300044694 Bacteria 1103
130 Ga0466957_0097353 3300044842 Bacteria 1850
131 Ga0466958_0112572 3300045836 Bacteria 1699
132 Ga0466958_0180527 3300045836 Bacteria 1339
133 Ga0466967_0324397 3300045976 Bacteria 1485
134 Ga0466967_0350966 3300045976 Bacteria 1428
135 Ga0495638_0027590 3300046460 Bacteria 3674
136 Ga0495641_0062459 3300046461 Bacteria 1680
137 Ga0495653_0110039 3300046463 Bacteria 1981
138 Ga0495639_0062807 3300046475 Bacteria 1704
139 Ga0495662_0084663 3300046476 Bacteria 1543
140 Ga0495664_0108877 3300046477 Bacteria 1671
141 Ga0495594_0111043 3300046499 Bacteria 1546
142 Ga0495618_0104479 3300046514 Bacteria 1813
143 Ga0495648_0052380 3300046524 Bacteria 2479
144 Ga0495666_0062565 3300046526 Bacteria 1777
145 Ga0495665_0078785 3300046531 Bacteria 1733
146 Ga0495640_0247462 3300046533 Bacteria 1117
147 Ga0495586_0108551 3300046535 Bacteria 1543
148 Ga0495587_0095022 3300046536 Bacteria 1720
149 Ga0495597_0074879 3300046542 Bacteria 1453
150 Ga0495645_0071440 3300046543 Unclassified 2502
151 Ga0495634_0117237 3300046642 Unclassified 1707
152 Ga0495635_0040053 3300046663 Bacteria 3239
153 Ga0495657_0090097 3300046675 Bacteria 1969
154 Ga0495623_0114268 3300046679 Bacteria 1632
155 Ga0495646_0081132 3300046680 Bacteria 1890
156 Ga0495658_0077521 3300046683 Unclassified 1943
157 Ga0495613_0051514 3300046689 Bacteria 3033
158 Ga0495624_0088364 3300046690 Bacteria 1913
159 Ga0495670_0020866 3300046691 Bacteria 3230
160 Ga0495600_0000810 3300046809 Bacteria 16604
161 Ga0495600_0087979 3300046809 Bacteria 2026
162 Ga0495581_0096302 3300047315 Bacteria 1718
163 Ga0495604_0157025 3300047317 Bacteria 1610
164 Ga0495676_0091348 3300047321 Bacteria 2276
165 Ga0495683_0108402 3300047323 Bacteria 1328
166 Ga0495686_0142458 3300047472 Bacteria 1413
167 Ga0495593_0036539 3300047673 Plasmid 2663
168 Ga0495602_0269363 3300048088 Bacteria 1259
169 Ga0496100_0092367 3300048903 Bacteria 2068
170 Ga0496101_0238269 3300048904 Bacteria 1415
171 Ga0496102_0103522 3300048905 Bacteria 2647
172 Ga0496102_0187376 3300048905 Bacteria 1950
173 Ga0496103_0043575 3300048906 Bacteria 2763
174 Ga0496103_0132802 3300048906 Bacteria 1590
175 Ga0496104_0454678 3300048907 Bacteria 1192
176 Ga0496106_0129604 3300048909 Bacteria 1977
177 Ga0496107_0108415 3300048910 Bacteria 2039
178 Ga0496107_0177316 3300048910 Bacteria 1582
179 Ga0496107_0224863 3300048910 Bacteria 1396
180 Ga0496107_0415164 3300048910 Bacteria 1001
181 Ga0496109_0248634 3300048912 Bacteria 1674
182 Ga0496114_0249427 3300048917 Bacteria 1562
183 Ga0496115_0196632 3300048918 Bacteria 1666
184 Ga0496116_0074817 3300048919 Bacteria 2128
185 Ga0496117_0034314 3300048920 Bacteria 3824
186 Ga0496118_0122656 3300048921 Bacteria 1689
187 Ga0496119_0018740 3300048922 Bacteria 5134
188 Ga0496120_0045291 3300048923 Bacteria 2549
189 Ga0496120_0091593 3300048923 Bacteria 1623
190 Ga0496121_0200466 3300048924 Bacteria 1423
191 Ga0496124_0220853 3300048927 Bacteria 1425
192 Ga0501032_0161155 3300049569 Bacteria 1473
193 Ga0501033_0200729 3300049570 Unclassified 1424
194 Ga0501036_0152955 3300049572 Bacteria 1946
195 Ga0501047_0209470 3300049581 Bacteria 1808
196 Ga0501047_0234521 3300049581 Bacteria 1687
197 Ga0501070_0246865 3300049586 Bacteria 1461
198 Ga0501074_0310460 3300049590 Bacteria 1120
199 Ga0501080_0209779 3300049742 Bacteria 1785
200 Ga0501080_0265660 3300049742 Bacteria 1562
201 Ga0501083_0292784 3300049744 Bacteria 1059
