F330479

General Info

Members Datasets Scaffolds Average Seq Length
218 135 436 371

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_1069_c1|nmdc:mga08x19_1069_c1_235_1392
Length 385
Sequence MKTRSALTIAAAVAWLAASPPVSSGQQRRAADGVAIGDDGLPLYSTFSLCAIDPATGQSGAAVTTRVPFVGRAVPHVRAGVGAVCTQASTVVEYGPRGLDLLARGVEPQAAVAQLLADDALREMRQLGMIDMKGRAAAHTGKQNSNWAGSRQGKNYTTQANIMVGPEVLDAVAATFESTEGTGMPLAERMILALEAGYAKGGDRRWGNLQSAAIKIADPNDPGRGGDYIALAIEVGEHPEPVAEMKRIYYTTGRHLGYRSFSRIEGQDVIELKRMLHALGYWRLTLTAFPEAPASTNTPKMQELRRTKPAEYDRVVAENRRQTTDYTSAYATFDEETIAAVDKFRADRNLNYQGDAPGLVDARFIDALRAAYIACRRNTGTSRCG

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
88 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
89 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
90 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
91 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
92 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
95 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
96 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
97 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
98 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
103 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 2.29
Rhizosphere 97.25
Stem 0
Stem Tuber 0
Unclassified 20.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_1069_c1 3300050514 Bacteria 17091
2 Ga0065712_10070271 3300005290 Bacteria 6158
3 Ga0065707_10164220 3300005295 Bacteria 1537
4 Ga0070666_10051533 3300005335 Bacteria 2772
5 Ga0070666_10073324 3300005335 Bacteria 2332
6 Ga0068868_100066708 3300005338 Bacteria 2862
7 Ga0068868_100098272 3300005338 Bacteria 2367
8 Ga0068868_100161963 3300005338 Unclassified 1848
9 Ga0070689_100042711 3300005340 Archaea 3481
10 Ga0070668_100068779 3300005347 Bacteria 2753
11 Ga0070669_100067782 3300005353 Bacteria 2633
12 Ga0070669_100243122 3300005353 Bacteria 1431
13 Ga0070675_100000116 3300005354 Bacteria 46828
14 Ga0070675_100031994 3300005354 Bacteria 4254
15 Ga0070675_100062707 3300005354 Unclassified 3072
16 Ga0070671_100021706 3300005355 Bacteria 5244
17 Ga0070673_100010726 3300005364 Bacteria 6214
18 Ga0070688_100016818 3300005365 Bacteria 4188
19 Ga0070667_100039127 3300005367 Bacteria 3974
20 Ga0070714_100015055 3300005435 Bacteria 6219
21 Ga0070713_100364112 3300005436 Unclassified 1344
22 Ga0070705_100037801 3300005440 Bacteria 2726
23 Ga0070694_100190476 3300005444 Bacteria 1523
24 Ga0070681_10046108 3300005458 Bacteria 4358
25 Ga0070699_100008894 3300005518 Bacteria 8698
26 Ga0070684_100357987 3300005535 Bacteria 1343
27 Ga0068853_100120894 3300005539 Bacteria 2336
28 Ga0070665_100003212 3300005548 Bacteria 17580
29 Ga0068854_100005993 3300005578 Bacteria 7698
30 Ga0068859_100038490 3300005617 Bacteria 4798
31 Ga0068859_100329127 3300005617 Bacteria 1622
32 Ga0068864_100250344 3300005618 Bacteria 1645
33 Ga0068861_100032306 3300005719 Bacteria 3852
34 Ga0068861_100291710 3300005719 Bacteria 1409
35 Ga0068863_100013786 3300005841 Bacteria 7789
36 Ga0068858_100008329 3300005842 Bacteria 9975
37 Ga0068860_100018555 3300005843 Bacteria 6767
38 Ga0068862_100166111 3300005844 Bacteria 1973
