F330126

General Info

Members Datasets Scaffolds Average Seq Length
218 133 212 231

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10103094|Ga0307516_101030942
Length 260
Sequence MIRSIALDDQPPALQILTHFCSRIEFIDLQQTFTRTGEALTYLQTHPVDLLILDINMPAISGIDFYKALPQKIMVIFTTAYSEYAVEGFALNAIDYLLKPFSFARFQQAAAKALEYQTFSRLAANPPQHLSPGDPGYLLPQSPIPGSIPGSDDVSGSLQHMLLRADYGFVRVTLTDILFIEGLDNYLRIHLQGQDTLIIRITMKALLEKLPPKDFIRVHRSYIVPLGRVANVRNKTITVAGREIPLGARYEEDFYKAFKD

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
5 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
119 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
120 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
121 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
122 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
123 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
124 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
125 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
126 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
127 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
128 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
129 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
132 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
133 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.02
Nodule 0
Rhizoplane 0.46
Rhizosphere 66.97
Stem 0
Stem Tuber 0
Unclassified 10.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10013983 3300003215 Bacteria 3365
2 rootH2_10044553 3300003320 Bacteria 4167
3 rootL2_10074450 3300003322 Bacteria 9817
4 rootL2_10125271 3300003322 Bacteria 7100
5 rootL2_10337020 3300003322 Bacteria 2039
6 rootH1_10026846 3300003323 Bacteria 16244
7 rootH1_10280354 3300003323 Bacteria 1050
8 JGI25160J50197_1000950 3300003354 Bacteria 15200
9 JGI25160J50197_1002374 3300003354 Bacteria 8792
10 JGI25404J52841_10017525 3300003659 Bacteria 1553
11 Ga0055526_1005639 3300003771 Bacteria 7122
12 Ga0055526_1023576 3300003771 Bacteria 2049
13 Ga0055528_1000359 3300003790 Bacteria 37077
14 Ga0055531_10008195 3300003794 Bacteria 5562
15 Ga0065165_1000112 3300005262 Bacteria 135988
16 Ga0065714_10091912 3300005288 Bacteria 1895
17 Ga0070683_100024629 3300005329 Bacteria 5393
18 Ga0068869_100005814 3300005334 Bacteria 7786
19 Ga0068869_100040647 3300005334 Bacteria 3326
20 Ga0070666_10000028 3300005335 Bacteria 144796
21 Ga0070666_10000135 3300005335 Bacteria 51126
22 Ga0068868_100471852 3300005338 Unclassified 1095
23 Ga0070668_100113548 3300005347 Unclassified 2158
24 Ga0070671_100053416 3300005355 Bacteria 3359
25 Ga0070671_100189500 3300005355 Bacteria 1743
26 Ga0070688_100230685 3300005365 Bacteria 1309
27 Ga0070667_100005250 3300005367 Bacteria 10829
28 Ga0070667_100066441 3300005367 Unclassified 3064
29 Ga0070685_10257806 3300005466 Bacteria 1158
30 Ga0068853_100374175 3300005539 Bacteria 1329
31 Ga0070665_100000006 3300005548 Bacteria 718034
32 Ga0070665_100239936 3300005548 Bacteria 1813
33 Ga0070664_100091872 3300005564 Bacteria 2628
34 Ga0068852_100009548 3300005616 Bacteria 7210
35 Ga0068859_100000127 3300005617 Bacteria 72136
36 Ga0068859_100000131 3300005617 Bacteria 70847
