F330491

General Info

Members Datasets Scaffolds Average Seq Length
218 149 436 269

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_040875|Ga0500555_040875_383_1279
Length 298
Sequence MTASQPQFLDVGSDGGSGAERRRIAYLQQPAAHADRPGLVWLCGLKSEMTSTKASAVAEWAQSQGLAFLRFDYSGHGQSEGRFEDGTIGRWLEEAEATFRALTQGPQILIGSSLGGYIALLLLQRLMGGRGPGVGRRASGEADHETPDARNPTAEVAAARIKAFVLIAPAWDMTELMWQRLPPSARQDIEEKGLFLRPSRYGDGPYPITRALIEDGRRHLIGSAPFDPGRPVHIIHGQQDPDVPWQHTLDLVAHLSGDWARVSAVPDGEHRLSRPQDIALLLGIVAGLAKGEAARPGG

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
81 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
82 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
85 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
149 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.8
Nodule 0
Rhizoplane 9.63
Rhizosphere 80.28
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_040875 3300053103 Bacteria 1291
2 Ga0070683_100554353 3300005329 Bacteria 1099
3 Ga0070690_100048861 3300005330 Bacteria 2696
4 Ga0070670_100125006 3300005331 Bacteria 2220
5 Ga0070670_100771784 3300005331 Bacteria 867
6 Ga0070691_10008637 3300005341 Bacteria 4664
7 Ga0070691_10034720 3300005341 Bacteria 2374
8 Ga0070692_10039512 3300005345 Bacteria 2410
9 Ga0070671_100245755 3300005355 Bacteria 1519
10 Ga0070673_100282522 3300005364 Bacteria 1456
11 Ga0070667_100415757 3300005367 Bacteria 1225
12 Ga0070703_10001729 3300005406 Bacteria 6477
13 Ga0070714_100344286 3300005435 Bacteria 1399
14 Ga0070713_100064202 3300005436 Bacteria 3081
15 Ga0070701_10004120 3300005438 Bacteria 5838
16 Ga0070694_100001861 3300005444 Bacteria 12504
17 Ga0070694_100053639 3300005444 Bacteria 2729
18 Ga0070708_100022031 3300005445 Bacteria 5401
19 Ga0070663_100007025 3300005455 Bacteria 6821
20 Ga0070681_10133216 3300005458 Bacteria 2417
21 Ga0070699_100001809 3300005518 Bacteria 19434
22 Ga0070679_100200536 3300005530 Bacteria 1962
23 Ga0070697_100238976 3300005536 Bacteria 1551
24 Ga0070695_100002921 3300005545 Bacteria 9944
25 Ga0070695_100041769 3300005545 Bacteria 2908
26 Ga0070696_100000856 3300005546 Bacteria 19655
27 Ga0070693_100112254 3300005547 Bacteria 1679
28 Ga0068857_100042077 3300005577 Bacteria 4052
29 Ga0070702_100018820 3300005615 Bacteria 3590
30 Ga0068859_100010838 3300005617 Bacteria 9173
31 Ga0068861_100023113 3300005719 Bacteria 4482
32 Ga0068870_10069535 3300005840 Bacteria 1916
33 Ga0068863_100610274 3300005841 Bacteria 1080
34 Ga0068858_100029478 3300005842 Bacteria 5096
35 Ga0068860_100010661 3300005843 Bacteria 9077
36 Ga0068860_100350271 3300005843 Unclassified 1453
37 Ga0068862_100001949 3300005844 Bacteria 18707
38 Ga0081455_10000029 3300005937 Bacteria 155672
39 Ga0081540_1000048 3300005983 Bacteria 127924
40 Ga0081539_10024720 3300005985 Bacteria 3888
41 Ga0075365_10051840 3300006038 Bacteria 2712
42 Ga0075368_10036903 3300006042 Unclassified 1910
43 Ga0075368_10110438 3300006042 Bacteria 1133
44 Ga0075363_100030275 3300006048 Bacteria 2801
45 Ga0075364_10008502 3300006051 Bacteria 6139
46 Ga0075367_10041057 3300006178 Bacteria 2703
47 Ga0075367_10051969 3300006178 Bacteria 2424
48 Ga0075367_10054581 3300006178 Unclassified 2369
49 Ga0075428_100095445 3300006844 Bacteria 3242
50 Ga0075430_100119908 3300006846 Bacteria 2193