39 Ga0097621_100102405 3300006237 Bacteria 2410
40 Ga0068871_100100759 3300006358 Bacteria 2420
41 Ga0068871_100172512 3300006358 Unclassified 1855
42 Ga0068871_100191895 3300006358 Bacteria 1760
43 Ga0068871_100234405 3300006358 Bacteria 1594
44 Ga0075428_100008298 3300006844 Bacteria 11513
45 Ga0075428_100034126 3300006844 Bacteria 5613
46 Ga0075428_100096017 3300006844 Unclassified 3231
47 Ga0075428_100212535 3300006844 Bacteria 2090
48 Ga0075431_100097561 3300006847 Bacteria 3035
49 Ga0075431_100157221 3300006847 Bacteria 2338
50 Ga0075433_10052616 3300006852 Bacteria 3548
51 Ga0075433_10172488 3300006852 Bacteria 1925
52 Ga0075434_100000264 3300006871 Bacteria 37263
53 Ga0075434_100038655 3300006871 Unclassified 4727
54 Ga0075434_100173148 3300006871 Bacteria 2178
55 Ga0075434_100347115 3300006871 Unclassified 1505
56 Ga0075429_100227460 3300006880 Unclassified 1634
57 Ga0068865_100009686 3300006881 Bacteria 5976
58 Ga0075436_100000694 3300006914 Bacteria 22204
59 Ga0075436_100091020 3300006914 Bacteria 2120
60 Ga0097620_100038490 3300006931 Bacteria 4798
61 Ga0097620_100329097 3300006931 Bacteria 1622
62 Ga0075435_100000163 3300007076 Bacteria 38632
63 Ga0075435_100003822 3300007076 Bacteria 10277
64 Ga0075435_100093806 3300007076 Bacteria 2480
65 Ga0075435_100212326 3300007076 Bacteria 1642
66 Ga0105251_10103568 3300009011 Bacteria 1300
67 Ga0105240_10008451 3300009093 Bacteria 14726
68 Ga0111539_10011862 3300009094 Bacteria 10924
69 Ga0111539_10109999 3300009094 Bacteria 3233
70 Ga0111539_10112295 3300009094 Unclassified 3197
71 Ga0111539_10175919 3300009094 Bacteria 2500
72 Ga0105245_10021941 3300009098 Bacteria 5603
73 Ga0105245_10249815 3300009098 Bacteria 1723
74 Ga0114129_10003232 3300009147 Bacteria 22871
75 Ga0114129_10005775 3300009147 Bacteria 17527
76 Ga0114129_10006963 3300009147 Bacteria 16086
77 Ga0114129_10033249 3300009147 Bacteria 7288
78 Ga0114129_10135375 3300009147 Bacteria 3381
79 Ga0114129_10142222 3300009147 Bacteria 3288
80 Ga0114129_10168090 3300009147 Unclassified 2991
81 Ga0105241_10055433 3300009174 Bacteria 3037
82 Ga0105242_10002851 3300009176 Bacteria 13543
83 Ga0105248_10050415 3300009177 Unclassified 4668
84 Ga0105248_10268084 3300009177 Bacteria 1922
85 Ga0105248_10382146 3300009177 Unclassified 1585
86 Ga0105249_10061117 3300009553 Bacteria 3457
87 Ga0157375_10024894 3300013308 Bacteria 5549
88 Ga0157375_10124649 3300013308 Bacteria 2690
89 Ga0157375_10343923 3300013308 Unclassified 1657
90 Ga0163163_10000008 3300014325 Bacteria 286490
91 Ga0163163_10052540 3300014325 Bacteria 4021
92 Ga0157380_10001199 3300014326 Bacteria 16776
93 Ga0157380_10056380 3300014326 Bacteria 3124
94 Ga0157380_10363627 3300014326 Unclassified 1359
95 Ga0157377_10008698 3300014745 Bacteria 4960
96 Ga0157379_10010798 3300014968 Bacteria 7961
97 Ga0157379_10019333 3300014968 Bacteria 6016
98 Ga0157379_10480646 3300014968 Unclassified 1150
99 Ga0157376_10036728 3300014969 Bacteria 3971
100 Ga0157376_10072457 3300014969 Unclassified 2930
101 Ga0157376_10204876 3300014969 Bacteria 1818
102 Ga0207680_10036035 3300025903 Bacteria 2847