37 Ga0068864_100068887 3300005618 Bacteria 3075
38 Ga0068864_100096053 3300005618 Unclassified 2622
39 Ga0068851_10040138 3300005834 Bacteria 2352
40 Ga0068863_100000404 3300005841 Bacteria 43876
41 Ga0068863_100096514 3300005841 Unclassified 2806
42 Ga0068858_100008556 3300005842 Bacteria 9832
43 Ga0068858_100012879 3300005842 Bacteria 7887
44 Ga0068858_100433378 3300005842 Bacteria 1265
45 Ga0068860_100005139 3300005843 Bacteria 13310
46 Ga0068860_100007152 3300005843 Bacteria 11164
47 Ga0068860_100715893 3300005843 Bacteria 1011
48 Ga0068862_100674207 3300005844 Unclassified 999
49 Ga0081455_10279209 3300005937 Bacteria 1207
50 Ga0081540_1001717 3300005983 Bacteria 18541
51 Ga0075366_10090851 3300006195 Bacteria 1829
52 Ga0097621_100005399 3300006237 Bacteria 9008
53 Ga0097621_100016995 3300006237 Bacteria 5516
54 Ga0097621_100018159 3300006237 Bacteria 5364
55 Ga0068871_100020547 3300006358 Bacteria 5061
56 Ga0068871_100149069 3300006358 Bacteria 1994
57 Ga0068871_100319512 3300006358 Bacteria 1367
58 Ga0068865_100085022 3300006881 Bacteria 2281
59 Ga0068865_100109401 3300006881 Unclassified 2036
60 Ga0068865_100204102 3300006881 Unclassified 1536
61 Ga0097620_100000127 3300006931 Bacteria 72136
62 Ga0097620_100000131 3300006931 Bacteria 70847
63 Ga0105245_10151603 3300009098 Eukaryota 2193
64 Ga0105245_10319550 3300009098 Unclassified 1529
65 Ga0105245_10904454 3300009098 Bacteria 924
66 Ga0105247_10004532 3300009101 Bacteria 8858
67 Ga0105241_10000995 3300009174 Bacteria 21469
68 Ga0105241_10004111 3300009174 Bacteria 10742
69 Ga0105241_10070858 3300009174 Bacteria 2705
70 Ga0105241_10084017 3300009174 Bacteria 2499
71 Ga0105242_10115275 3300009176 Bacteria 2297
72 Ga0105248_10318613 3300009177 Bacteria 1751
73 Ga0105237_10005746 3300009545 Bacteria 13937
74 Ga0105237_10006279 3300009545 Bacteria 13220
75 Ga0105237_10024175 3300009545 Bacteria 6217
76 Ga0105249_10001788 3300009553 Bacteria 18716
77 Ga0105249_10005206 3300009553 Bacteria 11225
78 Ga0105239_10011194 3300010375 Bacteria 10011
79 Ga0105239_10111914 3300010375 Bacteria 3027
80 Ga0105239_10162201 3300010375 Bacteria 2498
81 Ga0105239_10357010 3300010375 Bacteria 1650
82 Ga0105246_10003195 3300011119 Bacteria 9955
83 Ga0157371_10065567 3300013102 Bacteria 2572
84 Ga0157369_10056199 3300013105 Bacteria 4247
85 Ga0157374_10082053 3300013296 Bacteria 3061
86 Ga0157374_10180091 3300013296 Bacteria 2064
87 Ga0157374_10732434 3300013296 Unclassified 1003
88 Ga0157378_10029276 3300013297 Bacteria 4861
89 Ga0157378_10065205 3300013297 Bacteria 3260
90 Ga0157378_10155328 3300013297 Unclassified 2135
91 Ga0157378_10174071 3300013297 Bacteria 2021
92 Ga0157378_10368531 3300013297 Bacteria 1407
93 Ga0163162_10000592 3300013306 Bacteria 33661
94 Ga0163162_10002598 3300013306 Bacteria 17110
95 Ga0163162_10004053 3300013306 Bacteria 14058
96 Ga0163162_10837375 3300013306 Unclassified 1036
97 Ga0157372_10365072 3300013307 Bacteria 1682
98 Ga0157375_10173641 3300013308 Bacteria 2304
99 Ga0157375_10233262 3300013308 Unclassified 1999
100 Ga0163163_10894551 3300014325 Unclassified 951
101 Ga0157380_10000012 3300014326 Bacteria 131332
