F330715

General Info

Members Datasets Scaffolds Average Seq Length
219 136 219 186

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100284113|Ga0068869_1002841132
Length 205
Sequence MARPTFDAFAGESFYAGGPMERLPTRLDGLVLLSPAVHGDARGFFMETWRADAWQLHGVPAGFVQDNHSRSRQGTLRGIHFQTRPGQGKLVRVARGRVLDVVVDLRRGSPTFGEWEAVTLDDEHGAQLWIPVGFGHGFCVLSDIADFVYKCTSYYDPATEAGIRFDDPDVGIEWPQDVELLYSERDRLAPTLAQVADELPFRYAE

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
77 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
78 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
79 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
80 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
81 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
82 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
94 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 0
Rhizoplane 8.22
Rhizosphere 88.13
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100017443 3300005329 Bacteria 6346
2 Ga0070683_100230042 3300005329 Bacteria 1763
3 Ga0068869_100284113 3300005334 Bacteria 1331
4 Ga0068869_100680393 3300005334 Bacteria 876
5 Ga0068868_100039129 3300005338 Bacteria 3683
6 Ga0070687_100508998 3300005343 Bacteria 812
7 Ga0070661_100265503 3300005344 Bacteria 1328
8 Ga0070671_100159767 3300005355 Bacteria 1905
9 Ga0070701_10213507 3300005438 Bacteria 1147
10 Ga0070701_10226120 3300005438 Bacteria 1118
11 Ga0070700_100363458 3300005441 Bacteria 1077
12 Ga0070672_100384437 3300005543 Bacteria 1201
13 Ga0070672_101034008 3300005543 Bacteria 729
14 Ga0070695_100376664 3300005545 Bacteria 1070
15 Ga0070693_100039317 3300005547 Bacteria 2649
16 Ga0070665_101279187 3300005548 Bacteria 744
17 Ga0070704_100095070 3300005549 Bacteria 2231
18 Ga0070664_100698650 3300005564 Bacteria 945
19 Ga0070702_100012464 3300005615 Bacteria 4261
20 Ga0068852_100075125 3300005616 Bacteria 2980
21 Ga0068852_100548850 3300005616 Bacteria 1156
22 Ga0068859_100061384 3300005617 Bacteria 3788
23 Ga0068866_10031487 3300005718 Bacteria 2556
24 Ga0068851_10181546 3300005834 Bacteria 1166
25 Ga0068858_100054255 3300005842 Bacteria 3707
26 Ga0068858_100194867 3300005842 Bacteria 1915
27 Ga0068860_100460793 3300005843 Bacteria 1265
28 Ga0081455_10191605 3300005937 Bacteria 1539
29 Ga0081538_10000632 3300005981 Bacteria 39001
30 Ga0081538_10095888 3300005981 Bacteria 1514
31 Ga0075428_100681310 3300006844 Bacteria 1096
32 Ga0068865_100419703 3300006881 Bacteria 1100
33 Ga0068865_100565241 3300006881 Bacteria 957
34 Ga0068865_100610727 3300006881 Bacteria 923
35 Ga0097620_100061384 3300006931 Bacteria 3788
36 Ga0105245_10095540 3300009098 Bacteria 2742
37 Ga0105245_10095633 3300009098 Bacteria 2741
38 Ga0105245_10336478 3300009098 Bacteria 1491
39 Ga0105245_10919695 3300009098 Bacteria 917
40 Ga0105247_10618569 3300009101 Bacteria 805
41 Ga0105243_10009212 3300009148 Bacteria 7537
42 Ga0105243_10580514 3300009148 Bacteria 1076
43 Ga0105243_10963951 3300009148 Bacteria 853
44 Ga0105242_10336004 3300009176 Bacteria 1391
45 Ga0105242_10934822 3300009176 Bacteria 870
46 Ga0105248_11190661 3300009177 Bacteria 861
47 Ga0105238_10358324 3300009551 Bacteria 1448
48 Ga0105238_10491916 3300009551 Bacteria 1227
49 Ga0105238_11088892 3300009551 Bacteria 821