202 Ga0501035_0168974 3300049822 Bacteria 1890
203 Ga0501044_0170793 3300049823 Bacteria 2146
204 nmdc:mga03683_80856_c1 3300050489 Bacteria 1403
205 Ga0495601_0173523 3300053077 Bacteria 1409
206 Ga0495612_0040242 3300053078 Bacteria 1903
207 Ga0495619_0204353 3300053085 Bacteria 1367
208 Ga0500559_0024225 3300053136 Bacteria 2581
209 Ga0500568_0029472 3300053139 Bacteria 2277
210 Ga0500616_0074105 3300053153 Bacteria 1726
211 Ga0500616_0090142 3300053153 Bacteria 1520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0024225 Ga0500559_0024225_1104_1922 239
2 3300006051 Ga0075364_10155418 Ga0075364_101554182 247
3 3300044694 Ga0466963_0313847 Ga0466963_0313847_31_930 247
4 3300045976 Ga0466967_0324397 Ga0466967_0324397_103_1002 247
5 3300047472 Ga0495686_0142458 Ga0495686_0142458_52_924 247
6 3300053153 Ga0500616_0074105 Ga0500616_0074105_790_1662 247
7 3300005367 Ga0070667_100000006 Ga0070667_10000000685 251
8 3300005843 Ga0068860_100000120 Ga0068860_10000012053 251
9 3300025986 Ga0207658_10000010 Ga0207658_1000001084 251
10 3300028381 Ga0268264_10000070 Ga0268264_1000007024 251
11 3300005719 Ga0068861_100007919 Ga0068861_1000079194 252
12 3300031824 Ga0307413_10112033 Ga0307413_101120332 254
13 3300005563 Ga0068855_100419084 Ga0068855_1004190841 255
14 3300005578 Ga0068854_100086758 Ga0068854_1000867582 255
15 3300005843 Ga0068860_100262542 Ga0068860_1002625422 255
16 3300025942 Ga0207689_10448384 Ga0207689_104483842 255
17 3300028381 Ga0268264_10316243 Ga0268264_103162431 255
18 3300009545 Ga0105237_10294213 Ga0105237_102942132 259
19 3300009551 Ga0105238_10022447 Ga0105238_100224472 259
20 3300026041 Ga0207639_10400462 Ga0207639_104004621 259
21 3300046691 Ga0495670_0020866 Ga0495670_0020866_1701_2762 259
22 3300017792 Ga0163161_10221287 Ga0163161_102212871 261
23 3300044694 Ga0466963_0080476 Ga0466963_0080476_24_896 263
24 3300046642 Ga0495634_0117237 Ga0495634_0117237_134_1009 264
25 3300039447 Ga0436361_0165650 Ga0436361_0165650_634_1512 265
26 3300044842 Ga0466957_0097353 Ga0466957_0097353_720_1625 265
27 3300045836 Ga0466958_0112572 Ga0466958_0112572_374_1279 265
28 3300048923 Ga0496120_0091593 Ga0496120_0091593_704_1543 265
29 3300006028 Ga0070717_10207999 Ga0070717_102079993 266
30 3300014325 Ga0163163_10261973 Ga0163163_102619733 266
31 3300045836 Ga0466958_0180527 Ga0466958_0180527_392_1285 266
32 3300048910 Ga0496107_0415164 Ga0496107_0415164_15_872 266
33 3300048917 Ga0496114_0249427 Ga0496114_0249427_382_1239 266
34 iso_pu_bacteria 8016522445 8016529858 266
35 iso_pu_bacteria 8016530956 8016535093 266
36 iso_pu_bacteria 8016539877 8016548297 266
37 iso_pu_bacteria 8016548790 8016553827 266
38 iso_pu_bacteria 8016557553 8016562204 266
39 iso_pu_bacteria 8016575299 8016577566 266
40 iso_pu_bacteria 8016595262 8016600019 266
41 iso_pu_bacteria 8019530166 8019534845 266
42 3300009093 Ga0105240_10410635 Ga0105240_104106352 267
43 3300005617 Ga0068859_100130794 Ga0068859_1001307943 268
44 3300006931 Ga0097620_100130794 Ga0097620_1001307942 268
45 3300029957 Ga0265324_10036788 Ga0265324_100367881 268
46 3300031235 Ga0265330_10055544 Ga0265330_100555443 268
47 3300031238 Ga0265332_10063141 Ga0265332_100631411 268
48 3300031239 Ga0265328_10089215 Ga0265328_100892152 268
49 3300031241 Ga0265325_10078229 Ga0265325_100782291 268
50 3300031242 Ga0265329_10037193 Ga0265329_100371931 268
51 3300031249 Ga0265339_10098666 Ga0265339_100986661 268
52 3300031251 Ga0265327_10050831 Ga0265327_100508312 268