102 Ga0157380_10462363 3300014326 Bacteria 1222
103 Ga0157379_10006888 3300014968 Bacteria 9828
104 Ga0157376_10013273 3300014969 Bacteria 6144
105 Ga0157376_10026741 3300014969 Bacteria 4563
106 Ga0157376_10144937 3300014969 Unclassified 2135
107 Ga0157376_10192501 3300014969 Bacteria 1871
108 Ga0182005_1000100 3300015265 Bacteria 65235
109 Ga0182005_1000353 3300015265 Bacteria 25823
110 Ga0209436_102060 3300025208 Bacteria 6326
111 Ga0209673_1000096 3300025273 Bacteria 194819
112 Ga0209673_1026385 3300025273 Bacteria 1909
113 Ga0209564_1001415 3300025295 Bacteria 24742
114 Ga0209564_1002199 3300025295 Bacteria 16300
115 Ga0209758_1001132 3300025297 Bacteria 34267
116 Ga0209758_1017005 3300025297 Bacteria 3653
117 Ga0209050_1000207 3300025298 Bacteria 131328
118 Ga0209050_1008745 3300025298 Bacteria 5330
119 Ga0209050_1020860 3300025298 Bacteria 2417
120 Ga0207426_1000023 3300025302 Bacteria 545465
121 Ga0207426_1000699 3300025302 Bacteria 39800
122 Ga0209257_1001870 3300025304 Bacteria 22825
123 Ga0207656_10152604 3300025321 Bacteria 1095
124 Ga0207680_10000057 3300025903 Bacteria 50978
125 Ga0207680_10000220 3300025903 Bacteria 27508
126 Ga0207654_10003472 3300025911 Bacteria 7969
127 Ga0207654_10010731 3300025911 Bacteria 4664
128 Ga0207671_10002264 3300025914 Bacteria 20830
129 Ga0207671_10003351 3300025914 Bacteria 16075
130 Ga0207687_10137167 3300025927 Bacteria 1851
131 Ga0207644_10051409 3300025931 Bacteria 2958
132 Ga0207644_10075192 3300025931 Bacteria 2482
133 Ga0207704_10058232 3300025938 Unclassified 2378
134 Ga0207689_10000726 3300025942 Bacteria 31638
135 Ga0207689_10004672 3300025942 Bacteria 12365
136 Ga0207689_10123321 3300025942 Unclassified 2131
137 Ga0207689_10311791 3300025942 Unclassified 1305
138 Ga0207661_10032174 3300025944 Bacteria 4061
139 Ga0207712_10003559 3300025961 Bacteria 9828
140 Ga0207712_10006662 3300025961 Bacteria 7289
141 Ga0207668_10097593 3300025972 Unclassified 2175
142 Ga0207668_10485570 3300025972 Bacteria 1060
143 Ga0207658_10029321 3300025986 Bacteria 3885
144 Ga0207677_10343612 3300026023 Bacteria 1248
145 Ga0207703_10010415 3300026035 Bacteria 7274
146 Ga0207639_10340986 3300026041 Bacteria 1336
147 Ga0207641_10000229 3300026088 Bacteria 72315
148 Ga0207641_10001539 3300026088 Bacteria 22567
149 Ga0207676_10051794 3300026095 Unclassified 3206
150 Ga0207676_10150359 3300026095 Bacteria 2004
151 Ga0207698_10001760 3300026142 Bacteria 12629
152 Ga0268266_10000010 3300028379 Bacteria 1030233
153 Ga0268264_10003340 3300028381 Bacteria 13869
154 Ga0268264_10005391 3300028381 Bacteria 10829
155 Ga0307515_10000001 3300028794 Bacteria 4259510
156 Ga0307515_10003094 3300028794 Bacteria 35226
157 Ga0265338_10073982 3300028800 Bacteria 2901
158 Ga0307511_10001468 3300030521 Bacteria 24941
159 Ga0265331_10111166 3300031250 Bacteria 1257
160 Ga0265327_10000262 3300031251 Bacteria 104119
161 Ga0307513_10086886 3300031456 Unclassified 3204
162 Ga0307513_10178772 3300031456 Bacteria 1988
163 Ga0307509_10205127 3300031507 Bacteria 1803
164 Ga0307509_10254068 3300031507 Bacteria 1538
165 Ga0307516_10103094 3300031730 Bacteria 2667
166 Ga0307516_10279816 3300031730 Unclassified 1351