50 Ga0105249_10354414 3300009553 Bacteria 1487
51 Ga0105249_11096137 3300009553 Bacteria 866
52 Ga0105239_10411432 3300010375 Bacteria 1531
53 Ga0105239_11025581 3300010375 Bacteria 949
54 Ga0105239_11035226 3300010375 Bacteria 944
55 Ga0105239_11367382 3300010375 Bacteria 817
56 Ga0105246_10426792 3300011119 Bacteria 1108
57 Ga0105246_10793469 3300011119 Bacteria 839
58 Ga0157369_11654147 3300013105 Bacteria 651
59 Ga0163162_10167127 3300013306 Bacteria 2324
60 Ga0163162_11281869 3300013306 Bacteria 832
61 Ga0157372_10394342 3300013307 Bacteria 1613
62 Ga0157372_10407648 3300013307 Bacteria 1584
63 Ga0157372_11450680 3300013307 Bacteria 791
64 Ga0157375_10210648 3300013308 Bacteria 2101
65 Ga0163163_10570860 3300014325 Bacteria 1194
66 Ga0163163_11416113 3300014325 Bacteria 757
67 Ga0163163_11857692 3300014325 Bacteria 662
68 Ga0157377_10164389 3300014745 Bacteria 1383
69 Ga0157377_10331268 3300014745 Bacteria 1015
70 Ga0163161_10412827 3300017792 Bacteria 1085
71 Ga0207656_10202770 3300025321 Bacteria 958
72 Ga0207688_10093715 3300025901 Bacteria 1727
73 Ga0207687_10070084 3300025927 Bacteria 2502
74 Ga0207690_10235204 3300025932 Bacteria 1409
75 Ga0207686_10174800 3300025934 Bacteria 1518
76 Ga0207711_10782750 3300025941 Bacteria 889
77 Ga0207689_10178339 3300025942 Bacteria 1752
78 Ga0207661_10155494 3300025944 Bacteria 1980
79 Ga0207661_10918953 3300025944 Bacteria 806
80 Ga0207679_10096006 3300025945 Bacteria 2305
81 Ga0207679_10388010 3300025945 Bacteria 1226
82 Ga0207679_10525710 3300025945 Bacteria 1059
83 Ga0207640_10318343 3300025981 Bacteria 1237
84 Ga0207640_10577452 3300025981 Bacteria 948
85 Ga0207703_10313486 3300026035 Bacteria 1434
86 Ga0207678_10543839 3300026067 Bacteria 1015
87 Ga0207708_10069006 3300026075 Bacteria 2706
88 Ga0207708_10136769 3300026075 Bacteria 1919
89 Ga0207708_10417623 3300026075 Bacteria 1112
90 Ga0207702_10524999 3300026078 Bacteria 1156
91 Ga0207676_10363518 3300026095 Bacteria 1342
92 Ga0207675_100192410 3300026118 Bacteria 1957
93 Ga0207683_10376532 3300026121 Bacteria 1304
94 Ga0207683_10405854 3300026121 Bacteria 1254
95 Ga0207683_10892649 3300026121 Bacteria 825
96 Ga0207698_10181256 3300026142 Bacteria 1866
97 Ga0207698_10828074 3300026142 Bacteria 929
98 Ga0209813_10202334 3300027866 Bacteria 735
99 Ga0307408_100408463 3300031548 Bacteria 1168
100 Ga0316576_10788479 3300031727 Unclassified 684
101 Ga0307405_10073341 3300031731 Bacteria 2210
102 Ga0307405_10251225 3300031731 Bacteria 1316
103 Ga0307405_10283302 3300031731 Bacteria 1249
104 Ga0307405_10285151 3300031731 Bacteria 1245
105 Ga0307410_10530602 3300031852 Bacteria 973
106 Ga0307407_10271701 3300031903 Bacteria 1170
107 Ga0307407_10650119 3300031903 Bacteria 790
108 Ga0307412_10146356 3300031911 Bacteria 1737
109 Ga0307409_100300818 3300031995 Bacteria 1492
110 Ga0307409_100307039 3300031995 Bacteria 1479
111 Ga0307416_100005042 3300032002 Bacteria 8048
112 Ga0307416_100271177 3300032002 Bacteria 1666
113 Ga0307415_100001297 3300032126 Bacteria 11801
114 Ga0307415_100311572 3300032126 Bacteria 1308
115 Ga0307415_100528277 3300032126 Bacteria 1037
116 Ga0307415_100801967 3300032126 Bacteria 859
117 Ga0373960_0265824 3300035121 Bacteria 628
118 Ga0373931_0280621 3300035691 Bacteria 1023