53 3300031344 Ga0265316_10086224 Ga0265316_100862241 268
54 3300031344 Ga0265316_10121711 Ga0265316_101217111 268
55 3300031711 Ga0265314_10148307 Ga0265314_101483071 268
56 3300031711 Ga0265314_10157302 Ga0265314_101573022 268
57 3300031712 Ga0265342_10069632 Ga0265342_100696322 268
58 3300045976 Ga0466967_0350966 Ga0466967_0350966_503_1339 268
59 3300049744 Ga0501083_0292784 Ga0501083_0292784_184_1032 270
60 3300046460 Ga0495638_0027590 Ga0495638_0027590_1283_2143 272
61 3300047323 Ga0495683_0108402 Ga0495683_0108402_344_1207 272
62 3300005563 Ga0068855_100162676 Ga0068855_1001626763 273
63 3300053153 Ga0500616_0090142 Ga0500616_0090142_198_1061 273
64 3300021361 Ga0213872_10059388 Ga0213872_100593882 274
65 3300039447 Ga0436361_0059597 Ga0436361_0059597_33_893 274
66 3300041486 Ga0451807_1929891 Ga0451807_1929891_37_897 274
67 3300048910 Ga0496107_0224863 Ga0496107_0224863_11_862 274
68 3300044693 Ga0466961_0255677 Ga0466961_0255677_74_1018 275
69 3300048912 Ga0496109_0248634 Ga0496109_0248634_127_981 275
70 3300049570 Ga0501033_0200729 Ga0501033_0200729_489_1370 275
71 3300049581 Ga0501047_0234521 Ga0501047_0234521_731_1612 275
72 3300049742 Ga0501080_0209779 Ga0501080_0209779_820_1701 275
73 3300005436 Ga0070713_100123643 Ga0070713_1001236431 276
74 3300005439 Ga0070711_100193756 Ga0070711_1001937561 276
75 3300005983 Ga0081540_1023492 Ga0081540_10234923 276
76 3300006175 Ga0070712_100161475 Ga0070712_1001614751 276
77 3300009177 Ga0105248_10499594 Ga0105248_104995942 276
78 3300021361 Ga0213872_10033721 Ga0213872_100337212 276
79 3300021361 Ga0213872_10086285 Ga0213872_100862852 276
80 3300025915 Ga0207693_10138624 Ga0207693_101386243 276
81 3300025941 Ga0207711_10346967 Ga0207711_103469671 276
82 3300031344 Ga0265316_10355048 Ga0265316_103550481 276
83 3300035083 Ga0373926_0012495 Ga0373926_0012495_605_1516 276
84 3300035086 Ga0373934_0069200 Ga0373934_0069200_392_1303 276
85 3300035089 Ga0373944_0023412 Ga0373944_0023412_517_1428 276
86 3300035113 Ga0373936_0041683 Ga0373936_0041683_397_1308 276
87 3300035116 Ga0373945_0033263 Ga0373945_0033263_275_1186 276
88 3300035117 Ga0373953_0029107 Ga0373953_0029107_280_1191 276
89 3300035119 Ga0373956_0039263 Ga0373956_0039263_990_1901 276
90 3300035170 Ga0373943_0016792 Ga0373943_0016792_653_1564 276
91 3300035172 Ga0373955_0106620 Ga0373955_0106620_544_1455 276
92 3300035695 Ga0373927_0035614 Ga0373927_0035614_1058_1969 276
93 3300035725 Ga0373947_0119120 Ga0373947_0119120_209_1120 276
94 3300036401 Ga0373937_0025598 Ga0373937_0025598_3164_4075 276
95 3300037068 Ga0373925_0005736 Ga0373925_0005736_5918_6829 276
96 3300039438 Ga0436360_1353296 Ga0436360_1353296_444_1301 276
97 3300039447 Ga0436361_0764009 Ga0436361_0764009_504_1361 276
98 3300039447 Ga0436361_0766278 Ga0436361_0766278_3940_4797 276
99 3300039447 Ga0436361_1049570 Ga0436361_1049570_415_1272 276
100 3300039447 Ga0436361_1126565 Ga0436361_1126565_2793_3650 276
101 3300046461 Ga0495641_0062459 Ga0495641_0062459_157_1068 276
102 3300046463 Ga0495653_0110039 Ga0495653_0110039_106_1017 276
103 3300046475 Ga0495639_0062807 Ga0495639_0062807_122_1033 276
104 3300046476 Ga0495662_0084663 Ga0495662_0084663_81_992 276
105 3300046477 Ga0495664_0108877 Ga0495664_0108877_496_1407 276
106 3300046499 Ga0495594_0111043 Ga0495594_0111043_599_1510 276
107 3300046514 Ga0495618_0104479 Ga0495618_0104479_339_1250 276
108 3300046531 Ga0495665_0078785 Ga0495665_0078785_108_1019 276