51 Ga0075431_100019995 3300006847 Bacteria 6836
52 Ga0075431_100150051 3300006847 Bacteria 2400
53 Ga0075433_10005933 3300006852 Bacteria 9619
54 Ga0075434_100003078 3300006871 Bacteria 14838
55 Ga0075434_100006345 3300006871 Bacteria 10841
56 Ga0075429_100097632 3300006880 Bacteria 2563
57 Ga0075429_100105067 3300006880 Bacteria 2467
58 Ga0075429_100265924 3300006880 Bacteria 1502
59 Ga0068865_100139101 3300006881 Bacteria 1829
60 Ga0097620_100010838 3300006931 Bacteria 9173
61 Ga0075435_100016462 3300007076 Bacteria 5576
62 Ga0075435_100196093 3300007076 Bacteria 1710
63 Ga0114129_10231558 3300009147 Bacteria 2488
64 Ga0105241_10244270 3300009174 Unclassified 1519
65 Ga0105248_10663852 3300009177 Bacteria 1176
66 Ga0105249_10210168 3300009553 Bacteria 1909
67 Ga0105249_10251787 3300009553 Bacteria 1751
68 Ga0105239_10573484 3300010375 Bacteria 1286
69 Ga0105239_10657311 3300010375 Bacteria 1197
70 Ga0105246_10066644 3300011119 Bacteria 2521
71 Ga0163163_10246162 3300014325 Bacteria 1838
72 Ga0157380_10030228 3300014326 Unclassified 4147
73 Ga0157380_10318960 3300014326 Bacteria 1440
74 Ga0157379_10006995 3300014968 Bacteria 9752
75 Ga0157379_10043479 3300014968 Bacteria 4011
76 Ga0157376_10660899 3300014969 Bacteria 1046
77 Ga0213876_10119359 3300021384 Bacteria 1400
78 Ga0213875_10195157 3300021388 Bacteria 952
79 Ga0207707_10035662 3300025912 Bacteria 4349
80 Ga0207652_10168996 3300025921 Bacteria 1962
81 Ga0207700_10083965 3300025928 Bacteria 2495
82 Ga0207644_10246699 3300025931 Bacteria 1423
83 Ga0207661_10128756 3300025944 Bacteria 2165
84 Ga0207712_10003965 3300025961 Bacteria 9349
85 Ga0207668_10516936 3300025972 Bacteria 1029
86 Ga0207658_10247683 3300025986 Unclassified 1513
87 Ga0207703_10013856 3300026035 Bacteria 6284
88 Ga0207703_10799400 3300026035 Bacteria 900
89 Ga0207678_10001884 3300026067 Bacteria 19130
90 Ga0207641_10563334 3300026088 Bacteria 1112
91 Ga0207674_10011740 3300026116 Bacteria 9828
92 Ga0207675_100015341 3300026118 Bacteria 7148
93 Ga0207675_100025749 3300026118 Bacteria 5474
94 Ga0207675_100398949 3300026118 Bacteria 1355
95 Ga0209813_10009521 3300027866 Unclassified 2488
96 Ga0209813_10012575 3300027866 Bacteria 2241
97 Ga0207428_10045012 3300027907 Bacteria 3558
98 Ga0268265_10017411 3300028380 Bacteria 4957
99 Ga0268264_10002039 3300028381 Bacteria 18053
100 Ga0268264_10105591 3300028381 Bacteria 2457
101 Ga0307510_10223130 3300033180 Bacteria 1394
102 Ga0373929_0041931 3300035085 Bacteria 1019
103 Ga0373949_0011786 3300035090 Bacteria 1929
104 Ga0373951_0024058 3300035091 Bacteria 1409
105 Ga0373932_0017738 3300035112 Bacteria 1831
106 Ga0373960_0010404 3300035121 Bacteria 2271
107 Ga0373962_0010883 3300035242 Bacteria 2274
108 Ga0316574_0371043 3300035398 Unclassified 904
109 Ga0373931_0028173 3300035691 Bacteria 2873
110 Ga0373935_0529087 3300035692 Bacteria 858
111 Ga0436364_1521531 3300037853 Bacteria 965
112 Ga0436365_0923259 3300039437 Bacteria 1902
113 Ga0466960_0040872 3300044901 Bacteria 2195
114 Ga0451576_0031341 3300045051 Bacteria 5670
115 Ga0451576_0152489 3300045051 Bacteria 2410
116 Ga0495603_0382720 3300046455 Bacteria 807
117 Ga0496102_0031310 3300048905 Bacteria 4771
118 Ga0496103_0011431 3300048906 Bacteria 5262
119 Ga0496104_0000521 3300048907 Bacteria 32903