119 Ga0316584_0204944 3300036712 Bacteria 1454
120 Ga0436364_0808211 3300037853 Bacteria 1015
121 Ga0439465_0064691 3300041413 Bacteria 1217
122 Ga0451791_0104869 3300041451 Bacteria 1701
123 Ga0451793_0174444 3300041452 Bacteria 1070
124 Ga0451797_0404760 3300041453 Bacteria 763
125 Ga0451802_2019382 3300041460 Bacteria 1499
126 Ga0451807_1155185 3300041486 Bacteria 1154
127 Ga0451837_0063000 3300041494 Bacteria 1522
128 Ga0451839_0346565 3300041496 Bacteria 595
129 Ga0451853_1357593 3300041512 Bacteria 648
130 Ga0439440_0029312 3300042993 Bacteria 1290
131 Ga0466965_0024091 3300044683 Bacteria 2943
132 Ga0466965_0053203 3300044683 Bacteria 2012
133 Ga0466965_0258824 3300044683 Bacteria 935
134 Ga0466963_0045207 3300044694 Bacteria 2900
135 Ga0466963_0047718 3300044694 Bacteria 2827
136 Ga0466963_0272331 3300044694 Bacteria 1189
137 Ga0466963_0484547 3300044694 Bacteria 873
138 Ga0466971_0039345 3300044719 Bacteria 2122
139 Ga0466957_0064304 3300044842 Bacteria 2257
140 Ga0466957_0259301 3300044842 Bacteria 1158
141 Ga0466960_0099876 3300044901 Bacteria 1493
142 Ga0466960_0122202 3300044901 Bacteria 1365
143 Ga0466960_0403539 3300044901 Bacteria 788
144 Ga0466960_0760896 3300044901 Bacteria 584
145 Ga0466958_0221338 3300045836 Bacteria 1207
146 Ga0466967_0001365 3300045976 Bacteria 14053
147 Ga0466967_0020165 3300045976 Bacteria 5379
148 Ga0466967_0112341 3300045976 Bacteria 2505
149 Ga0466967_0203628 3300045976 Bacteria 1875
150 Ga0466967_0249409 3300045976 Bacteria 1695
151 Ga0466967_0328107 3300045976 Bacteria 1477
152 Ga0466967_0406598 3300045976 Bacteria 1325
153 Ga0466967_0514397 3300045976 Bacteria 1176
154 Ga0466967_0787919 3300045976 Bacteria 943
155 Ga0466967_1248081 3300045976 Bacteria 740
156 Ga0495596_0235932 3300046500 Bacteria 710
157 Ga0495644_0070133 3300046523 Bacteria 1317
158 Ga0495656_0268251 3300046615 Bacteria 867
159 Ga0496100_0458777 3300048903 Bacteria 978
160 Ga0496106_0025247 3300048909 Bacteria 4421
161 Ga0496108_0152237 3300048911 Bacteria 1996
162 Ga0496108_1241384 3300048911 Bacteria 629
163 Ga0496109_0127994 3300048912 Bacteria 2369
164 Ga0496109_0611457 3300048912 Bacteria 1026
165 Ga0496109_0643933 3300048912 Bacteria 997
166 Ga0496110_0585739 3300048913 Bacteria 1013
167 Ga0496110_0788032 3300048913 Bacteria 855
168 Ga0496111_0236346 3300048914 Bacteria 1357
169 Ga0496112_0415004 3300048915 Bacteria 1285
170 Ga0496114_0439985 3300048917 Bacteria 1155
171 Ga0496114_0967514 3300048917 Bacteria 734
172 Ga0501031_0175446 3300049568 Bacteria 1400
173 Ga0501031_0280701 3300049568 Bacteria 1080
174 Ga0501033_0419627 3300049570 Bacteria 932
175 Ga0501034_0410738 3300049571 Bacteria 1276
176 Ga0501036_0521482 3300049572 Bacteria 988
177 Ga0501036_0809176 3300049572 Bacteria 771
178 Ga0501038_0064340 3300049574 Bacteria 3128
179 Ga0501039_0064900 3300049575 Bacteria 2831
180 Ga0501039_0129233 3300049575 Bacteria 1982
181 Ga0501040_0037203 3300049576 Bacteria 3306
182 Ga0501040_0063458 3300049576 Bacteria 2542
183 Ga0501041_0067395 3300049577 Bacteria 2194
184 Ga0501042_0027531 3300049578 Bacteria 3998
185 Ga0501042_0308023 3300049578 Bacteria 1144
186 Ga0501042_0338142 3300049578 Bacteria 1088
187 Ga0501046_0409055 3300049580 Bacteria 979