103 Ga0207680_10042308 3300025903 Bacteria 2664
104 Ga0207695_10148291 3300025913 Bacteria 2287
105 Ga0207662_10008834 3300025918 Bacteria 5527
106 Ga0207681_10048630 3300025923 Bacteria 2863
107 Ga0207681_10175559 3300025923 Unclassified 1628
108 Ga0207659_10000064 3300025926 Bacteria 67058
109 Ga0207687_10293822 3300025927 Bacteria 1307
110 Ga0207664_10077169 3300025929 Bacteria 2699
111 Ga0207644_10021868 3300025931 Bacteria 4361
112 Ga0207706_10101473 3300025933 Bacteria 2532
113 Ga0207686_10122358 3300025934 Unclassified 1773
114 Ga0207704_10031615 3300025938 Unclassified 2985
115 Ga0207711_10013905 3300025941 Bacteria 6685
116 Ga0207711_10246321 3300025941 Unclassified 1640
117 Ga0207661_10335866 3300025944 Bacteria 1361
118 Ga0207651_10022573 3300025960 Bacteria 3851
119 Ga0207668_10047045 3300025972 Bacteria 2952
120 Ga0207640_10029453 3300025981 Bacteria 3370
121 Ga0207677_10117202 3300026023 Unclassified 1996
122 Ga0207703_10072983 3300026035 Bacteria 2838
123 Ga0207703_10297740 3300026035 Bacteria 1470
124 Ga0207639_10088136 3300026041 Bacteria 2476
125 Ga0207708_10106598 3300026075 Unclassified 2173
126 Ga0207676_10279509 3300026095 Unclassified 1515
127 Ga0207676_10305442 3300026095 Unclassified 1454
128 Ga0207675_100010841 3300026118 Bacteria 8539
129 Ga0207675_100299210 3300026118 Bacteria 1567
130 Ga0207428_10002489 3300027907 Bacteria 18394
131 Ga0207428_10003024 3300027907 Bacteria 16561
132 Ga0207428_10026833 3300027907 Unclassified 4800
133 Ga0207428_10071562 3300027907 Bacteria 2723
134 Ga0268266_10093096 3300028379 Bacteria 2644
135 Ga0268265_10045001 3300028380 Bacteria 3290
136 Ga0268265_10109704 3300028380 Bacteria 2250
137 Ga0268265_10167606 3300028380 Bacteria 1873
138 Ga0268264_10016766 3300028381 Bacteria 5994
139 Ga0307408_100033477 3300031548 Bacteria 3591
140 Ga0307410_10007924 3300031852 Bacteria 5854
141 Ga0307409_100348011 3300031995 Bacteria 1397
142 Ga0307416_100021218 3300032002 Bacteria 4658
143 Ga0307416_100158704 3300032002 Unclassified 2087
144 Ga0373930_0000910 3300034816 Bacteria 4231
145 Ga0373948_0001151 3300034817 Bacteria 3582
146 Ga0373958_0002434 3300034819 Bacteria 2608
147 Ga0373938_0000220 3300034957 Bacteria 8769
148 Ga0373928_0003751 3300035084 Bacteria 2900
149 Ga0373929_0000281 3300035085 Bacteria 9448
150 Ga0373934_0024990 3300035086 Unclassified 2311
151 Ga0373940_0002909 3300035088 Bacteria 3412
152 Ga0373949_0005308 3300035090 Bacteria 2880
153 Ga0373951_0000668 3300035091 Bacteria 9447
154 Ga0373952_0001073 3300035092 Bacteria 4996
155 Ga0373941_0000459 3300035115 Bacteria 8133
156 Ga0373956_0038270 3300035119 Unclassified 2122
157 Ga0373957_0073565 3300035120 Unclassified 1340
158 Ga0373960_0000115 3300035121 Bacteria 12973
159 Ga0373942_0000216 3300035207 Bacteria 15152
160 Ga0373961_0001610 3300035241 Bacteria 6418
161 Ga0373933_0011578 3300035724 Unclassified 4866
162 Ga0373937_0000108 3300036401 Bacteria 79022
163 Ga0373937_0456576 3300036401 Unclassified 1213
164 Ga0439433_0002610 3300041999 Bacteria 3828
165 Ga0439462_0023119 3300042015 Bacteria 1629
166 Ga0450923_003506 3300042125 Bacteria 2376
