F330809

General Info

Members Datasets Scaffolds Average Seq Length
219 146 438 242

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10100594|Ga0070681_101005942
Length 257
Sequence MFPYDPQLAAAVAAQPESMADVIRTMEAIDALCVPGDGLKWFNGLYLQVTNAVGARVAAGGFIDPAWLAELDVQFASLYFGALRTTLSPAAAAAPGCWRAFFDRRNQSAIARIQFALAGVNAHINRDLPIALAAASVAAGTPPTHGSQHYADYTSLNATLDSLVDAAKVTLQVRLLGDALPPISRLEDTLAAFSVTAAREGAWNHAEALWAIRDLPPLRDRVLDTLDGFTAMAGKALLVPVPDVIGVAMASPGCTTA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.28
Rhizosphere 97.72
Stem 0
Stem Tuber 0
Unclassified 23.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10100594 3300005458 Bacteria 2837
2 Ga0070658_10645407 3300005327 Unclassified 918
3 Ga0070683_100000024 3300005329 Bacteria 173376
4 Ga0070690_100126486 3300005330 Bacteria 1721
5 Ga0070670_100023110 3300005331 Bacteria 5351
6 Ga0068869_100040370 3300005334 Bacteria 3337
7 Ga0070666_10119330 3300005335 Unclassified 1828
8 Ga0070680_100090934 3300005336 Bacteria 2526
9 Ga0068868_100218557 3300005338 Unclassified 1594
10 Ga0068868_100304599 3300005338 Bacteria 1354
11 Ga0070669_100150926 3300005353 Bacteria 1799
12 Ga0070671_100217165 3300005355 Bacteria 1622
13 Ga0070673_100066946 3300005364 Bacteria 2871
14 Ga0070667_100010242 3300005367 Bacteria 7746
15 Ga0070714_100197294 3300005435 Bacteria 1840
16 Ga0070713_100125567 3300005436 Bacteria 2256
17 Ga0070708_100057103 3300005445 Bacteria 3474
18 Ga0070708_100523205 3300005445 Bacteria 1119
19 Ga0070663_100105426 3300005455 Bacteria 2110
20 Ga0070678_100010312 3300005456 Bacteria 5700
21 Ga0070678_100299562 3300005456 Unclassified 1366
22 Ga0070681_10276308 3300005458 Bacteria 1591
23 Ga0068867_100256500 3300005459 Bacteria 1424
24 Ga0068867_100267894 3300005459 Bacteria 1395
25 Ga0070706_100441721 3300005467 Unclassified 1211
26 Ga0070698_100008143 3300005471 Bacteria 11334
27 Ga0070698_100318750 3300005471 Bacteria 1485
28 Ga0070699_100104604 3300005518 Bacteria 2483
29 Ga0070699_100217105 3300005518 Bacteria 1704
30 Ga0070679_100149172 3300005530 Bacteria 2316
31 Ga0070679_100167430 3300005530 Bacteria 2171
32 Ga0070679_100203240 3300005530 Bacteria 1946
33 Ga0070679_100251088 3300005530 Unclassified 1725
34 Ga0070684_100000159 3300005535 Bacteria 45923
35 Ga0068853_100098138 3300005539 Unclassified 2587
36 Ga0070672_100163414 3300005543 Bacteria 1849
37 Ga0070665_100001862 3300005548 Bacteria 23943
38 Ga0070665_100032701 3300005548 Bacteria 5234
39 Ga0070665_100252573 3300005548 Bacteria 1764
40 Ga0070665_100431445 3300005548 Bacteria 1327
41 Ga0068855_100005180 3300005563 Bacteria 15899
42 Ga0068855_100021969 3300005563 Bacteria 7651
43 Ga0068855_100193749 3300005563 Bacteria 2291
44 Ga0068855_100419902 3300005563 Bacteria 1463
45 Ga0070664_100093599 3300005564 Bacteria 2604
46 Ga0068856_100077579 3300005614 Unclassified 3292
47 Ga0068856_100258265 3300005614 Bacteria 1757
48 Ga0068852_100014823 3300005616 Bacteria 6022
49 Ga0068852_100082855 3300005616 Bacteria 2851