188 Ga0501047_0517346 3300049581 Bacteria 1019
189 Ga0501048_0103934 3300049582 Bacteria 2005
190 Ga0501067_0351861 3300049583 Bacteria 821
191 Ga0501069_0075381 3300049585 Bacteria 1895
192 Ga0501071_0134899 3300049587 Bacteria 1836
193 Ga0501071_0218683 3300049587 Bacteria 1433
194 Ga0501072_0012613 3300049588 Bacteria 6461
195 Ga0501072_0049980 3300049588 Bacteria 3292
196 Ga0501074_0192474 3300049590 Bacteria 1454
197 Ga0501074_0313116 3300049590 Bacteria 1115
198 Ga0501075_0333242 3300049591 Bacteria 1156
199 Ga0501076_0134360 3300049592 Bacteria 2008
200 Ga0501077_0096157 3300049593 Bacteria 1877
201 Ga0501077_0316431 3300049593 Bacteria 995
202 Ga0501250_031780 3300049680 Bacteria 737
203 Ga0501081_0096264 3300049743 Bacteria 2088
204 Ga0501081_0344938 3300049743 Bacteria 1097
205 Ga0501083_0591354 3300049744 Bacteria 722
206 Ga0501035_0096735 3300049822 Bacteria 2594
207 Ga0501044_0356742 3300049823 Bacteria 1381
208 Ga0501045_0040519 3300049824 Bacteria 3389
209 Ga0501045_0092755 3300049824 Bacteria 2233
210 nmdc:mga00v17_291010_c1 3300050491 Bacteria 1060
211 nmdc:mga06z11_470776_c1 3300050494 Bacteria 760
212 nmdc:mga09592_175571_c1 3300050508 Bacteria 1853
213 nmdc:mga0qj67_657117_c1 3300050509 Bacteria 836
214 nmdc:mga08y16_249425_c1 3300050511 Bacteria 1834
215 Ga0500616_0077334 3300053153 Bacteria 1681
216 Ga0501084_0061423 3300054114 Bacteria 3146
217 Ga0501084_0085423 3300054114 Bacteria 2649
218 Ga0501082_0594407 3300060353 Bacteria 968
219 Ga0501082_1105338 3300060353 Bacteria 693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0760896 Ga0466960_0760896_13_510 163
2 3300048911 Ga0496108_1241384 Ga0496108_1241384_116_616 163
3 3300048913 Ga0496110_0585739 Ga0496110_0585739_10_513 164
4 3300050491 nmdc:mga00v17_291010_c1 nmdc:mga00v17_291010_c1_216_716 164
5 3300053153 Ga0500616_0077334 Ga0500616_0077334_216_731 168
6 3300045976 Ga0466967_0328107 Ga0466967_0328107_305_832 172
7 3300031727 Ga0316576_10788479 Ga0316576_107884791 173
8 3300036712 Ga0316584_0204944 Ga0316584_0204944_10_546 173
9 3300049568 Ga0501031_0175446 Ga0501031_0175446_710_1237 173
10 3300049570 Ga0501033_0419627 Ga0501033_0419627_207_734 173
11 3300049572 Ga0501036_0809176 Ga0501036_0809176_195_722 173
12 3300049575 Ga0501039_0064900 Ga0501039_0064900_849_1376 173
13 3300049576 Ga0501040_0063458 Ga0501040_0063458_1958_2485 173
14 3300049578 Ga0501042_0027531 Ga0501042_0027531_1198_1725 173
15 3300049585 Ga0501069_0075381 Ga0501069_0075381_732_1259 173
16 3300049587 Ga0501071_0218683 Ga0501071_0218683_210_737 173
17 3300049588 Ga0501072_0049980 Ga0501072_0049980_1731_2258 173
18 3300049590 Ga0501074_0192474 Ga0501074_0192474_419_946 173
19 3300049591 Ga0501075_0333242 Ga0501075_0333242_425_952 173
20 3300049593 Ga0501077_0096157 Ga0501077_0096157_545_1072 173
21 3300049824 Ga0501045_0092755 Ga0501045_0092755_586_1113 173
22 3300054114 Ga0501084_0061423 Ga0501084_0061423_1366_1893 173
23 3300060353 Ga0501082_0594407 Ga0501082_0594407_420_947 173
24 3300005981 Ga0081538_10095888 Ga0081538_100958882 174
25 3300009098 Ga0105245_10919695 Ga0105245_109196951 174
26 3300041496 Ga0451839_0346565 Ga0451839_0346565_25_561 174
27 3300045976 Ga0466967_0203628 Ga0466967_0203628_310_843 174
28 3300049577 Ga0501041_0067395 Ga0501041_0067395_1334_1867 175
