F330284

General Info

Members Datasets Scaffolds Average Seq Length
218 153 430 326

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0027253|Ga0466967_0027253_3348_4388
Length 346
Sequence MWTVVSARILHDRMKTMTTSVAAHRTTALRRAGVRATLAPSVHNTQPWRFVLSADQLRIYADRSRQLHVLDPTGRQLTISCGCALMNARVSLAGDGLDVTVERFPVADQPDLLARIRPTFGASSPAEGLAVLDHVLEIRQTNRRHFTGAEVPEEVLDVLEQAAAAEDSELYVIRDEATRLSVAALSQHADAIENLNPAYRAELRAWTTDDPGRRDGVPNLAVPHVDGTADDEVPIRDFDTRGTGGLPAATRSSKDQCLVLLCTRGDSPADWLRGGEALERVLLEITRHGFVASPLTQVTEVPSARAQLRRQLGMTAFPHVLLRIGRAPIAPQSRRRRLVEVLSEEA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
98 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.09
Rhizosphere 86.7
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0027253 3300045976 Bacteria 4750
2 Ga0070658_10143873 3300005327 Bacteria 1993
3 Ga0070690_100102677 3300005330 Bacteria 1897
4 Ga0070666_10019145 3300005335 Bacteria 4416
5 Ga0070682_100037620 3300005337 Bacteria 2964
6 Ga0070660_100097036 3300005339 Bacteria 2331
7 Ga0070660_100221506 3300005339 Unclassified 1538
8 Ga0070692_10007963 3300005345 Bacteria 4700
9 Ga0070668_100024160 3300005347 Bacteria 4603
10 Ga0070668_100121837 3300005347 Bacteria 2085
11 Ga0070669_100083043 3300005353 Bacteria 2389
12 Ga0070671_100034745 3300005355 Bacteria 4174
13 Ga0070659_100054636 3300005366 Bacteria 3145
14 Ga0070667_100055994 3300005367 Bacteria 3330
15 Ga0070667_100097531 3300005367 Bacteria 2536
16 Ga0070714_100000008 3300005435 Bacteria 278734
17 Ga0070700_100278530 3300005441 Bacteria 1212
18 Ga0070663_100182558 3300005455 Bacteria 1629
19 Ga0070684_100280431 3300005535 Bacteria 1527
20 Ga0068853_100043539 3300005539 Bacteria 3841
21 Ga0070686_100067045 3300005544 Bacteria 2336
22 Ga0070665_100020781 3300005548 Bacteria 6598
23 Ga0070665_100433410 3300005548 Bacteria 1324
24 Ga0070704_100045421 3300005549 Bacteria 3056
25 Ga0068855_100015000 3300005563 Bacteria 9332
26 Ga0068855_100034220 3300005563 Bacteria 6060
27 Ga0068855_100085220 3300005563 Bacteria 3657
28 Ga0068855_100183845 3300005563 Bacteria 2362
29 Ga0068855_100336917 3300005563 Bacteria 1664
30 Ga0070664_100226534 3300005564 Bacteria 1674
31 Ga0068857_100069248 3300005577 Unclassified 3142
32 Ga0068854_100184756 3300005578 Bacteria 1630
33 Ga0068856_100064657 3300005614 Bacteria 3615
34 Ga0068856_100105123 3300005614 Bacteria 2817
35 Ga0070702_100008065 3300005615 Bacteria 5084
36 Ga0068852_100570302 3300005616 Bacteria 1134
37 Ga0068859_100002765 3300005617 Bacteria 17784
38 Ga0068859_100003454 3300005617 Bacteria 16063
39 Ga0068866_10076234 3300005718 Bacteria 1788
40 Ga0068861_100033105 3300005719 Bacteria 3811
41 Ga0068870_10056381 3300005840 Bacteria 2097
42 Ga0068863_100001131 3300005841 Bacteria 26659
43 Ga0068858_100018553 3300005842 Bacteria 6513
44 Ga0068858_100317874 3300005842 Bacteria 1487
45 Ga0068860_100000767 3300005843 Bacteria 36120
46 Ga0068860_100509232 3300005843 Bacteria 1202