50 Ga0068852_100188640 3300005616 Bacteria 1944
51 Ga0068861_100242240 3300005719 Bacteria 1534
52 Ga0068863_100554982 3300005841 Unclassified 1134
53 Ga0068858_100264419 3300005842 Bacteria 1636
54 Ga0068860_100169834 3300005843 Bacteria 2106
55 Ga0097621_100006054 3300006237 Bacteria 8552
56 Ga0097621_100078899 3300006237 Unclassified 2736
57 Ga0097621_100169462 3300006237 Bacteria 1881
58 Ga0097621_100439682 3300006237 Bacteria 1173
59 Ga0068871_100067348 3300006358 Bacteria 2937
60 Ga0068871_100174304 3300006358 Bacteria 1845
61 Ga0068871_100180226 3300006358 Bacteria 1815
62 Ga0068871_100255409 3300006358 Unclassified 1528
63 Ga0068865_100248518 3300006881 Unclassified 1403
64 Ga0105240_10014931 3300009093 Bacteria 10581
65 Ga0105240_10025660 3300009093 Bacteria 7741
66 Ga0105240_10336177 3300009093 Bacteria 1717
67 Ga0105240_10805996 3300009093 Unclassified 1017
68 Ga0105245_10046589 3300009098 Unclassified 3874
69 Ga0105245_10614740 3300009098 Unclassified 1114
70 Ga0105245_10647149 3300009098 Unclassified 1087
71 Ga0105245_10730419 3300009098 Unclassified 1025
72 Ga0105243_10446267 3300009148 Bacteria 1213
73 Ga0105241_10028715 3300009174 Unclassified 4145
74 Ga0105242_10007051 3300009176 Bacteria 8681
75 Ga0105242_10104596 3300009176 Bacteria 2403
76 Ga0105248_10132284 3300009177 Bacteria 2815
77 Ga0105248_10292227 3300009177 Bacteria 1835
78 Ga0105248_10693946 3300009177 Unclassified 1148
79 Ga0105248_10832764 3300009177 Unclassified 1041
80 Ga0105237_10017693 3300009545 Bacteria 7387
81 Ga0105238_10577909 3300009551 Bacteria 1130
82 Ga0105249_10179201 3300009553 Bacteria 2060
83 Ga0105239_10102985 3300010375 Bacteria 3159
84 Ga0105239_10181772 3300010375 Bacteria 2353
85 Ga0157373_10208714 3300013100 Unclassified 1377
86 Ga0157370_10006056 3300013104 Bacteria 13425
87 Ga0157369_10007049 3300013105 Bacteria 12961
88 Ga0157369_10015468 3300013105 Bacteria 8597
89 Ga0157369_10020700 3300013105 Bacteria 7354
90 Ga0157374_10119216 3300013296 Bacteria 2545
91 Ga0157378_10063213 3300013297 Bacteria 3307
92 Ga0163162_10081171 3300013306 Unclassified 3313
93 Ga0163162_10573489 3300013306 Unclassified 1256
94 Ga0157372_10119815 3300013307 Unclassified 3021
95 Ga0157372_10147361 3300013307 Bacteria 2714
96 Ga0157372_10720269 3300013307 Bacteria 1161
97 Ga0157375_10077334 3300013308 Bacteria 3357
98 Ga0157375_10740277 3300013308 Unclassified 1135
99 Ga0157379_10011342 3300014968 Bacteria 7770
100 Ga0157379_10069805 3300014968 Bacteria 3143
101 Ga0157376_10034824 3300014969 Unclassified 4068
102 Ga0157376_10088984 3300014969 Bacteria 2669
103 Ga0157376_10108689 3300014969 Unclassified 2437
104 Ga0157376_10389357 3300014969 Bacteria 1345
105 Ga0157376_10957080 3300014969 Bacteria 877
106 Ga0163161_10278146 3300017792 Bacteria 1312
107 Ga0213872_10000689 3300021361 Bacteria 25437
108 Ga0213872_10004278 3300021361 Bacteria 7641
109 Ga0213872_10171847 3300021361 Bacteria 939
110 Ga0213871_10077741 3300021441 Bacteria 946