167 Ga0307510_10002329 3300033180 Bacteria 21472
168 Ga0373925_0551832 3300037068 Unclassified 948
169 Ga0395905_0000011 3300037471 Bacteria 424563
170 Ga0395901_0002683 3300038443 Bacteria 17951
171 Ga0451849_0874927 3300041505 Bacteria 1485
172 Ga0466957_0158604 3300044842 Bacteria 1468
173 Ga0451576_0000003 3300045051 Bacteria 1550573
174 Ga0451576_0000022 3300045051 Bacteria 495037
175 Ga0495638_0000121 3300046460 Bacteria 126440
176 Ga0495638_0034444 3300046460 Bacteria 3233
177 Ga0495638_0118385 3300046460 Bacteria 1567
178 Ga0495606_0054494 3300046507 Bacteria 2590
179 Ga0495648_0031392 3300046524 Unclassified 3498
180 Ga0495633_0000116 3300046558 Bacteria 108667
181 Ga0495668_0002203 3300046616 Bacteria 16596
182 Ga0495611_0021530 3300046648 Unclassified 2785
183 Ga0495687_000014 3300047443 Bacteria 366896
184 Ga0496115_0246382 3300048918 Bacteria 1472
185 Ga0496121_0000051 3300048924 Bacteria 315378
186 Ga0495682_0074669 3300049460 Bacteria 1220
187 nmdc:mga0k408_384459_c1 3300050493 Bacteria 836
188 Ga0500644_0000081 3300053088 Bacteria 58662
189 Ga0500644_0016098 3300053088 Bacteria 2148
190 Ga0500646_0002097 3300053090 Bacteria 5199
191 Ga0500583_0000038 3300053092 Bacteria 89399
192 Ga0500583_0000071 3300053092 Bacteria 60351
193 Ga0500583_0015012 3300053092 Unclassified 3052
194 Ga0500583_0024048 3300053092 Bacteria 2579
195 Ga0500651_0023976 3300053093 Bacteria 3823
196 Ga0500651_0060316 3300053093 Bacteria 2371
197 Ga0500651_0334838 3300053093 Unclassified 862
198 Ga0500562_000044 3300053108 Bacteria 65482
199 Ga0500569_000352 3300053109 Bacteria 7454
200 Ga0500597_201034 3300053120 Bacteria 837
201 Ga0500608_225702 3300053122 Unclassified 752
202 Ga0500652_111639 3300053131 Bacteria 1143
203 Ga0500658_0001953 3300053134 Bacteria 8070
204 Ga0500577_0000829 3300053142 Bacteria 7998
205 Ga0500588_0001519 3300053146 Bacteria 4446
206 Ga0500616_0000004 3300053153 Bacteria 1002714
207 Ga0500616_0031213 3300053153 Bacteria 2920
208 Ga0500616_0038990 3300053153 Bacteria 2564
209 Ga0500622_0001320 3300053156 Bacteria 20163
210 Ga0500622_0019815 3300053156 Bacteria 3570
211 Ga0500639_097152 3300053163 Bacteria 1457
212 Ga0500636_0159134 3300053177 Bacteria 1233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10233262 Ga0157375_102332622 197
2 3300014325 Ga0163163_10894551 Ga0163163_108945512 197
3 3300025942 Ga0207689_10311791 Ga0207689_103117911 207
4 3300053120 Ga0500597_201034 Ga0500597_201034_14_640 207
5 3300005288 Ga0065714_10091912 Ga0065714_100919121 220
6 iso_pu_bacteria 2818991442 2819572342 221
7 iso_pu_bacteria 2881955468 2881956395 221
8 3300003322 rootL2_10074450 rootL2_100744503 224
9 3300013297 Ga0157378_10065205 Ga0157378_100652053 225
10 3300015265 Ga0182005_1000353 Ga0182005_100035310 225
11 iso_pu_bacteria 2929239360 2929243647 225
12 iso_pu_bacteria 2818991442 2819577309 226
13 iso_pu_bacteria 2821136567 2821140612 226
14 iso_pu_bacteria 2904467357 2904473031 226
15 3300005329 Ga0070683_100024629 Ga0070683_1000246296 227
16 3300005564 Ga0070664_100091872 Ga0070664_1000918722 227
17 3300005843 Ga0068860_100715893 Ga0068860_1007158932 227