109 3300046533 Ga0495640_0247462 Ga0495640_0247462_108_1019 276
110 3300046535 Ga0495586_0108551 Ga0495586_0108551_71_982 276
111 3300046536 Ga0495587_0095022 Ga0495587_0095022_125_1036 276
112 3300046543 Ga0495645_0071440 Ga0495645_0071440_393_1304 276
113 3300046663 Ga0495635_0040053 Ga0495635_0040053_565_1476 276
114 3300046675 Ga0495657_0090097 Ga0495657_0090097_108_1019 276
115 3300046679 Ga0495623_0114268 Ga0495623_0114268_564_1475 276
116 3300046680 Ga0495646_0081132 Ga0495646_0081132_822_1733 276
117 3300046683 Ga0495658_0077521 Ga0495658_0077521_929_1840 276
118 3300046689 Ga0495613_0051514 Ga0495613_0051514_1954_2865 276
119 3300046690 Ga0495624_0088364 Ga0495624_0088364_753_1664 276
120 3300046809 Ga0495600_0087979 Ga0495600_0087979_962_1873 276
121 3300047315 Ga0495581_0096302 Ga0495581_0096302_22_933 276
122 3300047317 Ga0495604_0157025 Ga0495604_0157025_106_1017 276
123 3300047321 Ga0495676_0091348 Ga0495676_0091348_326_1237 276
124 3300047673 Ga0495593_0036539 Ga0495593_0036539_21_932 276
125 3300048088 Ga0495602_0269363 Ga0495602_0269363_108_1019 276
126 3300048903 Ga0496100_0092367 Ga0496100_0092367_617_1525 276
127 3300048904 Ga0496101_0238269 Ga0496101_0238269_36_944 276
128 3300048905 Ga0496102_0103522 Ga0496102_0103522_49_957 276
129 3300048906 Ga0496103_0043575 Ga0496103_0043575_1231_2139 276
130 3300048909 Ga0496106_0129604 Ga0496106_0129604_566_1474 276
131 3300048910 Ga0496107_0108415 Ga0496107_0108415_520_1428 276
132 3300048919 Ga0496116_0074817 Ga0496116_0074817_653_1561 276
133 3300048920 Ga0496117_0034314 Ga0496117_0034314_902_1810 276
134 3300048921 Ga0496118_0122656 Ga0496118_0122656_343_1251 276
135 3300048922 Ga0496119_0018740 Ga0496119_0018740_3278_4186 276
136 3300048923 Ga0496120_0045291 Ga0496120_0045291_1433_2341 276
137 3300048927 Ga0496124_0220853 Ga0496124_0220853_61_969 276
138 3300049569 Ga0501032_0161155 Ga0501032_0161155_108_1013 276
139 3300049572 Ga0501036_0152955 Ga0501036_0152955_467_1372 276
140 3300049581 Ga0501047_0209470 Ga0501047_0209470_712_1617 276
141 3300049586 Ga0501070_0246865 Ga0501070_0246865_500_1405 276
142 3300049590 Ga0501074_0310460 Ga0501074_0310460_141_1046 276
143 3300049742 Ga0501080_0265660 Ga0501080_0265660_484_1389 276
144 3300049822 Ga0501035_0168974 Ga0501035_0168974_663_1568 276
145 3300049823 Ga0501044_0170793 Ga0501044_0170793_384_1289 276
146 3300050489 nmdc:mga03683_80856_c1 nmdc:mga03683_80856_c1_452_1360 276
147 3300053077 Ga0495601_0173523 Ga0495601_0173523_391_1302 276
148 3300053078 Ga0495612_0040242 Ga0495612_0040242_926_1837 276
149 3300053085 Ga0495619_0204353 Ga0495619_0204353_349_1260 276
150 3300005329 Ga0070683_100161796 Ga0070683_1001617961 277
151 3300005471 Ga0070698_100309586 Ga0070698_1003095862 277
152 3300005535 Ga0070684_100182904 Ga0070684_1001829043 277
153 3300005563 Ga0068855_100303703 Ga0068855_1003037031 277
154 3300005618 Ga0068864_100000930 Ga0068864_10000093030 277
155 3300005937 Ga0081455_10087346 Ga0081455_100873462 277
156 3300006881 Ga0068865_100133854 Ga0068865_1001338542 277
157 3300009098 Ga0105245_10173059 Ga0105245_101730594 277
158 3300009098 Ga0105245_10236399 Ga0105245_102363992 277
159 3300009148 Ga0105243_10174026 Ga0105243_101740262 277
160 3300009551 Ga0105238_10140623 Ga0105238_101406233 277
161 3300009551 Ga0105238_10171473 Ga0105238_101714733 277
162 3300009553 Ga0105249_10137333 Ga0105249_101373333 277
163 3300024225 Ga0224572_1022932 Ga0224572_10229321 277
