F330293

General Info

Members Datasets Scaffolds Average Seq Length
218 134 436 351

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0111055|Ga0495629_0111055_230_1306
Length 347
Sequence VTPEEARAQFPVLERYAYLNTGSSGPLSQASVEAMRAQLERDLTQGRSGKARMEELFESRERIRGGIAAVLGTSPELVALTDSTTRGCQLVIAGLGLGATDEVITTDQEHFGLLGPLHASGARVVVTQADESALLAAVTPRTRLIAVSHVLWTTGRRLDLAGLRQPGGPPLLVDGAQSAGAIPVDLDGSAHKWLCGPDPSGGLFVRDPERLAVALPSAFSPSSHDADGSFVPKDGARRFDSGWIGAPALAGLEAALGVHPDWRYEGAAAAAARCRELLAPQVDVVTPPGQSTLVSFRASGDPTELVAALADRGVIVRELPGDNLIRVSCGWWTSEDDLRRLPEGLRG

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
54 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
106 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
132 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.63
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 14.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0111055 3300046459 Bacteria 1911
2 Ga0070658_10010256 3300005327 Bacteria 7512
3 Ga0070683_100008000 3300005329 Bacteria 8972
4 Ga0070683_100019024 3300005329 Bacteria 6094
5 Ga0070683_100053851 3300005329 Bacteria 3729
6 Ga0070683_100108558 3300005329 Bacteria 2617
7 Ga0070683_100130268 3300005329 Bacteria 2380
8 Ga0070683_100469690 3300005329 Bacteria 1201
9 Ga0070661_100113701 3300005344 Unclassified 2023
10 Ga0070710_10012097 3300005437 Bacteria 4277
11 Ga0070681_10049827 3300005458 Bacteria 4180
12 Ga0070707_100163375 3300005468 Bacteria 2170
13 Ga0070698_100229745 3300005471 Bacteria 1788
14 Ga0070679_100037238 3300005530 Bacteria 4831
15 Ga0070679_100076663 3300005530 Bacteria 3332
16 Ga0070684_100013509 3300005535 Bacteria 6587
17 Ga0070684_100020987 3300005535 Bacteria 5425
18 Ga0070684_100047768 3300005535 Bacteria 3710
19 Ga0070684_100110052 3300005535 Bacteria 2469
20 Ga0070695_100000023 3300005545 Bacteria 60293
21 Ga0070693_100083879 3300005547 Bacteria 1906
22 Ga0068855_100021883 3300005563 Bacteria 7665
23 Ga0070664_100066483 3300005564 Bacteria 3079
24 Ga0068857_100023794 3300005577 Bacteria 5393
25 Ga0068856_100128939 3300005614 Bacteria 2533
26 Ga0068856_100447184 3300005614 Bacteria 1313
27 Ga0068852_100486844 3300005616 Bacteria 1227
28 Ga0081540_1002727 3300005983 Bacteria 14366
29 Ga0070717_10002029 3300006028 Bacteria 14175
30 Ga0070712_100186169 3300006175 Bacteria 1621
31 Ga0075430_100020983 3300006846 Bacteria 5554
32 Ga0075433_10188881 3300006852 Bacteria 1833
33 Ga0075434_100056715 3300006871 Bacteria 3893
34 Ga0105240_10005428 3300009093 Bacteria 19003
35 Ga0105240_10010862 3300009093 Bacteria 12755
36 Ga0114129_10317018 3300009147 Bacteria 2074
37 Ga0105237_10150419 3300009545 Unclassified 2324
38 Ga0157370_10005407 3300013104 Bacteria 14328
39 Ga0157370_10090079 3300013104 Bacteria 2880
40 Ga0157369_10397123 3300013105 Bacteria 1431
41 Ga0157378_10354090 3300013297 Bacteria 1435
42 Ga0157372_10005876 3300013307 Bacteria 13060
43 Ga0157372_10291069 3300013307 Bacteria 1899
44 Ga0157376_10135040 3300014969 Bacteria 2207