18 3300006237 Ga0097621_100005399 Ga0097621_1000053997 227
19 3300006881 Ga0068865_100085022 Ga0068865_1000850222 227
20 3300009098 Ga0105245_10904454 Ga0105245_109044542 227
21 3300013105 Ga0157369_10056199 Ga0157369_100561992 227
22 3300013296 Ga0157374_10180091 Ga0157374_101800912 227
23 3300013297 Ga0157378_10155328 Ga0157378_101553282 227
24 3300013306 Ga0163162_10837375 Ga0163162_108373752 227
25 3300025944 Ga0207661_10032174 Ga0207661_100321746 227
26 3300048924 Ga0496121_0000051 Ga0496121_0000051_17028_17714 227
27 3300003323 rootH1_10280354 rootH1_102803542 228
28 3300031250 Ga0265331_10111166 Ga0265331_101111662 228
29 3300031251 Ga0265327_10000262 Ga0265327_1000026283 228
30 3300037471 Ga0395905_0000011 Ga0395905_0000011_114758_115450 228
31 3300053088 Ga0500644_0016098 Ga0500644_0016098_1403_2089 228
32 3300053108 Ga0500562_000044 Ga0500562_000044_16314_17000 228
33 3300003323 rootH1_10026846 rootH1_100268462 229
34 3300014326 Ga0157380_10000012 Ga0157380_1000001270 229
35 3300015265 Ga0182005_1000100 Ga0182005_100010010 229
36 3300025208 Ga0209436_102060 Ga0209436_1020606 229
37 3300031507 Ga0307509_10205127 Ga0307509_102051272 229
38 3300031730 Ga0307516_10279816 Ga0307516_102798162 229
39 3300038443 Ga0395901_0002683 Ga0395901_0002683_8125_8814 229
40 3300046460 Ga0495638_0000121 Ga0495638_0000121_69073_69765 229
41 3300053153 Ga0500616_0000004 Ga0500616_0000004_684414_685106 229
42 3300053177 Ga0500636_0159134 Ga0500636_0159134_19_711 229
43 3300003320 rootH2_10044553 rootH2_100445531 230
44 3300003322 rootL2_10125271 rootL2_101252717 230
45 3300003354 JGI25160J50197_1000950 JGI25160J50197_10009506 230
46 3300003659 JGI25404J52841_10017525 JGI25404J52841_100175252 230
47 3300003771 Ga0055526_1005639 Ga0055526_10056395 230
48 3300003790 Ga0055528_1000359 Ga0055528_10003599 230
49 3300003794 Ga0055531_10008195 Ga0055531_100081954 230
50 3300005262 Ga0065165_1000112 Ga0065165_100011231 230
51 3300005334 Ga0068869_100040647 Ga0068869_1000406473 230
52 3300005335 Ga0070666_10000135 Ga0070666_1000013540 230
53 3300005338 Ga0068868_100471852 Ga0068868_1004718522 230
54 3300005355 Ga0070671_100189500 Ga0070671_1001895002 230
55 3300005367 Ga0070667_100005250 Ga0070667_10000525011 230
56 3300005539 Ga0068853_100374175 Ga0068853_1003741752 230
57 3300005548 Ga0070665_100000006 Ga0070665_100000006381 230
58 3300005616 Ga0068852_100009548 Ga0068852_1000095487 230
59 3300005617 Ga0068859_100000127 Ga0068859_10000012713 230
60 3300005618 Ga0068864_100068887 Ga0068864_1000688872 230
61 3300005841 Ga0068863_100000404 Ga0068863_10000040413 230
62 3300005842 Ga0068858_100012879 Ga0068858_1000128797 230
63 3300005842 Ga0068858_100433378 Ga0068858_1004333781 230
64 3300005843 Ga0068860_100005139 Ga0068860_10000513914 230
65 3300006195 Ga0075366_10090851 Ga0075366_100908512 230
66 3300006237 Ga0097621_100018159 Ga0097621_1000181595 230
67 3300006358 Ga0068871_100319512 Ga0068871_1003195121 230
68 3300006881 Ga0068865_100204102 Ga0068865_1002041021 230
69 3300006931 Ga0097620_100000127 Ga0097620_10000012758 230
70 3300009098 Ga0105245_10319550 Ga0105245_103195502 230
71 3300009174 Ga0105241_10000995 Ga0105241_1000099510 230