47 Ga0081455_10007337 3300005937 Bacteria 11627
48 Ga0081455_10023348 3300005937 Bacteria 5757
49 Ga0070717_10033615 3300006028 Bacteria 4137
50 Ga0070716_100097175 3300006173 Bacteria 1797
51 Ga0068871_100179549 3300006358 Bacteria 1818
52 Ga0075434_100077176 3300006871 Bacteria 3326
53 Ga0097620_100002765 3300006931 Bacteria 17784
54 Ga0097620_100003454 3300006931 Bacteria 16063
55 Ga0105240_10041070 3300009093 Bacteria 5908
56 Ga0105240_10107451 3300009093 Bacteria 3383
57 Ga0105240_10112392 3300009093 Bacteria 3293
58 Ga0105240_10169743 3300009093 Bacteria 2585
59 Ga0105240_10341916 3300009093 Bacteria 1700
60 Ga0105240_10607411 3300009093 Bacteria 1203
61 Ga0111539_10352115 3300009094 Bacteria 1714
62 Ga0105245_10038034 3300009098 Bacteria 4279
63 Ga0105245_10151341 3300009098 Bacteria 2194
64 Ga0105247_10004806 3300009101 Bacteria 8598
65 Ga0105247_10007712 3300009101 Bacteria 6586
66 Ga0105247_10085605 3300009101 Bacteria 1993
67 Ga0105243_10370262 3300009148 Bacteria 1321
68 Ga0105241_10086618 3300009174 Bacteria 2464
69 Ga0105248_10061555 3300009177 Bacteria 4215
70 Ga0105248_10732367 3300009177 Unclassified 1116
71 Ga0105237_10050526 3300009545 Bacteria 4178
72 Ga0105237_10164943 3300009545 Bacteria 2214
73 Ga0105238_10131797 3300009551 Bacteria 2478
74 Ga0105238_10189931 3300009551 Bacteria 2030
75 Ga0105238_10250788 3300009551 Bacteria 1748
76 Ga0105239_10078026 3300010375 Bacteria 3645
77 Ga0105239_10168231 3300010375 Bacteria 2451
78 Ga0105246_10088773 3300011119 Bacteria 2222
79 Ga0157370_10076496 3300013104 Bacteria 3153
80 Ga0157370_10100806 3300013104 Bacteria 2705
81 Ga0157370_10236645 3300013104 Bacteria 1690
82 Ga0157369_10107373 3300013105 Bacteria 2969
83 Ga0157374_10008615 3300013296 Bacteria 8725
84 Ga0157374_10412530 3300013296 Bacteria 1348
85 Ga0157378_10182932 3300013297 Bacteria 1973
86 Ga0163162_10030123 3300013306 Bacteria 5375
87 Ga0157372_10000132 3300013307 Bacteria 82054
88 Ga0157372_10065744 3300013307 Bacteria 4072
89 Ga0157375_10098959 3300013308 Bacteria 2994
90 Ga0157379_10043081 3300014968 Bacteria 4030
91 Ga0163161_10013809 3300017792 Bacteria 5625
92 Ga0206353_10039200 3300020082 Unclassified 1653
93 Ga0224712_10028818 3300022467 Bacteria 1988
94 Ga0207710_10005422 3300025900 Bacteria 5494
95 Ga0207688_10021395 3300025901 Bacteria 3533
96 Ga0207680_10163513 3300025903 Bacteria 1494
97 Ga0207647_10030351 3300025904 Bacteria 3488
98 Ga0207654_10052324 3300025911 Bacteria 2353
99 Ga0207695_10080616 3300025913 Bacteria 3295
100 Ga0207695_10142801 3300025913 Bacteria 2340
101 Ga0207695_10359366 3300025913 Bacteria 1343
102 Ga0207695_10405694 3300025913 Bacteria 1247
103 Ga0207662_10031190 3300025918 Bacteria 3096
104 Ga0207657_10017912 3300025919 Bacteria 6777
105 Ga0207694_10093423 3300025924 Bacteria 2376
106 Ga0207694_10145461 3300025924 Bacteria 1908
107 Ga0207687_10053597 3300025927 Bacteria 2818