45 Ga0182006_1025217 3300015261 Bacteria 2444
46 Ga0197907_11303737 3300020069 Bacteria 7047
47 Ga0206356_10029049 3300020070 Bacteria 1713
48 Ga0206353_10130426 3300020082 Bacteria 3990
49 Ga0207688_10041374 3300025901 Bacteria 2563
50 Ga0207705_10001180 3300025909 Bacteria 21214
51 Ga0207707_10046822 3300025912 Unclassified 3766
52 Ga0207707_10404756 3300025912 Unclassified 1171
53 Ga0207671_10238103 3300025914 Unclassified 1429
54 Ga0207693_10008727 3300025915 Bacteria 8286
55 Ga0207649_10017055 3300025920 Bacteria 4111
56 Ga0207652_10162604 3300025921 Unclassified 2001
57 Ga0207664_10026133 3300025929 Bacteria 4408
58 Ga0207664_10168145 3300025929 Bacteria 1875
59 Ga0207706_10126824 3300025933 Unclassified 2244
60 Ga0207704_10243629 3300025938 Unclassified 1345
61 Ga0207661_10032349 3300025944 Bacteria 4051
62 Ga0207661_10071484 3300025944 Bacteria 2836
63 Ga0207661_10087764 3300025944 Bacteria 2584
64 Ga0207679_10164575 3300025945 Unclassified 1820
65 Ga0207702_10418436 3300026078 Bacteria 1295
66 Ga0207702_10420249 3300026078 Bacteria 1293
67 Ga0207648_10048699 3300026089 Bacteria 3710
68 Ga0207674_10014710 3300026116 Bacteria 8629
69 Ga0207674_10274984 3300026116 Bacteria 1632
70 Ga0207674_10287631 3300026116 Unclassified 1592
71 Ga0265319_1002685 3300028563 Bacteria 9536
72 Ga0265319_1021462 3300028563 Bacteria 2371
73 Ga0265334_10028546 3300028573 Bacteria 2241
74 Ga0265318_10035182 3300028577 Bacteria 1927
75 Ga0265322_10007247 3300028654 Bacteria 3244
76 Ga0265338_10036814 3300028800 Bacteria 4673
77 Ga0265320_10093947 3300031240 Bacteria 1387
78 Ga0265327_10009456 3300031251 Bacteria 7029
79 Ga0265327_10013246 3300031251 Bacteria 5490
80 Ga0265316_10028696 3300031344 Bacteria 4587
81 Ga0265316_10094298 3300031344 Bacteria 2280
82 Ga0265314_10028647 3300031711 Bacteria 4150
83 Ga0307406_10060310 3300031901 Bacteria 2446
84 Ga0373955_0045166 3300035172 Bacteria 2377
85 Ga0373947_0013637 3300035725 Bacteria 4655
86 Ga0373925_0005199 3300037068 Bacteria 9732
87 Ga0395899_0019007 3300037312 Bacteria 5221
88 Ga0395900_0011556 3300037418 Bacteria 9034
89 Ga0395900_0044896 3300037418 Unclassified 4551
90 Ga0395900_0199342 3300037418 Unclassified 2026
91 Ga0395900_0213418 3300037418 Bacteria 1948
92 Ga0395900_0236437 3300037418 Bacteria 1835
93 Ga0395900_0329210 3300037418 Bacteria 1506
94 Ga0395898_0005506 3300037466 Bacteria 13669
95 Ga0395898_0068894 3300037466 Bacteria 3424
96 Ga0395898_0123110 3300037466 Bacteria 2485
97 Ga0395898_0165170 3300037466 Bacteria 2117
98 Ga0395898_0181996 3300037466 Unclassified 2008
99 Ga0395898_0385802 3300037466 Bacteria 1336
100 Ga0395905_0055539 3300037471 Bacteria 3706
101 Ga0395905_0067785 3300037471 Bacteria 3342
102 Ga0395905_0075523 3300037471 Bacteria 3159
103 Ga0395901_0021717 3300038443 Bacteria 6577
104 Ga0395901_0025777 3300038443 Bacteria 6036
105 Ga0395901_0034564 3300038443 Bacteria 5221
106 Ga0395901_0057552 3300038443 Bacteria 4043