164 3300024227 Ga0228598_1009087 Ga0228598_10090872 277
165 3300025924 Ga0207694_10097766 Ga0207694_100977662 277
166 3300025927 Ga0207687_10064503 Ga0207687_100645032 277
167 3300025935 Ga0207709_10211783 Ga0207709_102117832 277
168 3300025936 Ga0207670_10225774 Ga0207670_102257742 277
169 3300025938 Ga0207704_10279535 Ga0207704_102795352 277
170 3300025944 Ga0207661_10316798 Ga0207661_103167982 277
171 3300025949 Ga0207667_10399335 Ga0207667_103993351 277
172 3300026095 Ga0207676_10000239 Ga0207676_100002395 277
173 3300039438 Ga0436360_1321273 Ga0436360_1321273_75_986 277
174 3300039447 Ga0436361_0270290 Ga0436361_0270290_382_1290 277
175 3300039450 Ga0436363_0755379 Ga0436363_0755379_149_1057 277
176 3300046526 Ga0495666_0062565 Ga0495666_0062565_287_1180 277
177 3300048905 Ga0496102_0187376 Ga0496102_0187376_378_1271 277
178 3300048906 Ga0496103_0132802 Ga0496103_0132802_642_1535 277
179 3300048907 Ga0496104_0454678 Ga0496104_0454678_37_930 277
180 3300048910 Ga0496107_0177316 Ga0496107_0177316_100_993 277
181 3300048924 Ga0496121_0200466 Ga0496121_0200466_323_1216 277
182 3300053139 Ga0500568_0029472 Ga0500568_0029472_356_1249 277
183 3300003322 rootL2_10319556 rootL2_103195562 279
184 3300005367 Ga0070667_100114418 Ga0070667_1001144183 279
185 3300005617 Ga0068859_100121855 Ga0068859_1001218553 279
186 3300005719 Ga0068861_100193978 Ga0068861_1001939781 279
187 3300005842 Ga0068858_100341390 Ga0068858_1003413902 279
188 3300005843 Ga0068860_100441278 Ga0068860_1004412781 279
189 3300009101 Ga0105247_10173449 Ga0105247_101734491 279
190 3300009148 Ga0105243_10083150 Ga0105243_100831503 279
191 3300013296 Ga0157374_10360554 Ga0157374_103605542 279
192 3300013297 Ga0157378_10353772 Ga0157378_103537721 279
193 3300013308 Ga0157375_10116076 Ga0157375_101160763 279
194 3300014745 Ga0157377_10076438 Ga0157377_100764383 279
195 3300014968 Ga0157379_10186838 Ga0157379_101868382 279
196 3300021441 Ga0213871_10027528 Ga0213871_100275282 279
197 3300021441 Ga0213871_10028750 Ga0213871_100287501 279
198 3300025297 Ga0209758_1058584 Ga0209758_10585842 279
199 3300025899 Ga0207642_10069252 Ga0207642_100692522 279
200 3300025900 Ga0207710_10084168 Ga0207710_100841681 279
201 3300025927 Ga0207687_10002928 Ga0207687_100029287 279
202 3300025935 Ga0207709_10073177 Ga0207709_100731771 279
203 3300025941 Ga0207711_10091053 Ga0207711_100910532 279
204 3300025960 Ga0207651_10364850 Ga0207651_103648501 279
205 3300025986 Ga0207658_10109084 Ga0207658_101090841 279
206 3300026035 Ga0207703_10314000 Ga0207703_103140001 279
207 3300026118 Ga0207675_100054451 Ga0207675_1000544512 279
208 3300028786 Ga0307517_10039405 Ga0307517_100394054 279
209 3300028800 Ga0265338_10026564 Ga0265338_100265643 279
210 3300039438 Ga0436360_0172232 Ga0436360_0172232_237_1139 279
211 3300039438 Ga0436360_0645242 Ga0436360_0645242_1059_1961 279
212 3300039447 Ga0436361_0239055 Ga0436361_0239055_625_1527 279
213 3300039453 Ga0436362_0511815 Ga0436362_0511815_471_1373 279
214 3300039453 Ga0436362_0683647 Ga0436362_0683647_914_1816 279
215 3300039453 Ga0436362_1179636 Ga0436362_1179636_152_1054 279
216 3300046524 Ga0495648_0052380 Ga0495648_0052380_1396_2286 279
217 3300046542 Ga0495597_0074879 Ga0495597_0074879_520_1410 279
218 3300046809 Ga0495600_0000810 Ga0495600_0000810_7158_8048 279
219 3300048918 Ga0496115_0196632 Ga0496115_0196632_316_1206 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