167 Ga0453683_0242928 3300044673 Bacteria 1147
168 Ga0451576_0005342 3300045051 Bacteria 16150
169 Ga0451576_0063220 3300045051 Unclassified 3858
170 Ga0451576_0128400 3300045051 Bacteria 2642
171 Ga0451576_0349041 3300045051 Bacteria 1549
172 Ga0495647_0033875 3300046681 Bacteria 1911
173 Ga0495658_0011220 3300046683 Bacteria 4500
174 Ga0495674_0339145 3300047319 Bacteria 1222
175 Ga0496104_0529608 3300048907 Bacteria 1089
176 Ga0496106_0047579 3300048909 Bacteria 3229
177 Ga0496112_0051685 3300048915 Bacteria 4031
178 Ga0496113_0051243 3300048916 Bacteria 3080
179 Ga0496114_0080904 3300048917 Unclassified 2744
180 Ga0501072_0065150 3300049588 Unclassified 2873
181 Ga0501073_0003040 3300049589 Bacteria 12583
182 Ga0501077_0041522 3300049593 Unclassified 2928
183 Ga0501045_0180042 3300049824 Unclassified 1575
184 nmdc:mga05p37_10907_c1 3300050507 Bacteria 10790
185 nmdc:mga05p37_15_c1 3300050507 Bacteria 134650
186 nmdc:mga05p37_304401_c1 3300050507 Bacteria 1892
187 nmdc:mga05p37_40999_c1 3300050507 Bacteria 5685
188 nmdc:mga05p37_6413_c1 3300050507 Bacteria 13868
189 nmdc:mga05p37_7990_c1 3300050507 Bacteria 12487
190 nmdc:mga09592_57944_c1 3300050508 Unclassified 3275
191 nmdc:mga0qj67_66939_c1 3300050509 Unclassified 2861
192 nmdc:mga06r32_35104_c1 3300050510 Bacteria 4731
193 nmdc:mga06r32_68838_c1 3300050510 Unclassified 3420
194 nmdc:mga08y16_10722_c1 3300050511 Bacteria 9617
195 nmdc:mga08y16_107863_c1 3300050511 Unclassified 2899
196 nmdc:mga08y16_151109_c1 3300050511 Unclassified 2414
197 nmdc:mga08y16_1546_c1 3300050511 Bacteria 23180
198 nmdc:mga08y16_20905_c1 3300050511 Bacteria 6911
199 nmdc:mga08y16_30515_c1 3300050511 Bacteria 5673
200 nmdc:mga08y16_59355_c1 3300050511 Bacteria 3996
201 nmdc:mga0n895_12_c1 3300050512 Bacteria 112043
202 nmdc:mga0n895_197630_c1 3300050512 Bacteria 2042
203 nmdc:mga0n895_359684_c1 3300050512 Unclassified 1474
204 nmdc:mga0rr50_191_c1 3300050513 Bacteria 33287
205 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
206 nmdc:mga0rr50_214668_c1 3300050513 Unclassified 1586
207 nmdc:mga0rr50_41354_c1 3300050513 Bacteria 3358
208 nmdc:mga0rr50_50725_c1 3300050513 Bacteria 3076
209 nmdc:mga08x19_87_c1 3300050514 Bacteria 83168
210 nmdc:mga0a205_10463_c1 3300050515 Bacteria 8521
211 nmdc:mga0a205_127027_c1 3300050515 Bacteria 2449
212 nmdc:mga0a205_237235_c1 3300050515 Bacteria 1705
213 nmdc:mga0a205_31127_c1 3300050515 Bacteria 5110
214 Ga0495601_0018950 3300053077 Bacteria 4193
215 Ga0500555_014350 3300053103 Bacteria 2284
216 Ga0501084_0098610 3300054114 Unclassified 2454
217 Ga0590075_006125 3300059424 Bacteria 2849
218 Ga0590077_002466 3300059426 Bacteria 3952
219 nmdc:mga08x19_1069_c1
220 Ga0065712_10070271
221 Ga0065707_10164220
222 Ga0070666_10051533
223 Ga0070666_10073324
224 Ga0068868_100066708
225 Ga0068868_100098272
226 Ga0068868_100161963
227 Ga0070689_100042711
228 Ga0070668_100068779
229 Ga0070669_100067782
230 Ga0070669_100243122
231 Ga0070675_100000116
232 Ga0070675_100031994
233 Ga0070675_100062707
234 Ga0070671_100021706
235 Ga0070673_100010726
236 Ga0070688_100016818
237 Ga0070667_100039127
238 Ga0070714_100015055
239 Ga0070713_100364112