111 Ga0207647_10035302 3300025904 Bacteria 3187
112 Ga0207705_10445427 3300025909 Bacteria 1004
113 Ga0207654_10065564 3300025911 Bacteria 2139
114 Ga0207695_10004438 3300025913 Bacteria 19149
115 Ga0207695_10037355 3300025913 Bacteria 5241
116 Ga0207695_10310442 3300025913 Unclassified 1467
117 Ga0207695_10579455 3300025913 Unclassified 1003
118 Ga0207660_10042658 3300025917 Unclassified 3185
119 Ga0207657_10247446 3300025919 Bacteria 1422
120 Ga0207652_10093961 3300025921 Unclassified 2640
121 Ga0207652_10199390 3300025921 Unclassified 1801
122 Ga0207646_10130251 3300025922 Bacteria 2263
123 Ga0207650_10069294 3300025925 Bacteria 2650
124 Ga0207687_10278723 3300025927 Bacteria 1339
125 Ga0207687_10565407 3300025927 Unclassified 955
126 Ga0207664_10411473 3300025929 Unclassified 1204
127 Ga0207644_10226864 3300025931 Unclassified 1483
128 Ga0207706_10097433 3300025933 Bacteria 2587
129 Ga0207686_10232869 3300025934 Bacteria 1336
130 Ga0207711_10085607 3300025941 Bacteria 2762
131 Ga0207711_10281282 3300025941 Unclassified 1532
132 Ga0207689_10035545 3300025942 Bacteria 4139
133 Ga0207661_10000038 3300025944 Bacteria 136281
134 Ga0207661_10161550 3300025944 Bacteria 1944
135 Ga0207679_10070920 3300025945 Bacteria 2627
136 Ga0207667_10031505 3300025949 Bacteria 5724
137 Ga0207667_10262803 3300025949 Bacteria 1765
138 Ga0207651_10325038 3300025960 Unclassified 1287
139 Ga0207712_10240806 3300025961 Unclassified 1457
140 Ga0207658_10054796 3300025986 Bacteria 2952
141 Ga0207677_10115899 3300026023 Bacteria 2005
142 Ga0207703_10063208 3300026035 Bacteria 3034
143 Ga0207703_10347735 3300026035 Bacteria 1364
144 Ga0207639_10050136 3300026041 Bacteria 3169
145 Ga0207678_10134270 3300026067 Bacteria 2111
146 Ga0207702_10102196 3300026078 Unclassified 2533
147 Ga0207641_10123193 3300026088 Bacteria 2317
148 Ga0207641_10539131 3300026088 Unclassified 1137
149 Ga0207683_10010496 3300026121 Bacteria 7903
150 Ga0207698_10025065 3300026142 Unclassified 4195
151 Ga0207698_10637663 3300026142 Bacteria 1054
152 Ga0268266_10108678 3300028379 Unclassified 2454
153 Ga0268266_10177716 3300028379 Bacteria 1936
154 Ga0265319_1024698 3300028563 Bacteria 2159
155 Ga0265338_10365546 3300028800 Bacteria 1034
156 Ga0265760_10008804 3300031090 Bacteria 2885
157 Ga0265332_10078531 3300031238 Bacteria 1401
158 Ga0265316_10273007 3300031344 Bacteria 1237
159 Ga0265314_10073800 3300031711 Bacteria 2274
160 Ga0307409_100821722 3300031995 Bacteria 938
161 Ga0373926_0028776 3300035083 Bacteria 1951
162 Ga0373935_0007871 3300035692 Bacteria 6391
163 Ga0373927_0009932 3300035695 Bacteria 6379
164 Ga0373947_0123152 3300035725 Bacteria 1649
165 Ga0373937_1365915 3300036401 Unclassified 656
166 Ga0373925_0014717 3300037068 Bacteria 5652
167 Ga0373925_0214886 3300037068 Bacteria 1533
168 Ga0373925_0242154 3300037068 Bacteria 1445
169 Ga0395898_0105940 3300037466 Unclassified 2697
170 Ga0436360_0273674 3300039438 Bacteria 1895