29 3300049578 Ga0501042_0308023 Ga0501042_0308023_277_810 175
30 3300049743 Ga0501081_0344938 Ga0501081_0344938_64_597 175
31 3300049744 Ga0501083_0591354 Ga0501083_0591354_28_561 175
32 3300050509 nmdc:mga0qj67_657117_c1 nmdc:mga0qj67_657117_c1_274_807 175
33 3300046615 Ga0495656_0268251 Ga0495656_0268251_38_574 176
34 3300005981 Ga0081538_10000632 Ga0081538_1000063220 177
35 3300005329 Ga0070683_100230042 Ga0070683_1002300422 179
36 3300005547 Ga0070693_100039317 Ga0070693_1000393171 179
37 3300005937 Ga0081455_10191605 Ga0081455_101916052 179
38 3300009551 Ga0105238_10491916 Ga0105238_104919162 179
39 3300013105 Ga0157369_11654147 Ga0157369_116541471 179
40 3300013307 Ga0157372_11450680 Ga0157372_114506801 179
41 3300014325 Ga0163163_11416113 Ga0163163_114161132 179
42 3300025932 Ga0207690_10235204 Ga0207690_102352042 179
43 3300025944 Ga0207661_10918953 Ga0207661_109189532 179
44 3300026078 Ga0207702_10524999 Ga0207702_105249992 179
45 3300026121 Ga0207683_10892649 Ga0207683_108926491 179
46 3300044683 Ga0466965_0053203 Ga0466965_0053203_481_1029 179
47 3300044694 Ga0466963_0045207 Ga0466963_0045207_248_796 179
48 3300044694 Ga0466963_0047718 Ga0466963_0047718_2140_2688 179
49 3300044694 Ga0466963_0272331 Ga0466963_0272331_129_677 179
50 3300044842 Ga0466957_0064304 Ga0466957_0064304_1559_2107 179
51 3300045976 Ga0466967_0001365 Ga0466967_0001365_10485_11033 179
52 3300045976 Ga0466967_0020165 Ga0466967_0020165_3835_4383 179
53 3300045976 Ga0466967_0787919 Ga0466967_0787919_329_877 179
54 3300048913 Ga0496110_0788032 Ga0496110_0788032_189_737 179
55 3300048915 Ga0496112_0415004 Ga0496112_0415004_349_897 179
56 3300045976 Ga0466967_0249409 Ga0466967_0249409_390_938 180
57 3300050508 nmdc:mga09592_175571_c1 nmdc:mga09592_175571_c1_111_659 180
58 3300005329 Ga0070683_100017443 Ga0070683_1000174436 181
59 3300005334 Ga0068869_100284113 Ga0068869_1002841132 181
60 3300005334 Ga0068869_100680393 Ga0068869_1006803931 181
61 3300005338 Ga0068868_100039129 Ga0068868_1000391293 181
62 3300005343 Ga0070687_100508998 Ga0070687_1005089981 181
63 3300005344 Ga0070661_100265503 Ga0070661_1002655032 181
64 3300005355 Ga0070671_100159767 Ga0070671_1001597672 181
65 3300005438 Ga0070701_10213507 Ga0070701_102135072 181
66 3300005438 Ga0070701_10226120 Ga0070701_102261202 181
67 3300005441 Ga0070700_100363458 Ga0070700_1003634581 181
68 3300005543 Ga0070672_100384437 Ga0070672_1003844372 181
69 3300005543 Ga0070672_101034008 Ga0070672_1010340081 181
70 3300005545 Ga0070695_100376664 Ga0070695_1003766642 181
71 3300005548 Ga0070665_101279187 Ga0070665_1012791872 181
72 3300005549 Ga0070704_100095070 Ga0070704_1000950702 181
73 3300005564 Ga0070664_100698650 Ga0070664_1006986502 181
74 3300005615 Ga0070702_100012464 Ga0070702_1000124643 181
75 3300005616 Ga0068852_100075125 Ga0068852_1000751252 181
76 3300005616 Ga0068852_100548850 Ga0068852_1005488502 181
77 3300005617 Ga0068859_100061384 Ga0068859_1000613844 181
78 3300005718 Ga0068866_10031487 Ga0068866_100314873 181
79 3300005834 Ga0068851_10181546 Ga0068851_101815461 181
80 3300005842 Ga0068858_100054255 Ga0068858_1000542553 181
81 3300005842 Ga0068858_100194867 Ga0068858_1001948672 181
82 3300005843 Ga0068860_100460793 Ga0068860_1004607931 181