108 Ga0207700_10021332 3300025928 Bacteria 4420
109 Ga0207664_10000002 3300025929 Bacteria 657053
110 Ga0207644_10040135 3300025931 Bacteria 3307
111 Ga0207690_10212957 3300025932 Bacteria 1474
112 Ga0207706_10008795 3300025933 Bacteria 9296
113 Ga0207665_10007324 3300025939 Bacteria 7301
114 Ga0207711_10527916 3300025941 Unclassified 1101
115 Ga0207679_10380129 3300025945 Bacteria 1238
116 Ga0207667_10071374 3300025949 Bacteria 3611
117 Ga0207667_10080674 3300025949 Bacteria 3371
118 Ga0207667_10108052 3300025949 Bacteria 2870
119 Ga0207712_10007897 3300025961 Bacteria 6722
120 Ga0207703_10013971 3300026035 Bacteria 6259
121 Ga0207639_10350070 3300026041 Bacteria 1319
122 Ga0207678_10007538 3300026067 Bacteria 9617
123 Ga0207702_10045928 3300026078 Bacteria 3676
124 Ga0207641_10001260 3300026088 Bacteria 25231
125 Ga0207641_10463016 3300026088 Bacteria 1227
126 Ga0207675_100090910 3300026118 Bacteria 2870
127 Ga0207683_10096655 3300026121 Bacteria 2634
128 Ga0268266_10001159 3300028379 Bacteria 32594
129 Ga0268266_10053104 3300028379 Bacteria 3481
130 Ga0268264_10000147 3300028381 Bacteria 164790
131 Ga0307406_10012057 3300031901 Bacteria 4917
132 Ga0307407_10011431 3300031903 Bacteria 4225
133 Ga0307409_100029019 3300031995 Bacteria 3952
134 Ga0307416_100015807 3300032002 Bacteria 5224
135 Ga0307411_10091177 3300032005 Bacteria 2128
136 Ga0373940_0014326 3300035088 Bacteria 1933
137 Ga0373951_0038710 3300035091 Bacteria 1144
138 Ga0373941_0009002 3300035115 Bacteria 2503
139 Ga0373942_0039655 3300035207 Bacteria 1282
140 Ga0373931_0036482 3300035691 Bacteria 2562
141 Ga0466972_0036266 3300044658 Bacteria 2413
142 Ga0466965_0019157 3300044683 Bacteria 3286
143 Ga0466965_0069402 3300044683 Bacteria 1771
144 Ga0466966_0199977 3300044684 Bacteria 1209
145 Ga0466961_0158949 3300044693 Bacteria 1409
146 Ga0466961_0169161 3300044693 Bacteria 1360
147 Ga0466963_0010926 3300044694 Bacteria 5515
148 Ga0466963_0011245 3300044694 Bacteria 5447
149 Ga0466963_0085324 3300044694 Bacteria 2143
150 Ga0466971_0031274 3300044719 Bacteria 2383
151 Ga0466970_0019596 3300044765 Bacteria 3508
152 Ga0466957_0089548 3300044842 Bacteria 1926
153 Ga0466959_0004336 3300045049 Bacteria 9480
154 Ga0466958_0015745 3300045836 Bacteria 4341
155 Ga0466958_0060873 3300045836 Bacteria 2299
156 Ga0466958_0237127 3300045836 Bacteria 1165
157 Ga0466967_0014617 3300045976 Bacteria 6123
158 Ga0466967_0041864 3300045976 Bacteria 3953
159 Ga0466967_0159491 3300045976 Bacteria 2116
160 Ga0495639_0091872 3300046475 Bacteria 1425
161 Ga0496100_0352431 3300048903 Bacteria 1112
162 Ga0496101_0124733 3300048904 Bacteria 1950
163 Ga0496102_0000044 3300048905 Bacteria 187834
164 Ga0496102_0000378 3300048905 Bacteria 53414
165 Ga0496102_0029210 3300048905 Bacteria 4932
166 Ga0496102_0072361 3300048905 Bacteria 3168
167 Ga0496102_0259764 3300048905 Bacteria 1637
168 Ga0496103_0000123 3300048906 Bacteria 83794