240 Ga0070705_100037801
241 Ga0070694_100190476
242 Ga0070681_10046108
243 Ga0070699_100008894
244 Ga0070684_100357987
245 Ga0068853_100120894
246 Ga0070665_100003212
247 Ga0068854_100005993
248 Ga0068859_100038490
249 Ga0068859_100329127
250 Ga0068864_100250344
251 Ga0068861_100032306
252 Ga0068861_100291710
253 Ga0068863_100013786
254 Ga0068858_100008329
255 Ga0068860_100018555
256 Ga0068862_100166111
257 Ga0097621_100102405
258 Ga0068871_100100759
259 Ga0068871_100172512
260 Ga0068871_100191895
261 Ga0068871_100234405
262 Ga0075428_100008298
263 Ga0075428_100034126
264 Ga0075428_100096017
265 Ga0075428_100212535
266 Ga0075431_100097561
267 Ga0075431_100157221
268 Ga0075433_10052616
269 Ga0075433_10172488
270 Ga0075434_100000264
271 Ga0075434_100038655
272 Ga0075434_100173148
273 Ga0075434_100347115
274 Ga0075429_100227460
275 Ga0068865_100009686
276 Ga0075436_100000694
277 Ga0075436_100091020
278 Ga0097620_100038490
279 Ga0097620_100329097
280 Ga0075435_100000163
281 Ga0075435_100003822
282 Ga0075435_100093806
283 Ga0075435_100212326
284 Ga0105251_10103568
285 Ga0105240_10008451
286 Ga0111539_10011862
287 Ga0111539_10109999
288 Ga0111539_10112295
289 Ga0111539_10175919
290 Ga0105245_10021941
291 Ga0105245_10249815
292 Ga0114129_10003232
293 Ga0114129_10005775
294 Ga0114129_10006963
295 Ga0114129_10033249
296 Ga0114129_10135375
297 Ga0114129_10142222
298 Ga0114129_10168090
299 Ga0105241_10055433
300 Ga0105242_10002851
301 Ga0105248_10050415
302 Ga0105248_10268084
303 Ga0105248_10382146
304 Ga0105249_10061117
305 Ga0157375_10024894
306 Ga0157375_10124649
307 Ga0157375_10343923
308 Ga0163163_10000008
309 Ga0163163_10052540
310 Ga0157380_10001199
311 Ga0157380_10056380
312 Ga0157380_10363627
313 Ga0157377_10008698
314 Ga0157379_10010798
315 Ga0157379_10019333
316 Ga0157379_10480646
317 Ga0157376_10036728
318 Ga0157376_10072457
319 Ga0157376_10204876
320 Ga0207680_10036035
321 Ga0207680_10042308
322 Ga0207695_10148291
323 Ga0207662_10008834
324 Ga0207681_10048630
325 Ga0207681_10175559
326 Ga0207659_10000064
327 Ga0207687_10293822
328 Ga0207664_10077169
329 Ga0207644_10021868
330 Ga0207706_10101473
331 Ga0207686_10122358
332 Ga0207704_10031615
333 Ga0207711_10013905
334 Ga0207711_10246321
335 Ga0207661_10335866
336 Ga0207651_10022573
337 Ga0207668_10047045
338 Ga0207640_10029453
339 Ga0207677_10117202
340 Ga0207703_10072983
341 Ga0207703_10297740
342 Ga0207639_10088136
343 Ga0207708_10106598
344 Ga0207676_10279509
345 Ga0207676_10305442
346 Ga0207675_100010841
347 Ga0207675_100299210
348 Ga0207428_10002489
349 Ga0207428_10003024
350 Ga0207428_10026833
351 Ga0207428_10071562
352 Ga0268266_10093096
353 Ga0268265_10045001
354 Ga0268265_10109704
355 Ga0268265_10167606
356 Ga0268264_10016766
357 Ga0307408_100033477
358 Ga0307410_10007924
359 Ga0307409_100348011
360 Ga0307416_100021218
361 Ga0307416_100158704
362 Ga0373930_0000910
363 Ga0373948_0001151
364 Ga0373958_0002434
365 Ga0373938_0000220
366 Ga0373928_0003751
367 Ga0373929_0000281
368 Ga0373934_0024990
369 Ga0373940_0002909
370 Ga0373949_0005308
371 Ga0373951_0000668
372 Ga0373952_0001073
373 Ga0373941_0000459