107 Ga0395901_0178080 3300038443 Bacteria 2230
108 Ga0395901_0248347 3300038443 Unclassified 1854
109 Ga0395901_0302906 3300038443 Bacteria 1657
110 Ga0395901_0339753 3300038443 Bacteria 1551
111 Ga0466965_0059169 3300044683 Bacteria 1912
112 Ga0466966_0055390 3300044684 Bacteria 2509
113 Ga0466961_0004773 3300044693 Bacteria 8533
114 Ga0466963_0001732 3300044694 Bacteria 11878
115 Ga0466963_0010157 3300044694 Bacteria 5692
116 Ga0466963_0011935 3300044694 Bacteria 5304
117 Ga0466963_0043062 3300044694 Bacteria 2967
118 Ga0466963_0050952 3300044694 Bacteria 2742
119 Ga0466963_0108111 3300044694 Bacteria 1907
120 Ga0466964_0004622 3300044706 Bacteria 5089
121 Ga0466964_0004654 3300044706 Bacteria 5072
122 Ga0466964_0073999 3300044706 Bacteria 1447
123 Ga0466964_0117349 3300044706 Bacteria 1195
124 Ga0466957_0002085 3300044842 Bacteria 10698
125 Ga0466957_0035614 3300044842 Bacteria 2987
126 Ga0466957_0046064 3300044842 Bacteria 2646
127 Ga0466960_0054889 3300044901 Unclassified 1936
128 Ga0466959_0016801 3300045049 Bacteria 5354
129 Ga0466959_0025819 3300045049 Bacteria 4356
130 Ga0466958_0002164 3300045836 Bacteria 9786
131 Ga0466958_0006624 3300045836 Bacteria 6317
132 Ga0466958_0079432 3300045836 Bacteria 2017
133 Ga0466967_0001236 3300045976 Bacteria 14424
134 Ga0466967_0009441 3300045976 Bacteria 7235
135 Ga0466967_0019897 3300045976 Bacteria 5411
136 Ga0466967_0043693 3300045976 Bacteria 3881
137 Ga0466967_0080087 3300045976 Bacteria 2946
138 Ga0495627_029644 3300046453 Unclassified 1740
139 Ga0495592_0012708 3300046454 Bacteria 6400
140 Ga0495592_0052487 3300046454 Bacteria 3027
141 Ga0495603_0024854 3300046455 Bacteria 3625
142 Ga0495641_0011680 3300046461 Bacteria 4977
143 Ga0495641_0035007 3300046461 Bacteria 2370
144 Ga0495641_0056236 3300046461 Bacteria 1784
145 Ga0495641_0104619 3300046461 Bacteria 1263
146 Ga0495651_0112799 3300046462 Unclassified 2008
147 Ga0495653_0044797 3300046463 Unclassified 3432
148 Ga0495582_0062929 3300046473 Bacteria 2050
149 Ga0495582_0176998 3300046473 Bacteria 1215
150 Ga0495639_0001088 3300046475 Bacteria 12243
151 Ga0495662_0003188 3300046476 Bacteria 8284
152 Ga0495664_0151114 3300046477 Unclassified 1408
153 Ga0495584_0018224 3300046491 Bacteria 3570
154 Ga0495608_0138304 3300046511 Bacteria 1555
155 Ga0495618_0044215 3300046514 Unclassified 2809
156 Ga0495628_0028880 3300046516 Bacteria 4502
157 Ga0495630_0006658 3300046517 Bacteria 8235
158 Ga0495666_0000606 3300046526 Bacteria 16065
159 Ga0495652_0040624 3300046529 Unclassified 4020
160 Ga0495652_0041211 3300046529 Bacteria 3987
161 Ga0495665_0040028 3300046531 Bacteria 2496
162 Ga0495640_0051789 3300046533 Unclassified 2820
163 Ga0495640_0208689 3300046533 Bacteria 1235
164 Ga0495586_0007422 3300046535 Bacteria 5848
165 Ga0495587_0011842 3300046536 Bacteria 5513
166 Ga0495645_0094798 3300046543 Bacteria 2128
167 Ga0495667_0084492 3300046559 Unclassified 2061
168 Ga0495656_0123394 3300046615 Archaea 1225