83 3300006844 Ga0075428_100681310 Ga0075428_1006813102 181
84 3300006881 Ga0068865_100419703 Ga0068865_1004197032 181
85 3300006881 Ga0068865_100565241 Ga0068865_1005652412 181
86 3300006881 Ga0068865_100610727 Ga0068865_1006107272 181
87 3300006931 Ga0097620_100061384 Ga0097620_1000613844 181
88 3300009098 Ga0105245_10095540 Ga0105245_100955404 181
89 3300009098 Ga0105245_10095633 Ga0105245_100956332 181
90 3300009098 Ga0105245_10336478 Ga0105245_103364782 181
91 3300009101 Ga0105247_10618569 Ga0105247_106185691 181
92 3300009148 Ga0105243_10009212 Ga0105243_100092123 181
93 3300009148 Ga0105243_10580514 Ga0105243_105805142 181
94 3300009148 Ga0105243_10963951 Ga0105243_109639512 181
95 3300009176 Ga0105242_10336004 Ga0105242_103360042 181
96 3300009176 Ga0105242_10934822 Ga0105242_109348222 181
97 3300009177 Ga0105248_11190661 Ga0105248_111906612 181
98 3300009551 Ga0105238_10358324 Ga0105238_103583242 181
99 3300009551 Ga0105238_11088892 Ga0105238_110888921 181
100 3300009553 Ga0105249_10354414 Ga0105249_103544142 181
101 3300009553 Ga0105249_11096137 Ga0105249_110961372 181
102 3300010375 Ga0105239_10411432 Ga0105239_104114322 181
103 3300010375 Ga0105239_11025581 Ga0105239_110255812 181
104 3300010375 Ga0105239_11035226 Ga0105239_110352262 181
105 3300010375 Ga0105239_11367382 Ga0105239_113673821 181
106 3300011119 Ga0105246_10426792 Ga0105246_104267922 181
107 3300011119 Ga0105246_10793469 Ga0105246_107934691 181
108 3300013306 Ga0163162_10167127 Ga0163162_101671272 181
109 3300013306 Ga0163162_11281869 Ga0163162_112818691 181
110 3300013307 Ga0157372_10394342 Ga0157372_103943422 181
111 3300013307 Ga0157372_10407648 Ga0157372_104076482 181
112 3300013308 Ga0157375_10210648 Ga0157375_102106482 181
113 3300014325 Ga0163163_10570860 Ga0163163_105708602 181
114 3300014325 Ga0163163_11857692 Ga0163163_118576921 181
115 3300014745 Ga0157377_10164389 Ga0157377_101643891 181
116 3300014745 Ga0157377_10331268 Ga0157377_103312682 181
117 3300017792 Ga0163161_10412827 Ga0163161_104128272 181
118 3300025321 Ga0207656_10202770 Ga0207656_102027701 181
119 3300025901 Ga0207688_10093715 Ga0207688_100937152 181
120 3300025927 Ga0207687_10070084 Ga0207687_100700842 181
121 3300025934 Ga0207686_10174800 Ga0207686_101748002 181
122 3300025941 Ga0207711_10782750 Ga0207711_107827502 181
123 3300025942 Ga0207689_10178339 Ga0207689_101783392 181
124 3300025944 Ga0207661_10155494 Ga0207661_101554942 181
125 3300025945 Ga0207679_10096006 Ga0207679_100960062 181
126 3300025945 Ga0207679_10388010 Ga0207679_103880102 181
127 3300025945 Ga0207679_10525710 Ga0207679_105257102 181
128 3300025981 Ga0207640_10318343 Ga0207640_103183432 181
129 3300025981 Ga0207640_10577452 Ga0207640_105774522 181
130 3300026035 Ga0207703_10313486 Ga0207703_103134862 181
131 3300026067 Ga0207678_10543839 Ga0207678_105438392 181
132 3300026075 Ga0207708_10069006 Ga0207708_100690063 181
133 3300026075 Ga0207708_10136769 Ga0207708_101367693 181
134 3300026075 Ga0207708_10417623 Ga0207708_104176232 181
135 3300026095 Ga0207676_10363518 Ga0207676_103635182 181
136 3300026118 Ga0207675_100192410 Ga0207675_1001924102 181
137 3300026121 Ga0207683_10376532 Ga0207683_103765322 181
138 3300026121 Ga0207683_10405854 Ga0207683_104058542 181