212

279

0.97

PF13333

rve_2

Integrase core domain

231

286

0.96

PF00665

rve

Integrase core domain

124

224

0.94

PF13276

HTH_21

HTH-like domain

40

101

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u9s-assembly1.cif.gz_C crystal structure of nqrc from vibrio cholerae 0.7806 115 150
3oyi-assembly1.cif.gz_B crystal structure of the pfv s217q mutant intasome in complex with manganese 0.6956 104 216
2x6n-assembly3.cif.gz_C human foamy virus integrase - catalytic core. manganese-bound structure. 0.694 109 220
4w6u-assembly2.cif.gz_B crystal structure of full-length split gfp mutant e115h/t118h with nickel mediated crystal contacts, p 21 21 21 space group 0.6939 110 145
2x6n-assembly2.cif.gz_E human foamy virus integrase - catalytic core. manganese-bound structure. 0.6661 106 220
ID Description Score Start End Superfamily
3fhzB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8793 30 74 1.10.10.10
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8644 101 173 3.30.420.10
af_O13981_436_790_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8627 127 147 2.130.10.10
2p5kA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8376 30 72 1.10.10.10
af_Q47718_102_174_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8324 101 173 3.30.420.10
ID Description Score Start End GO Terms
AF-W2ED20-F1-model_v4 deleted 0.9256 115 201
AF-A0A2K4JH71-F1-model_v4 deleted 0.9183 118 203
AF-X1LKZ2-F1-model_v4 Integrase catalytic domain-containing protein 0.912 110 211 GO:0003676
GO:0015074
AF-A0A2S7DTL5-F1-model_v4 IS3 family transposase 0.9113 109 209 GO:0003676
GO:0015074
AF-A0A1J8P3R2-F1-model_v4 Transposase 0.9105 95 203 GO:0003676
GO:0015074

Feature Viewer

pLDDT pTM Quality
76.13 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map