72 3300009174 Ga0105241_10070858 Ga0105241_100708581 230
73 3300009174 Ga0105241_10084017 Ga0105241_100840173 230
74 3300009176 Ga0105242_10115275 Ga0105242_101152752 230
75 3300009545 Ga0105237_10006279 Ga0105237_100062795 230
76 3300009545 Ga0105237_10024175 Ga0105237_100241754 230
77 3300009553 Ga0105249_10005206 Ga0105249_100052065 230
78 3300010375 Ga0105239_10011194 Ga0105239_100111943 230
79 3300010375 Ga0105239_10111914 Ga0105239_101119141 230
80 3300010375 Ga0105239_10357010 Ga0105239_103570102 230
81 3300013296 Ga0157374_10082053 Ga0157374_100820532 230
82 3300013296 Ga0157374_10732434 Ga0157374_107324341 230
83 3300013297 Ga0157378_10174071 Ga0157378_101740712 230
84 3300013297 Ga0157378_10368531 Ga0157378_103685312 230
85 3300013306 Ga0163162_10002598 Ga0163162_1000259813 230
86 3300013307 Ga0157372_10365072 Ga0157372_103650722 230
87 3300013308 Ga0157375_10173641 Ga0157375_101736412 230
88 3300014326 Ga0157380_10462363 Ga0157380_104623631 230
89 3300014969 Ga0157376_10013273 Ga0157376_100132733 230
90 3300014969 Ga0157376_10026741 Ga0157376_100267415 230
91 3300014969 Ga0157376_10192501 Ga0157376_101925012 230
92 3300025273 Ga0209673_1000096 Ga0209673_100009683 230
93 3300025295 Ga0209564_1002199 Ga0209564_10021999 230
94 3300025297 Ga0209758_1001132 Ga0209758_100113223 230
95 3300025298 Ga0209050_1000207 Ga0209050_1000207128 230
96 3300025298 Ga0209050_1008745 Ga0209050_10087455 230
97 3300025298 Ga0209050_1020860 Ga0209050_10208602 230
98 3300025302 Ga0207426_1000699 Ga0207426_100069920 230
99 3300025304 Ga0209257_1001870 Ga0209257_100187013 230
100 3300025903 Ga0207680_10000057 Ga0207680_1000005738 230
101 3300025911 Ga0207654_10003472 Ga0207654_100034724 230
102 3300025914 Ga0207671_10002264 Ga0207671_1000226413 230
103 3300025927 Ga0207687_10137167 Ga0207687_101371673 230
104 3300025931 Ga0207644_10075192 Ga0207644_100751922 230
105 3300025942 Ga0207689_10004672 Ga0207689_1000467210 230
106 3300025961 Ga0207712_10006662 Ga0207712_100066624 230
107 3300025972 Ga0207668_10485570 Ga0207668_104855701 230
108 3300025986 Ga0207658_10029321 Ga0207658_100293214 230
109 3300026035 Ga0207703_10010415 Ga0207703_100104154 230
110 3300026041 Ga0207639_10340986 Ga0207639_103409862 230
111 3300026088 Ga0207641_10000229 Ga0207641_1000022913 230
112 3300026095 Ga0207676_10150359 Ga0207676_101503592 230
113 3300026142 Ga0207698_10001760 Ga0207698_100017608 230
114 3300028379 Ga0268266_10000010 Ga0268266_10000010462 230
115 3300028381 Ga0268264_10003340 Ga0268264_1000334013 230
116 3300028794 Ga0307515_10000001 Ga0307515_100000011706 230
117 3300028794 Ga0307515_10003094 Ga0307515_1000309411 230
118 3300030521 Ga0307511_10001468 Ga0307511_1000146814 230
119 3300031456 Ga0307513_10086886 Ga0307513_100868862 230
120 3300031456 Ga0307513_10178772 Ga0307513_101787721 230
121 3300031507 Ga0307509_10254068 Ga0307509_102540682 230
122 3300031730 Ga0307516_10103094 Ga0307516_101030942 230
123 3300041505 Ga0451849_0874927 Ga0451849_0874927_712_1413 230
124 3300044842 Ga0466957_0158604 Ga0466957_0158604_145_840 230
125 3300045051 Ga0451576_0000003 Ga0451576_0000003_1052501_1053199 230