169 Ga0496103_0037288 3300048906 Bacteria 2978
170 Ga0496103_0078117 3300048906 Bacteria 2078
171 Ga0496103_0100346 3300048906 Bacteria 1832
172 Ga0496103_0199548 3300048906 Unclassified 1286
173 Ga0496104_0174679 3300048907 Bacteria 2059
174 Ga0496105_0115003 3300048908 Bacteria 2219
175 Ga0496109_0449950 3300048912 Bacteria 1216
176 Ga0496110_0038402 3300048913 Bacteria 4166
177 Ga0496111_0057758 3300048914 Bacteria 2809
178 Ga0496113_0000814 3300048916 Bacteria 16232
179 Ga0496113_0003253 3300048916 Bacteria 9689
180 Ga0496113_0096191 3300048916 Bacteria 2289
181 Ga0496114_0068255 3300048917 Bacteria 2985
182 Ga0496118_0003272 3300048921 Bacteria 20622
183 Ga0496119_0000305 3300048922 Bacteria 68548
184 Ga0496119_0037427 3300048922 Bacteria 3151
185 Ga0496120_0006093 3300048923 Bacteria 9353
186 Ga0496120_0011362 3300048923 Bacteria 6125
187 Ga0496121_0024755 3300048924 Bacteria 5727
188 Ga0496126_0048490 3300048929 Bacteria 3881
189 Ga0501031_0001048 3300049568 Bacteria 16785
190 Ga0501032_0000955 3300049569 Bacteria 23363
191 Ga0501033_0001191 3300049570 Bacteria 23501
192 Ga0501034_0002839 3300049571 Bacteria 20187
193 Ga0501036_0003718 3300049572 Bacteria 12231
194 Ga0501037_0000344 3300049573 Bacteria 39209
195 Ga0501037_0134300 3300049573 Bacteria 1773
196 Ga0501038_0000195 3300049574 Bacteria 52526
197 Ga0501039_0000355 3300049575 Bacteria 32637
198 Ga0501042_0049939 3300049578 Bacteria 2984
199 Ga0501043_0002157 3300049579 Bacteria 16786
200 Ga0501046_0001615 3300049580 Bacteria 21554
201 Ga0501047_0001634 3300049581 Bacteria 21880
202 Ga0501047_0175851 3300049581 Bacteria 2008
203 Ga0501048_0000709 3300049582 Bacteria 24346
204 Ga0501067_0007944 3300049583 Bacteria 5893
205 Ga0501068_0004860 3300049584 Bacteria 7318
206 Ga0501070_0001006 3300049586 Bacteria 25283
207 Ga0501071_0026249 3300049587 Bacteria 4087
208 Ga0501073_0000569 3300049589 Bacteria 26046
209 Ga0501074_0003518 3300049590 Bacteria 11116
210 Ga0501080_0010337 3300049742 Bacteria 8535
211 Ga0501035_0005521 3300049822 Bacteria 11950
212 Ga0501044_0011056 3300049823 Bacteria 9790
213 nmdc:mga0n895_222616_c1 3300050512 Bacteria 1916
214 Ga0501084_0002679 3300054114 Bacteria 14335
215 Ga0466962_0007126 3300061719 Bacteria 5356
216 Ga0466967_0027253
217 Ga0070658_10143873
218 Ga0070690_100102677
219 Ga0070666_10019145
220 Ga0070682_100037620
221 Ga0070660_100097036
222 Ga0070660_100221506
223 Ga0070692_10007963
224 Ga0070668_100024160
225 Ga0070668_100121837
226 Ga0070669_100083043
227 Ga0070671_100034745
228 Ga0070659_100054636
229 Ga0070667_100055994
230 Ga0070667_100097531
231 Ga0070714_100000008
232 Ga0070700_100278530
233 Ga0070663_100182558
234 Ga0070684_100280431
235 Ga0068853_100043539
236 Ga0070686_100067045
237 Ga0070665_100020781
238 Ga0070665_100433410
239 Ga0070704_100045421
240 Ga0068855_100015000
241 Ga0068855_100034220
242 Ga0068855_100085220
243 Ga0068855_100183845