169 Ga0495634_0038876 3300046642 Unclassified 3242
170 Ga0495634_0156004 3300046642 Bacteria 1441
171 Ga0495635_0180351 3300046663 Unclassified 1435
172 Ga0495647_0000242 3300046681 Bacteria 14935
173 Ga0495669_0196593 3300046684 Unclassified 963
174 Ga0495624_0011042 3300046690 Bacteria 6217
175 Ga0495624_0016442 3300046690 Bacteria 4979
176 Ga0495589_0186274 3300046794 Bacteria 983
177 Ga0495581_0014330 3300047315 Bacteria 4597
178 Ga0495604_0015169 3300047317 Bacteria 6150
179 Ga0495674_0058362 3300047319 Bacteria 3374
180 Ga0495676_0016971 3300047321 Bacteria 6447
181 Ga0495676_0054805 3300047321 Bacteria 3167
182 Ga0495676_0068445 3300047321 Bacteria 2743
183 Ga0495680_0070397 3300047322 Unclassified 2667
184 Ga0495684_0002199 3300047471 Bacteria 15612
185 Ga0495684_0009136 3300047471 Bacteria 7655
186 Ga0495593_0000299 3300047673 Bacteria 27012
187 Ga0496100_0219636 3300048903 Bacteria 1394
188 Ga0496101_0276220 3300048904 Bacteria 1312
189 Ga0496102_0008572 3300048905 Bacteria 8769
190 Ga0496103_0064525 3300048906 Unclassified 2283
191 Ga0496104_0153075 3300048907 Bacteria 2213
192 Ga0496106_0005956 3300048909 Bacteria 9002
193 Ga0496106_0074212 3300048909 Unclassified 2604
194 Ga0496107_0000956 3300048910 Bacteria 17125
195 Ga0496109_0024789 3300048912 Bacteria 5336
196 Ga0496109_0095555 3300048912 Bacteria 2752
197 Ga0496110_0073151 3300048913 Bacteria 3042
198 Ga0496110_0641436 3300048913 Bacteria 962
199 Ga0496111_0213873 3300048914 Bacteria 1432
200 Ga0496112_0018199 3300048915 Bacteria 6613
201 Ga0496112_0052362 3300048915 Bacteria 4006
202 Ga0496112_0055185 3300048915 Bacteria 3906
203 Ga0496112_0165414 3300048915 Bacteria 2178
204 Ga0496112_0257175 3300048915 Unclassified 1696
205 Ga0496113_0061458 3300048916 Bacteria 2835
206 Ga0496113_0110621 3300048916 Bacteria 2138
207 Ga0496114_0082559 3300048917 Unclassified 2717
208 nmdc:mga05p37_31321_c1 3300050507 Bacteria 6496
209 nmdc:mga0n895_79359_c1 3300050512 Bacteria 3269
210 Ga0495601_0148136 3300053077 Bacteria 1532
211 Ga0495612_0006597 3300053078 Bacteria 4763
212 Ga0495612_0059731 3300053078 Bacteria 1577
213 Ga0495619_0011169 3300053085 Bacteria 5649
214 Ga0495619_0161422 3300053085 Bacteria 1548
215 Ga0495619_0235014 3300053085 Unclassified 1270
216 Ga0466962_0020368 3300061719 Bacteria 3186
217 Ga0466962_0092371 3300061719 Bacteria 1451
218 Ga0466962_0096461 3300061719 Bacteria 1418
219 Ga0495629_0111055
220 Ga0070658_10010256
221 Ga0070683_100008000
222 Ga0070683_100019024
223 Ga0070683_100053851
224 Ga0070683_100108558
225 Ga0070683_100130268
226 Ga0070683_100469690
227 Ga0070661_100113701
228 Ga0070710_10012097
229 Ga0070681_10049827
230 Ga0070707_100163375
231 Ga0070698_100229745
232 Ga0070679_100037238
233 Ga0070679_100076663
234 Ga0070684_100013509
235 Ga0070684_100020987
236 Ga0070684_100047768
237 Ga0070684_100110052
238 Ga0070695_100000023
239 Ga0070693_100083879
240 Ga0068855_100021883
241 Ga0070664_100066483
242 Ga0068857_100023794
243 Ga0068856_100128939