171 Ga0436360_1000234 3300039438 Unclassified 952
172 Ga0436361_0279132 3300039447 Unclassified 3759
173 Ga0436361_0440059 3300039447 Bacteria 984
174 Ga0436361_0902439 3300039447 Bacteria 94295
175 Ga0436361_0905098 3300039447 Bacteria 1000
176 Ga0436361_0950109 3300039447 Bacteria 1188
177 Ga0466967_0228883 3300045976 Bacteria 1769
178 Ga0495629_0052801 3300046459 Bacteria 2844
179 Ga0495629_0119468 3300046459 Bacteria 1837
180 Ga0495580_0064006 3300046472 Bacteria 2578
181 Ga0495645_0001245 3300046543 Bacteria 17375
182 Ga0495645_0205902 3300046543 Archaea 1331
183 Ga0495667_0029425 3300046559 Unclassified 3698
184 Ga0495635_0307179 3300046663 Unclassified 1063
185 Ga0495613_0283175 3300046689 Bacteria 1151
186 Ga0495680_0132520 3300047322 Bacteria 1830
187 Ga0495675_0019856 3300047444 Unclassified 4270
188 Ga0495684_0160206 3300047471 Bacteria 1679
189 Ga0496105_0399088 3300048908 Unclassified 1092
190 Ga0496106_0439754 3300048909 Bacteria 1048
191 Ga0496114_0039688 3300048917 Bacteria 3896
192 Ga0496115_0053791 3300048918 Bacteria 3232
193 Ga0496115_0503483 3300048918 Unclassified 973
194 Ga0501031_0045723 3300049568 Bacteria 2856
195 Ga0501032_0027765 3300049569 Bacteria 3889
196 Ga0501033_0006961 3300049570 Bacteria 8829
197 Ga0501036_0001304 3300049572 Bacteria 19109
198 Ga0501037_0000852 3300049573 Bacteria 22742
199 Ga0501038_0024558 3300049574 Bacteria 5376
200 Ga0501039_0014444 3300049575 Bacteria 6046
201 Ga0501040_0263471 3300049576 Unclassified 1230
202 Ga0501043_0008849 3300049579 Bacteria 7921
203 Ga0501046_0054157 3300049580 Bacteria 3157
204 Ga0501068_0000234 3300049584 Bacteria 26949
205 Ga0501069_0003617 3300049585 Bacteria 7964
206 Ga0501070_0005792 3300049586 Bacteria 10543
207 Ga0501072_0002523 3300049588 Bacteria 13706
208 Ga0501073_0000482 3300049589 Bacteria 27716
209 Ga0501074_0017580 3300049590 Bacteria 5192
210 Ga0501076_0010528 3300049592 Bacteria 6864
211 Ga0501077_0005461 3300049593 Bacteria 7738
212 Ga0501079_0002938 3300049741 Bacteria 12452
213 Ga0501080_0001468 3300049742 Bacteria 19844
214 Ga0501044_0001219 3300049823 Bacteria 30541
215 Ga0501044_0011048 3300049823 Bacteria 9793
216 Ga0495595_0150099 3300053084 Bacteria 1147
217 Ga0501084_0014970 3300054114 Bacteria 6430
218 Ga0501082_0000580 3300060353 Bacteria 32432
219 Ga0501082_0004844 3300060353 Bacteria 11736
220 Ga0070681_10100594
221 Ga0070658_10645407
222 Ga0070683_100000024
223 Ga0070690_100126486
224 Ga0070670_100023110
225 Ga0068869_100040370
226 Ga0070666_10119330
227 Ga0070680_100090934
228 Ga0068868_100218557
229 Ga0068868_100304599
230 Ga0070669_100150926
231 Ga0070671_100217165
232 Ga0070673_100066946
233 Ga0070667_100010242
234 Ga0070714_100197294
235 Ga0070713_100125567
236 Ga0070708_100057103
237 Ga0070708_100523205
238 Ga0070663_100105426
239 Ga0070678_100010312
240 Ga0070678_100299562
241 Ga0070681_10276308
242 Ga0068867_100256500
243 Ga0068867_100267894
244 Ga0070706_100441721
245 Ga0070698_100008143