120 Ga0496104_0006243 3300048907 Bacteria 10470
121 Ga0496105_0004218 3300048908 Bacteria 10799
122 Ga0496105_0079875 3300048908 Bacteria 2701
123 Ga0496106_0003134 3300048909 Bacteria 12340
124 Ga0496107_0117509 3300048910 Bacteria 1958
125 Ga0496107_0388187 3300048910 Bacteria 1038
126 Ga0496108_0144278 3300048911 Bacteria 2051
127 Ga0496108_0592893 3300048911 Bacteria 966
128 Ga0496109_0003581 3300048912 Bacteria 12965
129 Ga0496109_0239629 3300048912 Bacteria 1707
130 Ga0496109_0826047 3300048912 Bacteria 865
131 Ga0496110_0000727 3300048913 Bacteria 22766
132 Ga0496111_0002340 3300048914 Bacteria 11422
133 Ga0496112_0217440 3300048915 Bacteria 1867
134 Ga0496113_0097305 3300048916 Bacteria 2277
135 Ga0496113_0264344 3300048916 Bacteria 1375
136 Ga0496115_0009396 3300048918 Bacteria 7266
137 Ga0496115_0077639 3300048918 Bacteria 2701
138 Ga0501033_0032049 3300049570 Bacteria 3946
139 Ga0501034_0009998 3300049571 Bacteria 9911
140 Ga0501034_0222435 3300049571 Bacteria 1840
141 Ga0501034_0439337 3300049571 Bacteria 1224
142 Ga0501034_0667581 3300049571 Bacteria 940
143 Ga0501036_0186790 3300049572 Bacteria 1744
144 Ga0501039_0120869 3300049575 Bacteria 2052
145 Ga0501040_0083589 3300049576 Bacteria 2214
146 Ga0501041_0505971 3300049577 Unclassified 769
147 Ga0501042_0300828 3300049578 Bacteria 1159
148 Ga0501043_0168411 3300049579 Bacteria 1710
149 Ga0501043_0327924 3300049579 Bacteria 1166
150 Ga0501046_0000058 3300049580 Bacteria 127462
151 Ga0501046_0254071 3300049580 Bacteria 1293
152 Ga0501047_0115485 3300049581 Bacteria 2566
153 Ga0501047_0131354 3300049581 Bacteria 2385
154 Ga0501067_0149331 3300049583 Bacteria 1302
155 Ga0501068_0099209 3300049584 Bacteria 1804
156 Ga0501069_0251881 3300049585 Bacteria 1030
157 Ga0501070_0138409 3300049586 Bacteria 2010
158 Ga0501071_0143528 3300049587 Bacteria 1779
159 Ga0501072_0324343 3300049588 Bacteria 1224
160 Ga0501074_0017606 3300049590 Bacteria 5189
161 Ga0501074_0161770 3300049590 Bacteria 1599
162 Ga0501075_0040373 3300049591 Bacteria 3495
163 Ga0501075_0155335 3300049591 Bacteria 1744
164 Ga0501076_0068914 3300049592 Bacteria 2826
165 Ga0501076_0344019 3300049592 Bacteria 1224
166 Ga0501076_0435570 3300049592 Bacteria 1079
167 Ga0501077_0021560 3300049593 Bacteria 4078
168 Ga0501077_0025412 3300049593 Bacteria 3762
169 Ga0501079_0009878 3300049741 Bacteria 7240
170 Ga0501079_0053169 3300049741 Bacteria 3125
171 Ga0501079_0375030 3300049741 Bacteria 1115
172 Ga0501080_0025260 3300049742 Bacteria 5513
173 Ga0501080_0030982 3300049742 Bacteria 4984
174 Ga0501080_0195845 3300049742 Bacteria 1856
175 Ga0501081_0033970 3300049743 Bacteria 3468
176 Ga0501081_0143519 3300049743 Bacteria 1712
177 Ga0501083_0042878 3300049744 Bacteria 3067
178 Ga0501083_0044339 3300049744 Unclassified 3011
179 Ga0501044_0047827 3300049823 Bacteria 4423
180 Ga0501044_0075119 3300049823 Bacteria 3432
181 Ga0501044_0138681 3300049823 Bacteria 2421
182 Ga0501044_0301246 3300049823 Bacteria 1532
183 Ga0501045_0063985 3300049824 Bacteria 2700
184 Ga0501045_0643479 3300049824 Bacteria 784
185 nmdc:mga03n38_5288_c1 3300050490 Bacteria 4379
186 nmdc:mga06z11_140081_c1 3300050494 Bacteria 1367
187 nmdc:mga04h51_26954_c1 3300050495 Unclassified 1781
188 nmdc:mga04h51_47922_c1 3300050495 Bacteria 1058