244 Ga0068856_100447184
245 Ga0068852_100486844
246 Ga0081540_1002727
247 Ga0070717_10002029
248 Ga0070712_100186169
249 Ga0075430_100020983
250 Ga0075433_10188881
251 Ga0075434_100056715
252 Ga0105240_10005428
253 Ga0105240_10010862
254 Ga0114129_10317018
255 Ga0105237_10150419
256 Ga0157370_10005407
257 Ga0157370_10090079
258 Ga0157369_10397123
259 Ga0157378_10354090
260 Ga0157372_10005876
261 Ga0157372_10291069
262 Ga0157376_10135040
263 Ga0182006_1025217
264 Ga0197907_11303737
265 Ga0206356_10029049
266 Ga0206353_10130426
267 Ga0207688_10041374
268 Ga0207705_10001180
269 Ga0207707_10046822
270 Ga0207707_10404756
271 Ga0207671_10238103
272 Ga0207693_10008727
273 Ga0207649_10017055
274 Ga0207652_10162604
275 Ga0207664_10026133
276 Ga0207664_10168145
277 Ga0207706_10126824
278 Ga0207704_10243629
279 Ga0207661_10032349
280 Ga0207661_10071484
281 Ga0207661_10087764
282 Ga0207679_10164575
283 Ga0207702_10418436
284 Ga0207702_10420249
285 Ga0207648_10048699
286 Ga0207674_10014710
287 Ga0207674_10274984
288 Ga0207674_10287631
289 Ga0265319_1002685
290 Ga0265319_1021462
291 Ga0265334_10028546
292 Ga0265318_10035182
293 Ga0265322_10007247
294 Ga0265338_10036814
295 Ga0265320_10093947
296 Ga0265327_10009456
297 Ga0265327_10013246
298 Ga0265316_10028696
299 Ga0265316_10094298
300 Ga0265314_10028647
301 Ga0307406_10060310
302 Ga0373955_0045166
303 Ga0373947_0013637
304 Ga0373925_0005199
305 Ga0395899_0019007
306 Ga0395900_0011556
307 Ga0395900_0044896
308 Ga0395900_0199342
309 Ga0395900_0213418
310 Ga0395900_0236437
311 Ga0395900_0329210
312 Ga0395898_0005506
313 Ga0395898_0068894
314 Ga0395898_0123110
315 Ga0395898_0165170
316 Ga0395898_0181996
317 Ga0395898_0385802
318 Ga0395905_0055539
319 Ga0395905_0067785
320 Ga0395905_0075523
321 Ga0395901_0021717
322 Ga0395901_0025777
323 Ga0395901_0034564
324 Ga0395901_0057552
325 Ga0395901_0178080
326 Ga0395901_0248347
327 Ga0395901_0302906
328 Ga0395901_0339753
329 Ga0466965_0059169
330 Ga0466966_0055390
331 Ga0466961_0004773
332 Ga0466963_0001732
333 Ga0466963_0010157
334 Ga0466963_0011935
335 Ga0466963_0043062
336 Ga0466963_0050952
337 Ga0466963_0108111
338 Ga0466964_0004622
339 Ga0466964_0004654
340 Ga0466964_0073999
341 Ga0466964_0117349
342 Ga0466957_0002085
343 Ga0466957_0035614
344 Ga0466957_0046064
345 Ga0466960_0054889
346 Ga0466959_0016801
347 Ga0466959_0025819
348 Ga0466958_0002164
349 Ga0466958_0006624
350 Ga0466958_0079432
351 Ga0466967_0001236
352 Ga0466967_0009441
353 Ga0466967_0019897
354 Ga0466967_0043693
355 Ga0466967_0080087
356 Ga0495627_029644
357 Ga0495592_0012708
358 Ga0495592_0052487
359 Ga0495603_0024854
360 Ga0495641_0011680
361 Ga0495641_0035007
362 Ga0495641_0056236
363 Ga0495641_0104619
364 Ga0495651_0112799
365 Ga0495653_0044797
366 Ga0495582_0062929
367 Ga0495582_0176998
368 Ga0495639_0001088
369 Ga0495662_0003188
370 Ga0495664_0151114
371 Ga0495584_0018224
372 Ga0495608_0138304
373 Ga0495618_0044215
374 Ga0495628_0028880
375 Ga0495630_0006658