246 Ga0070698_100318750
247 Ga0070699_100104604
248 Ga0070699_100217105
249 Ga0070679_100149172
250 Ga0070679_100167430
251 Ga0070679_100203240
252 Ga0070679_100251088
253 Ga0070684_100000159
254 Ga0068853_100098138
255 Ga0070672_100163414
256 Ga0070665_100001862
257 Ga0070665_100032701
258 Ga0070665_100252573
259 Ga0070665_100431445
260 Ga0068855_100005180
261 Ga0068855_100021969
262 Ga0068855_100193749
263 Ga0068855_100419902
264 Ga0070664_100093599
265 Ga0068856_100077579
266 Ga0068856_100258265
267 Ga0068852_100014823
268 Ga0068852_100082855
269 Ga0068852_100188640
270 Ga0068861_100242240
271 Ga0068863_100554982
272 Ga0068858_100264419
273 Ga0068860_100169834
274 Ga0097621_100006054
275 Ga0097621_100078899
276 Ga0097621_100169462
277 Ga0097621_100439682
278 Ga0068871_100067348
279 Ga0068871_100174304
280 Ga0068871_100180226
281 Ga0068871_100255409
282 Ga0068865_100248518
283 Ga0105240_10014931
284 Ga0105240_10025660
285 Ga0105240_10336177
286 Ga0105240_10805996
287 Ga0105245_10046589
288 Ga0105245_10614740
289 Ga0105245_10647149
290 Ga0105245_10730419
291 Ga0105243_10446267
292 Ga0105241_10028715
293 Ga0105242_10007051
294 Ga0105242_10104596
295 Ga0105248_10132284
296 Ga0105248_10292227
297 Ga0105248_10693946
298 Ga0105248_10832764
299 Ga0105237_10017693
300 Ga0105238_10577909
301 Ga0105249_10179201
302 Ga0105239_10102985
303 Ga0105239_10181772
304 Ga0157373_10208714
305 Ga0157370_10006056
306 Ga0157369_10007049
307 Ga0157369_10015468
308 Ga0157369_10020700
309 Ga0157374_10119216
310 Ga0157378_10063213
311 Ga0163162_10081171
312 Ga0163162_10573489
313 Ga0157372_10119815
314 Ga0157372_10147361
315 Ga0157372_10720269
316 Ga0157375_10077334
317 Ga0157375_10740277
318 Ga0157379_10011342
319 Ga0157379_10069805
320 Ga0157376_10034824
321 Ga0157376_10088984
322 Ga0157376_10108689
323 Ga0157376_10389357
324 Ga0157376_10957080
325 Ga0163161_10278146
326 Ga0213872_10000689
327 Ga0213872_10004278
328 Ga0213872_10171847
329 Ga0213871_10077741
330 Ga0207647_10035302
331 Ga0207705_10445427
332 Ga0207654_10065564
333 Ga0207695_10004438
334 Ga0207695_10037355
335 Ga0207695_10310442
336 Ga0207695_10579455
337 Ga0207660_10042658
338 Ga0207657_10247446
339 Ga0207652_10093961
340 Ga0207652_10199390
341 Ga0207646_10130251
342 Ga0207650_10069294
343 Ga0207687_10278723
344 Ga0207687_10565407
345 Ga0207664_10411473
346 Ga0207644_10226864
347 Ga0207706_10097433
348 Ga0207686_10232869
349 Ga0207711_10085607
350 Ga0207711_10281282
351 Ga0207689_10035545
352 Ga0207661_10000038
353 Ga0207661_10161550
354 Ga0207679_10070920
355 Ga0207667_10031505
356 Ga0207667_10262803
357 Ga0207651_10325038
358 Ga0207712_10240806
359 Ga0207658_10054796
360 Ga0207677_10115899
361 Ga0207703_10063208
362 Ga0207703_10347735
363 Ga0207639_10050136
364 Ga0207678_10134270
365 Ga0207702_10102196
366 Ga0207641_10123193
367 Ga0207641_10539131
368 Ga0207683_10010496
369 Ga0207698_10025065
370 Ga0207698_10637663
371 Ga0268266_10108678
372 Ga0268266_10177716