189 nmdc:mga04h51_5980_c1 3300050495 Bacteria 3128
190 nmdc:mga05p37_325960_c1 3300050507 Bacteria 1816
191 nmdc:mga09592_127698_c1 3300050508 Bacteria 2186
192 nmdc:mga09592_39097_c1 3300050508 Bacteria 3984
193 nmdc:mga0qj67_186118_c1 3300050509 Bacteria 1687
194 nmdc:mga0qj67_20106_c1 3300050509 Bacteria 5110
195 nmdc:mga06r32_7911_c1 3300050510 Bacteria 9557
196 nmdc:mga06r32_8364_c1 3300050510 Bacteria 9317
197 nmdc:mga08y16_169215_c1 3300050511 Bacteria 2270
198 nmdc:mga0n895_2524_c1 3300050512 Bacteria 14345
199 nmdc:mga0n895_49284_c1 3300050512 Unclassified 4125
200 nmdc:mga0rr50_116625_c1 3300050513 Unclassified 2120
201 nmdc:mga0rr50_24935_c1 3300050513 Bacteria 4151
202 nmdc:mga0a205_7108_c2 3300050515 Bacteria 8732
203 Ga0500642_0065573 3300053130 Bacteria 1641
204 Ga0501084_0005823 3300054114 Bacteria 10144
205 Ga0501084_0029914 3300054114 Bacteria 4556
206 Ga0501084_0039980 3300054114 Bacteria 3923
207 Ga0501084_0407464 3300054114 Bacteria 1149
208 Ga0501084_0414171 3300054114 Bacteria 1139
209 Ga0501082_0006851 3300060353 Bacteria 9854
210 Ga0501082_0106472 3300060353 Bacteria 2426
211 Ga0501082_0231455 3300060353 Unclassified 1608
212 Ga0501082_0232172 3300060353 Unclassified 1606
213 Ga0501082_0235076 3300060353 Bacteria 1595
214 Ga0501082_0536638 3300060353 Bacteria 1023
215 Ga0530510_0022005 3300061734 Bacteria 4539
216 Ga0530510_0027766 3300061734 Bacteria 4055
217 2883292084 2883291878 Bacteria 5894118
218 2883355095 2883354860 Bacteria 5865246
219 Ga0500555_040875
220 Ga0070683_100554353
221 Ga0070690_100048861
222 Ga0070670_100125006
223 Ga0070670_100771784
224 Ga0070691_10008637
225 Ga0070691_10034720
226 Ga0070692_10039512
227 Ga0070671_100245755
228 Ga0070673_100282522
229 Ga0070667_100415757
230 Ga0070703_10001729
231 Ga0070714_100344286
232 Ga0070713_100064202
233 Ga0070701_10004120
234 Ga0070694_100001861
235 Ga0070694_100053639
236 Ga0070708_100022031
237 Ga0070663_100007025
238 Ga0070681_10133216
239 Ga0070699_100001809
240 Ga0070679_100200536
241 Ga0070697_100238976
242 Ga0070695_100002921
243 Ga0070695_100041769
244 Ga0070696_100000856
245 Ga0070693_100112254
246 Ga0068857_100042077
247 Ga0070702_100018820
248 Ga0068859_100010838
249 Ga0068861_100023113
250 Ga0068870_10069535
251 Ga0068863_100610274
252 Ga0068858_100029478
253 Ga0068860_100010661
254 Ga0068860_100350271
255 Ga0068862_100001949
256 Ga0081455_10000029
257 Ga0081540_1000048
258 Ga0081539_10024720
259 Ga0075365_10051840
260 Ga0075368_10036903
261 Ga0075368_10110438
262 Ga0075363_100030275
263 Ga0075364_10008502
264 Ga0075367_10041057
265 Ga0075367_10051969
266 Ga0075367_10054581
267 Ga0075428_100095445
268 Ga0075430_100119908
269 Ga0075431_100019995
270 Ga0075431_100150051
271 Ga0075433_10005933
272 Ga0075434_100003078
273 Ga0075434_100006345
274 Ga0075429_100097632
275 Ga0075429_100105067
276 Ga0075429_100265924
277 Ga0068865_100139101
278 Ga0097620_100010838
279 Ga0075435_100016462
280 Ga0075435_100196093
281 Ga0114129_10231558
282 Ga0105241_10244270
283 Ga0105248_10663852
284 Ga0105249_10210168
285 Ga0105249_10251787
286 Ga0105239_10573484
287 Ga0105239_10657311
288 Ga0105246_10066644
289 Ga0163163_10246162
290 Ga0157380_10030228
291 Ga0157380_10318960
292 Ga0157379_10006995
293 Ga0157379_10043479
294 Ga0157376_10660899