139 3300026142 Ga0207698_10181256 Ga0207698_101812562 181
140 3300026142 Ga0207698_10828074 Ga0207698_108280742 181
141 3300027866 Ga0209813_10202334 Ga0209813_102023342 181
142 3300031548 Ga0307408_100408463 Ga0307408_1004084631 181
143 3300031731 Ga0307405_10073341 Ga0307405_100733412 181
144 3300031731 Ga0307405_10251225 Ga0307405_102512252 181
145 3300031731 Ga0307405_10283302 Ga0307405_102833022 181
146 3300031731 Ga0307405_10285151 Ga0307405_102851512 181
147 3300031852 Ga0307410_10530602 Ga0307410_105306022 181
148 3300031903 Ga0307407_10271701 Ga0307407_102717012 181
149 3300031903 Ga0307407_10650119 Ga0307407_106501192 181
150 3300031911 Ga0307412_10146356 Ga0307412_101463562 181
151 3300031995 Ga0307409_100300818 Ga0307409_1003008182 181
152 3300031995 Ga0307409_100307039 Ga0307409_1003070392 181
153 3300032002 Ga0307416_100005042 Ga0307416_10000504210 181
154 3300032002 Ga0307416_100271177 Ga0307416_1002711772 181
155 3300032126 Ga0307415_100001297 Ga0307415_10000129712 181
156 3300032126 Ga0307415_100311572 Ga0307415_1003115722 181
157 3300032126 Ga0307415_100528277 Ga0307415_1005282772 181
158 3300032126 Ga0307415_100801967 Ga0307415_1008019672 181
159 3300035121 Ga0373960_0265824 Ga0373960_0265824_25_576 181
160 3300035691 Ga0373931_0280621 Ga0373931_0280621_246_866 181
161 3300037853 Ga0436364_0808211 Ga0436364_0808211_439_1005 181
162 3300041413 Ga0439465_0064691 Ga0439465_0064691_394_948 181
163 3300041451 Ga0451791_0104869 Ga0451791_0104869_556_1110 181
164 3300041452 Ga0451793_0174444 Ga0451793_0174444_90_644 181
165 3300041453 Ga0451797_0404760 Ga0451797_0404760_62_619 181
166 3300041460 Ga0451802_2019382 Ga0451802_2019382_68_622 181
167 3300041486 Ga0451807_1155185 Ga0451807_1155185_161_715 181
168 3300041494 Ga0451837_0063000 Ga0451837_0063000_748_1302 181
169 3300041512 Ga0451853_1357593 Ga0451853_1357593_44_601 181
170 3300042993 Ga0439440_0029312 Ga0439440_0029312_106_660 181
171 3300044683 Ga0466965_0024091 Ga0466965_0024091_1807_2364 181
172 3300044683 Ga0466965_0258824 Ga0466965_0258824_20_571 181
173 3300044694 Ga0466963_0484547 Ga0466963_0484547_190_744 181
174 3300044719 Ga0466971_0039345 Ga0466971_0039345_1216_1770 181
175 3300044842 Ga0466957_0259301 Ga0466957_0259301_88_642 181
176 3300044901 Ga0466960_0099876 Ga0466960_0099876_418_972 181
177 3300044901 Ga0466960_0122202 Ga0466960_0122202_660_1211 181
178 3300044901 Ga0466960_0403539 Ga0466960_0403539_48_599 181
179 3300045836 Ga0466958_0221338 Ga0466958_0221338_360_914 181
180 3300045976 Ga0466967_0112341 Ga0466967_0112341_680_1237 181
181 3300045976 Ga0466967_0406598 Ga0466967_0406598_733_1290 181
182 3300045976 Ga0466967_0514397 Ga0466967_0514397_259_810 181
183 3300045976 Ga0466967_1248081 Ga0466967_1248081_62_619 181
184 3300046500 Ga0495596_0235932 Ga0495596_0235932_51_611 181
185 3300046523 Ga0495644_0070133 Ga0495644_0070133_236_796 181
186 3300048903 Ga0496100_0458777 Ga0496100_0458777_44_661 181
187 3300048909 Ga0496106_0025247 Ga0496106_0025247_1781_2398 181
188 3300048911 Ga0496108_0152237 Ga0496108_0152237_1020_1637 181
189 3300048912 Ga0496109_0127994 Ga0496109_0127994_75_629 181
190 3300048912 Ga0496109_0611457 Ga0496109_0611457_121_738 181