244 Ga0068855_100336917
245 Ga0070664_100226534
246 Ga0068857_100069248
247 Ga0068854_100184756
248 Ga0068856_100064657
249 Ga0068856_100105123
250 Ga0070702_100008065
251 Ga0068852_100570302
252 Ga0068859_100002765
253 Ga0068859_100003454
254 Ga0068866_10076234
255 Ga0068861_100033105
256 Ga0068870_10056381
257 Ga0068863_100001131
258 Ga0068858_100018553
259 Ga0068858_100317874
260 Ga0068860_100000767
261 Ga0068860_100509232
262 Ga0081455_10007337
263 Ga0081455_10023348
264 Ga0070717_10033615
265 Ga0070716_100097175
266 Ga0068871_100179549
267 Ga0075434_100077176
268 Ga0097620_100002765
269 Ga0097620_100003454
270 Ga0105240_10041070
271 Ga0105240_10107451
272 Ga0105240_10112392
273 Ga0105240_10169743
274 Ga0105240_10341916
275 Ga0105240_10607411
276 Ga0111539_10352115
277 Ga0105245_10038034
278 Ga0105245_10151341
279 Ga0105247_10004806
280 Ga0105247_10007712
281 Ga0105247_10085605
282 Ga0105243_10370262
283 Ga0105241_10086618
284 Ga0105248_10061555
285 Ga0105248_10732367
286 Ga0105237_10050526
287 Ga0105237_10164943
288 Ga0105238_10131797
289 Ga0105238_10189931
290 Ga0105238_10250788
291 Ga0105239_10078026
292 Ga0105239_10168231
293 Ga0105246_10088773
294 Ga0157370_10076496
295 Ga0157370_10100806
296 Ga0157370_10236645
297 Ga0157369_10107373
298 Ga0157374_10008615
299 Ga0157374_10412530
300 Ga0157378_10182932
301 Ga0163162_10030123
302 Ga0157372_10000132
303 Ga0157372_10065744
304 Ga0157375_10098959
305 Ga0157379_10043081
306 Ga0163161_10013809
307 Ga0206353_10039200
308 Ga0224712_10028818
309 Ga0207710_10005422
310 Ga0207688_10021395
311 Ga0207680_10163513
312 Ga0207647_10030351
313 Ga0207654_10052324
314 Ga0207695_10080616
315 Ga0207695_10142801
316 Ga0207695_10359366
317 Ga0207695_10405694
318 Ga0207662_10031190
319 Ga0207657_10017912
320 Ga0207694_10093423
321 Ga0207694_10145461
322 Ga0207687_10053597
323 Ga0207700_10021332
324 Ga0207664_10000002
325 Ga0207644_10040135
326 Ga0207690_10212957
327 Ga0207706_10008795
328 Ga0207665_10007324
329 Ga0207711_10527916
330 Ga0207679_10380129
331 Ga0207667_10071374
332 Ga0207667_10080674
333 Ga0207667_10108052
334 Ga0207712_10007897
335 Ga0207703_10013971
336 Ga0207639_10350070
337 Ga0207678_10007538
338 Ga0207702_10045928
339 Ga0207641_10001260
340 Ga0207641_10463016
341 Ga0207675_100090910
342 Ga0207683_10096655
343 Ga0268266_10001159
344 Ga0268266_10053104
345 Ga0268264_10000147
346 Ga0307406_10012057
347 Ga0307407_10011431
348 Ga0307409_100029019
349 Ga0307416_100015807
350 Ga0307411_10091177
351 Ga0373940_0014326
352 Ga0373951_0038710
353 Ga0373941_0009002
354 Ga0373942_0039655
355 Ga0373931_0036482
356 Ga0466972_0036266
357 Ga0466965_0019157
358 Ga0466965_0069402
359 Ga0466966_0199977
360 Ga0466961_0158949
361 Ga0466961_0169161
362 Ga0466963_0010926
363 Ga0466963_0011245
364 Ga0466963_0085324
365 Ga0466971_0031274
366 Ga0466970_0019596
367 Ga0466957_0089548
368 Ga0466959_0004336
369 Ga0466958_0015745