295 Ga0213876_10119359
296 Ga0213875_10195157
297 Ga0207707_10035662
298 Ga0207652_10168996
299 Ga0207700_10083965
300 Ga0207644_10246699
301 Ga0207661_10128756
302 Ga0207712_10003965
303 Ga0207668_10516936
304 Ga0207658_10247683
305 Ga0207703_10013856
306 Ga0207703_10799400
307 Ga0207678_10001884
308 Ga0207641_10563334
309 Ga0207674_10011740
310 Ga0207675_100015341
311 Ga0207675_100025749
312 Ga0207675_100398949
313 Ga0209813_10009521
314 Ga0209813_10012575
315 Ga0207428_10045012
316 Ga0268265_10017411
317 Ga0268264_10002039
318 Ga0268264_10105591
319 Ga0307510_10223130
320 Ga0373929_0041931
321 Ga0373949_0011786
322 Ga0373951_0024058
323 Ga0373932_0017738
324 Ga0373960_0010404
325 Ga0373962_0010883
326 Ga0316574_0371043
327 Ga0373931_0028173
328 Ga0373935_0529087
329 Ga0436364_1521531
330 Ga0436365_0923259
331 Ga0466960_0040872
332 Ga0451576_0031341
333 Ga0451576_0152489
334 Ga0495603_0382720
335 Ga0496102_0031310
336 Ga0496103_0011431
337 Ga0496104_0000521
338 Ga0496104_0006243
339 Ga0496105_0004218
340 Ga0496105_0079875
341 Ga0496106_0003134
342 Ga0496107_0117509
343 Ga0496107_0388187
344 Ga0496108_0144278
345 Ga0496108_0592893
346 Ga0496109_0003581
347 Ga0496109_0239629
348 Ga0496109_0826047
349 Ga0496110_0000727
350 Ga0496111_0002340
351 Ga0496112_0217440
352 Ga0496113_0097305
353 Ga0496113_0264344
354 Ga0496115_0009396
355 Ga0496115_0077639
356 Ga0501033_0032049
357 Ga0501034_0009998
358 Ga0501034_0222435
359 Ga0501034_0439337
360 Ga0501034_0667581
361 Ga0501036_0186790
362 Ga0501039_0120869
363 Ga0501040_0083589
364 Ga0501041_0505971
365 Ga0501042_0300828
366 Ga0501043_0168411
367 Ga0501043_0327924
368 Ga0501046_0000058
369 Ga0501046_0254071
370 Ga0501047_0115485
371 Ga0501047_0131354
372 Ga0501067_0149331
373 Ga0501068_0099209
374 Ga0501069_0251881
375 Ga0501070_0138409
376 Ga0501071_0143528
377 Ga0501072_0324343
378 Ga0501074_0017606
379 Ga0501074_0161770
380 Ga0501075_0040373
381 Ga0501075_0155335
382 Ga0501076_0068914
383 Ga0501076_0344019
384 Ga0501076_0435570
385 Ga0501077_0021560
386 Ga0501077_0025412
387 Ga0501079_0009878
388 Ga0501079_0053169
389 Ga0501079_0375030
390 Ga0501080_0025260
391 Ga0501080_0030982
392 Ga0501080_0195845
393 Ga0501081_0033970
394 Ga0501081_0143519
395 Ga0501083_0042878
396 Ga0501083_0044339
397 Ga0501044_0047827
398 Ga0501044_0075119
399 Ga0501044_0138681
400 Ga0501044_0301246
401 Ga0501045_0063985
402 Ga0501045_0643479
403 nmdc:mga03n38_5288_c1
404 nmdc:mga06z11_140081_c1
405 nmdc:mga04h51_26954_c1
406 nmdc:mga04h51_47922_c1
407 nmdc:mga04h51_5980_c1
408 nmdc:mga05p37_325960_c1
409 nmdc:mga09592_127698_c1
410 nmdc:mga09592_39097_c1
411 nmdc:mga0qj67_186118_c1
412 nmdc:mga0qj67_20106_c1
413 nmdc:mga06r32_7911_c1
414 nmdc:mga06r32_8364_c1
415 nmdc:mga08y16_169215_c1
416 nmdc:mga0n895_2524_c1
417 nmdc:mga0n895_49284_c1
418 nmdc:mga0rr50_116625_c1
419 nmdc:mga0rr50_24935_c1
420 nmdc:mga0a205_7108_c2
421 Ga0500642_0065573
422 Ga0501084_0005823
423 Ga0501084_0029914
424 Ga0501084_0039980
425 Ga0501084_0407464
426 Ga0501084_0414171
427 Ga0501082_0006851
428 Ga0501082_0106472
429 Ga0501082_0231455
430 Ga0501082_0232172
431 Ga0501082_0235076
432 Ga0501082_0536638
433 Ga0530510_0022005
434 Ga0530510_0027766
435 2883292084
436 2883355095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