191 3300048912 Ga0496109_0643933 Ga0496109_0643933_277_834 181
192 3300048914 Ga0496111_0236346 Ga0496111_0236346_546_1109 181
193 3300048917 Ga0496114_0439985 Ga0496114_0439985_517_1077 181
194 3300048917 Ga0496114_0967514 Ga0496114_0967514_115_669 181
195 3300049568 Ga0501031_0280701 Ga0501031_0280701_364_918 181
196 3300049571 Ga0501034_0410738 Ga0501034_0410738_580_1134 181
197 3300049572 Ga0501036_0521482 Ga0501036_0521482_149_703 181
198 3300049574 Ga0501038_0064340 Ga0501038_0064340_755_1309 181
199 3300049575 Ga0501039_0129233 Ga0501039_0129233_678_1232 181
200 3300049576 Ga0501040_0037203 Ga0501040_0037203_208_762 181
201 3300049578 Ga0501042_0338142 Ga0501042_0338142_60_614 181
202 3300049580 Ga0501046_0409055 Ga0501046_0409055_198_752 181
203 3300049581 Ga0501047_0517346 Ga0501047_0517346_269_832 181
204 3300049582 Ga0501048_0103934 Ga0501048_0103934_890_1444 181
205 3300049583 Ga0501067_0351861 Ga0501067_0351861_241_804 181
206 3300049587 Ga0501071_0134899 Ga0501071_0134899_858_1412 181
207 3300049588 Ga0501072_0012613 Ga0501072_0012613_1130_1684 181
208 3300049590 Ga0501074_0313116 Ga0501074_0313116_162_716 181
209 3300049592 Ga0501076_0134360 Ga0501076_0134360_1279_1833 181
210 3300049593 Ga0501077_0316431 Ga0501077_0316431_430_984 181
211 3300049680 Ga0501250_031780 Ga0501250_031780_96_653 181
212 3300049743 Ga0501081_0096264 Ga0501081_0096264_713_1267 181
213 3300049822 Ga0501035_0096735 Ga0501035_0096735_30_584 181
214 3300049823 Ga0501044_0356742 Ga0501044_0356742_419_973 181
215 3300049824 Ga0501045_0040519 Ga0501045_0040519_1882_2436 181
216 3300050494 nmdc:mga06z11_470776_c1 nmdc:mga06z11_470776_c1_10_564 181
217 3300050511 nmdc:mga08y16_249425_c1 nmdc:mga08y16_249425_c1_210_761 181
218 3300054114 Ga0501084_0085423 Ga0501084_0085423_965_1519 181
219 3300060353 Ga0501082_1105338 Ga0501082_1105338_34_600 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

24

194

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9706 2 171
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.959 2 181
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9568 2 170
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9514 2 177
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9488 2 181
ID Description Score Start End Superfamily
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9616 11 172 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9552 2 172 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9478 1 181 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9472 1 180 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9428 1 181 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6J4RKW7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9879 2 181 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A7W0LY38-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase family protein 0.9877 56 181 GO:0000271
GO:0005829
GO:0008830
AF-A0A1Q3NKM8-F1-model_v4 deleted 0.9862 2 179
AF-A0A538ES95-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9857 1 180 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1E4HBY4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9821 1 152 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
96.12 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map