370 Ga0466958_0060873
371 Ga0466958_0237127
372 Ga0466967_0014617
373 Ga0466967_0041864
374 Ga0466967_0159491
375 Ga0495639_0091872
376 Ga0496100_0352431
377 Ga0496101_0124733
378 Ga0496102_0000044
379 Ga0496102_0000378
380 Ga0496102_0029210
381 Ga0496102_0072361
382 Ga0496102_0259764
383 Ga0496103_0000123
384 Ga0496103_0037288
385 Ga0496103_0078117
386 Ga0496103_0100346
387 Ga0496103_0199548
388 Ga0496104_0174679
389 Ga0496105_0115003
390 Ga0496109_0449950
391 Ga0496110_0038402
392 Ga0496111_0057758
393 Ga0496113_0000814
394 Ga0496113_0003253
395 Ga0496113_0096191
396 Ga0496114_0068255
397 Ga0496118_0003272
398 Ga0496119_0000305
399 Ga0496119_0037427
400 Ga0496120_0006093
401 Ga0496120_0011362
402 Ga0496121_0024755
403 Ga0496126_0048490
404 Ga0501031_0001048
405 Ga0501032_0000955
406 Ga0501033_0001191
407 Ga0501034_0002839
408 Ga0501036_0003718
409 Ga0501037_0000344
410 Ga0501037_0134300
411 Ga0501038_0000195
412 Ga0501039_0000355
413 Ga0501042_0049939
414 Ga0501043_0002157
415 Ga0501046_0001615
416 Ga0501047_0001634
417 Ga0501047_0175851
418 Ga0501048_0000709
419 Ga0501067_0007944
420 Ga0501068_0004860
421 Ga0501070_0001006
422 Ga0501071_0026249
423 Ga0501073_0000569
424 Ga0501074_0003518
425 Ga0501080_0010337
426 Ga0501035_0005521
427 Ga0501044_0011056
428 nmdc:mga0n895_222616_c1
429 Ga0501084_0002679
430 Ga0466962_0007126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ymv-assembly1.cif.gz_A structure of reduced m smegmatis 5246, a homologue of m.tuberculosis acg 0.8529 13 329
2ymv-assembly1.cif.gz_A structure of reduced m smegmatis 5246, a homologue of m.tuberculosis acg 0.8256 13 329
3gb5-assembly1.cif.gz_A-2 crystal structure of mus musculus iodotyrosine deiodinase (iyd) bound to fmn 0.7221 114 325
3m5k-assembly1.cif.gz_B crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution 0.6982 115 329
3kwk-assembly1.cif.gz_A-2 crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (np_809094.1) from bacteroides thetaiotaomicron vpi-5482 at 1.54 a resolution 0.6974 115 320
ID Description Score Start End Superfamily
af_P9WL07_1_99_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8927 15 108 3.40.109.10
af_P9WIZ7_118_336_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8675 114 327 3.40.109.10
af_P9WL07_1_99_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8421 15 108 3.40.109.10
af_P9WIZ7_118_336_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8414 114 327 3.40.109.10
af_P95233_1_116_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8306 13 112 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A1G8TXZ4-F1-model_v4 Nitroreductase family protein 0.9746 8 329 GO:0016491
AF-A0A6P0GG74-F1-model_v4 Nitroreductase 0.9722 11 327 GO:0016491
AF-A0A7G7LF29-F1-model_v4 Nitroreductase 0.9679 8 327 GO:0016491
AF-F5XMY1-F1-model_v4 Uncharacterized protein 0.9586 1 329 GO:0016491
AF-A0A161LLR8-F1-model_v4 Nitroreductase 0.9576 5 160 GO:0016491

Map