39

129

0.88

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

22

279

0.54

Structural Annotation

Top 5 Hits

ID Description Score Start End
3llc-assembly1.cif.gz_A crystal structure of putative hydrolase (yp_002548124.1) from agrobacterium vitis s4 at 1.80 a resolution 0.9603 12 256
6ny9-assembly1.cif.gz_B alpha/beta hydrolase domain-containing protein 10 from mouse 0.9395 12 256
6ny9-assembly1.cif.gz_B alpha/beta hydrolase domain-containing protein 10 from mouse 0.9178 12 256
3llc-assembly1.cif.gz_A crystal structure of putative hydrolase (yp_002548124.1) from agrobacterium vitis s4 at 1.80 a resolution 0.8993 12 256
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8532 12 135
ID Description Score Start End Superfamily
af_E7F9Y7_35_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9668 12 256 3.40.50.1820
af_E7F9Y7_35_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9405 12 256 3.40.50.1820
3llcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9174 12 254 3.40.50.1820
3llcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8854 12 254 3.40.50.1820
af_A0A0R0GYE0_51_217_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8184 12 174 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A401PSI8-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9887 12 105 GO:0004553
GO:0005739
GO:0008474
AF-A0A2N4YD77-F1-model_v4 Palmitoyl-protein thioesterase ABHD10, mitochondrial (EC 3.1.1.93) (EC 3.1.2.22) (Acyl-protein thioesterase ABHD10) (Alpha/beta hydrolase domain-containing protein 10) (Mycophenolic acid acyl-glucuronide esterase, mitochondrial) 0.9884 12 256 GO:0016787
AF-A0A7V8DZ01-F1-model_v4 deleted 0.9865 24 256
AF-A0A2E7R9F1-F1-model_v4 Alpha/beta hydrolase 0.9858 45 254 GO:0004553
AF-A0A3B9K3Y7-F1-model_v4 Palmitoyl-protein thioesterase ABHD10, mitochondrial (EC 3.1.1.93) (EC 3.1.2.22) (Acyl-protein thioesterase ABHD10) (Alpha/beta hydrolase domain-containing protein 10) (Mycophenolic acid acyl-glucuronide esterase, mitochondrial) 0.985 37 254 GO:0004553
GO:0008474

Map