374 Ga0373956_0038270
375 Ga0373957_0073565
376 Ga0373960_0000115
377 Ga0373942_0000216
378 Ga0373961_0001610
379 Ga0373933_0011578
380 Ga0373937_0000108
381 Ga0373937_0456576
382 Ga0439433_0002610
383 Ga0439462_0023119
384 Ga0450923_003506
385 Ga0453683_0242928
386 Ga0451576_0005342
387 Ga0451576_0063220
388 Ga0451576_0128400
389 Ga0451576_0349041
390 Ga0495647_0033875
391 Ga0495658_0011220
392 Ga0495674_0339145
393 Ga0496104_0529608
394 Ga0496106_0047579
395 Ga0496112_0051685
396 Ga0496113_0051243
397 Ga0496114_0080904
398 Ga0501072_0065150
399 Ga0501073_0003040
400 Ga0501077_0041522
401 Ga0501045_0180042
402 nmdc:mga05p37_10907_c1
403 nmdc:mga05p37_15_c1
404 nmdc:mga05p37_304401_c1
405 nmdc:mga05p37_40999_c1
406 nmdc:mga05p37_6413_c1
407 nmdc:mga05p37_7990_c1
408 nmdc:mga09592_57944_c1
409 nmdc:mga0qj67_66939_c1
410 nmdc:mga06r32_35104_c1
411 nmdc:mga06r32_68838_c1
412 nmdc:mga08y16_10722_c1
413 nmdc:mga08y16_107863_c1
414 nmdc:mga08y16_151109_c1
415 nmdc:mga08y16_1546_c1
416 nmdc:mga08y16_20905_c1
417 nmdc:mga08y16_30515_c1
418 nmdc:mga08y16_59355_c1
419 nmdc:mga0n895_12_c1
420 nmdc:mga0n895_197630_c1
421 nmdc:mga0n895_359684_c1
422 nmdc:mga0rr50_191_c1
423 nmdc:mga0rr50_1_c1
424 nmdc:mga0rr50_214668_c1
425 nmdc:mga0rr50_41354_c1
426 nmdc:mga0rr50_50725_c1
427 nmdc:mga08x19_87_c1
428 nmdc:mga0a205_10463_c1
429 nmdc:mga0a205_127027_c1
430 nmdc:mga0a205_237235_c1
431 nmdc:mga0a205_31127_c1
432 Ga0495601_0018950
433 Ga0500555_014350
434 Ga0501084_0098610
435 Ga0590075_006125
436 Ga0590077_002466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06267

DUF1028

Family of unknown function (DUF1028)

46

245

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imh-assembly3.cif.gz_B crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.8934 41 245
2imh-assembly3.cif.gz_A crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.8906 41 245
7l6s-assembly1.cif.gz_A-2 crystal structure of the atpase and transducer domains of dna topoisomerase ii from balamuthia mandrillaris cdc:v039: baboon/san diego/1986 0.8141 42 59
2imh-assembly3.cif.gz_B crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.7843 41 245
2imh-assembly3.cif.gz_A crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.7559 41 245
ID Description Score Start End Superfamily
af_K7LBJ4_23_159_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.922 162 193 1.50.40.10
af_Q9FNU5_39_320_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.9061 162 193 1.50.40.10
2imhB01 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.8867 41 245 3.60.20.10
af_A4HWA9_1_141_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.8739 162 195 1.50.40.10
af_B4FZF1_31_326_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.8739 162 193 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A4Q8YLC1-F1-model_v4 deleted 0.9334 42 245
AF-A0A399ZZH4-F1-model_v4 DUF1028 domain-containing protein 0.9324 42 245
AF-A0A3N5RTH7-F1-model_v4 DUF1028 domain-containing protein 0.9316 42 131
AF-A0A1F6ZJM0-F1-model_v4 Fimbrial assembly protein FimA 0.9292 42 250
AF-A0A536XAI5-F1-model_v4 DUF1028 domain-containing protein 0.9291 42 245

Map