373 Ga0265319_1024698
374 Ga0265338_10365546
375 Ga0265760_10008804
376 Ga0265332_10078531
377 Ga0265316_10273007
378 Ga0265314_10073800
379 Ga0307409_100821722
380 Ga0373926_0028776
381 Ga0373935_0007871
382 Ga0373927_0009932
383 Ga0373947_0123152
384 Ga0373937_1365915
385 Ga0373925_0014717
386 Ga0373925_0214886
387 Ga0373925_0242154
388 Ga0395898_0105940
389 Ga0436360_0273674
390 Ga0436360_1000234
391 Ga0436361_0279132
392 Ga0436361_0440059
393 Ga0436361_0902439
394 Ga0436361_0905098
395 Ga0436361_0950109
396 Ga0466967_0228883
397 Ga0495629_0052801
398 Ga0495629_0119468
399 Ga0495580_0064006
400 Ga0495645_0001245
401 Ga0495645_0205902
402 Ga0495667_0029425
403 Ga0495635_0307179
404 Ga0495613_0283175
405 Ga0495680_0132520
406 Ga0495675_0019856
407 Ga0495684_0160206
408 Ga0496105_0399088
409 Ga0496106_0439754
410 Ga0496114_0039688
411 Ga0496115_0053791
412 Ga0496115_0503483
413 Ga0501031_0045723
414 Ga0501032_0027765
415 Ga0501033_0006961
416 Ga0501036_0001304
417 Ga0501037_0000852
418 Ga0501038_0024558
419 Ga0501039_0014444
420 Ga0501040_0263471
421 Ga0501043_0008849
422 Ga0501046_0054157
423 Ga0501068_0000234
424 Ga0501069_0003617
425 Ga0501070_0005792
426 Ga0501072_0002523
427 Ga0501073_0000482
428 Ga0501074_0017580
429 Ga0501076_0010528
430 Ga0501077_0005461
431 Ga0501079_0002938
432 Ga0501080_0001468
433 Ga0501044_0001219
434 Ga0501044_0011048
435 Ga0495595_0150099
436 Ga0501084_0014970
437 Ga0501082_0000580
438 Ga0501082_0004844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19458

DUF5995

Family of unknown function (DUF5995)

19

240

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u9l-assembly1.cif.gz_A structure of a membrane protein 0.3806 59 237
4u9l-assembly1.cif.gz_A structure of a membrane protein 0.3717 59 237
5cwb-assembly1.cif.gz_A crystal structure of de novo designed helical repeat protein dhr4 0.3239 5 204
1pxs-assembly2.cif.gz_B structure of met56ala mutant of bacteriorhodopsin 0.3102 4 238
3hao-assembly2.cif.gz_B crystal structure of bacteriorhodopsin mutant l94a crystallized from bicelles 0.3065 4 236
ID Description Score Start End Superfamily
af_Q8GX86_53_210_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.353 25 165 1.20.140.40
af_K7KM14_42_221_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.2934 38 169 1.20.1280.290
af_Q9P6L5_856_1059_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.2923 5 168 1.20.1410.10
af_Q9VDS2_130_561_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2901 1 246 1.20.1250.20
af_P46499_74_485_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2886 28 242 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2U3KTK4-F1-model_v4 Uncharacterized protein 0.9928 1 242
AF-A0A2U3KTK4-F1-model_v4 Uncharacterized protein 0.9766 1 242
AF-A0A7W0NMC4-F1-model_v4 Uncharacterized protein 0.9504 9 145
AF-A0A538KXP9-F1-model_v4 DUF2063 domain-containing protein 0.9452 14 238
AF-A0A7W0HAZ3-F1-model_v4 Uncharacterized protein 0.9384 14 240

Map