376 Ga0495666_0000606
377 Ga0495652_0040624
378 Ga0495652_0041211
379 Ga0495665_0040028
380 Ga0495640_0051789
381 Ga0495640_0208689
382 Ga0495586_0007422
383 Ga0495587_0011842
384 Ga0495645_0094798
385 Ga0495667_0084492
386 Ga0495656_0123394
387 Ga0495634_0038876
388 Ga0495634_0156004
389 Ga0495635_0180351
390 Ga0495647_0000242
391 Ga0495669_0196593
392 Ga0495624_0011042
393 Ga0495624_0016442
394 Ga0495589_0186274
395 Ga0495581_0014330
396 Ga0495604_0015169
397 Ga0495674_0058362
398 Ga0495676_0016971
399 Ga0495676_0054805
400 Ga0495676_0068445
401 Ga0495680_0070397
402 Ga0495684_0002199
403 Ga0495684_0009136
404 Ga0495593_0000299
405 Ga0496100_0219636
406 Ga0496101_0276220
407 Ga0496102_0008572
408 Ga0496103_0064525
409 Ga0496104_0153075
410 Ga0496106_0005956
411 Ga0496106_0074212
412 Ga0496107_0000956
413 Ga0496109_0024789
414 Ga0496109_0095555
415 Ga0496110_0073151
416 Ga0496110_0641436
417 Ga0496111_0213873
418 Ga0496112_0018199
419 Ga0496112_0052362
420 Ga0496112_0055185
421 Ga0496112_0165414
422 Ga0496112_0257175
423 Ga0496113_0061458
424 Ga0496113_0110621
425 Ga0496114_0082559
426 nmdc:mga05p37_31321_c1
427 nmdc:mga0n895_79359_c1
428 Ga0495601_0148136
429 Ga0495612_0006597
430 Ga0495612_0059731
431 Ga0495619_0011169
432 Ga0495619_0161422
433 Ga0495619_0235014
434 Ga0466962_0020368
435 Ga0466962_0092371
436 Ga0466962_0096461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

17

340

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n2t-assembly1.cif.gz_B c-des mutant k223a with gly covalenty linked to the plp-cofactor 0.9196 7 352
1elu-assembly1.cif.gz_B complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide. 0.9139 9 352
1n2t-assembly1.cif.gz_B c-des mutant k223a with gly covalenty linked to the plp-cofactor 0.8997 7 352
1elu-assembly1.cif.gz_B complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide. 0.8892 9 352
6wci-assembly1.cif.gz_B crystal structure of a cysteine desulfurase sufs from stenotrophomonas maltophilia k279a 0.8727 1 351
ID Description Score Start End Superfamily
1elqB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8945 29 265 3.40.640.10
af_Q60358_310_394_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8776 271 352 3.90.1150.10
1wytA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8772 271 352 3.90.1150.10
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8713 31 261 3.40.640.10
af_Q5JNT6_87_306_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8657 52 224 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A538LKW9-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9872 1 351 GO:0008483
AF-A0A538HFL2-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9803 1 219 GO:0008483
AF-A0A538M0X6-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9798 1 350 GO:0008483
AF-A0A538LKW9-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9761 1 351 GO:0008483
AF-A0A7W0JN85-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9736 85 353 GO:0008483

Map