126 3300045051 Ga0451576_0000022 Ga0451576_0000022_8216_8923 230
127 3300046460 Ga0495638_0034444 Ga0495638_0034444_1743_2489 230
128 3300046460 Ga0495638_0118385 Ga0495638_0118385_785_1480 230
129 3300046524 Ga0495648_0031392 Ga0495648_0031392_825_1520 230
130 3300046558 Ga0495633_0000116 Ga0495633_0000116_97913_98608 230
131 3300046616 Ga0495668_0002203 Ga0495668_0002203_11661_12356 230
132 3300046648 Ga0495611_0021530 Ga0495611_0021530_89_784 230
133 3300048918 Ga0496115_0246382 Ga0496115_0246382_27_719 230
134 3300049460 Ga0495682_0074669 Ga0495682_0074669_410_1105 230
135 3300050493 nmdc:mga0k408_384459_c1 nmdc:mga0k408_384459_c1_117_812 230
136 3300053092 Ga0500583_0000071 Ga0500583_0000071_46563_47258 230
137 3300053092 Ga0500583_0015012 Ga0500583_0015012_574_1269 230
138 3300053093 Ga0500651_0023976 Ga0500651_0023976_2172_2867 230
139 3300053146 Ga0500588_0001519 Ga0500588_0001519_3206_3907 230
140 3300053153 Ga0500616_0031213 Ga0500616_0031213_1112_1810 230
141 3300053156 Ga0500622_0001320 Ga0500622_0001320_2907_3602 230
142 3300053156 Ga0500622_0019815 Ga0500622_0019815_2167_2865 230
143 3300003215 JGI25153J46596_10013983 JGI25153J46596_100139832 231
144 3300003322 rootL2_10337020 rootL2_103370202 231
145 3300003354 JGI25160J50197_1002374 JGI25160J50197_10023742 231
146 3300003771 Ga0055526_1023576 Ga0055526_10235762 231
147 3300005334 Ga0068869_100005814 Ga0068869_1000058142 231
148 3300005335 Ga0070666_10000028 Ga0070666_1000002898 231
149 3300005347 Ga0070668_100113548 Ga0070668_1001135482 231
150 3300005355 Ga0070671_100053416 Ga0070671_1000534164 231
151 3300005365 Ga0070688_100230685 Ga0070688_1002306852 231
152 3300005367 Ga0070667_100066441 Ga0070667_1000664412 231
153 3300005466 Ga0070685_10257806 Ga0070685_102578061 231
154 3300005548 Ga0070665_100239936 Ga0070665_1002399362 231
155 3300005617 Ga0068859_100000131 Ga0068859_10000013114 231
156 3300005618 Ga0068864_100096053 Ga0068864_1000960532 231
157 3300005834 Ga0068851_10040138 Ga0068851_100401384 231
158 3300005841 Ga0068863_100096514 Ga0068863_1000965142 231
159 3300005842 Ga0068858_100008556 Ga0068858_1000085565 231
160 3300005843 Ga0068860_100007152 Ga0068860_1000071529 231
161 3300005844 Ga0068862_100674207 Ga0068862_1006742071 231
162 3300005937 Ga0081455_10279209 Ga0081455_102792091 231
163 3300005983 Ga0081540_1001717 Ga0081540_10017173 231
164 3300006237 Ga0097621_100016995 Ga0097621_1000169952 231
165 3300006358 Ga0068871_100020547 Ga0068871_1000205477 231
166 3300006358 Ga0068871_100149069 Ga0068871_1001490692 231
167 3300006881 Ga0068865_100109401 Ga0068865_1001094012 231
168 3300006931 Ga0097620_100000131 Ga0097620_10000013163 231
169 3300009098 Ga0105245_10151603 Ga0105245_101516032 231
170 3300009101 Ga0105247_10004532 Ga0105247_100045326 231
171 3300009174 Ga0105241_10004111 Ga0105241_100041116 231
172 3300009177 Ga0105248_10318613 Ga0105248_103186132 231
173 3300009545 Ga0105237_10005746 Ga0105237_1000574610 231
174 3300009553 Ga0105249_10001788 Ga0105249_100017889 231
175 3300010375 Ga0105239_10162201 Ga0105239_101622012 231
176 3300011119 Ga0105246_10003195 Ga0105246_100031956 231
177 3300013102 Ga0157371_10065567 Ga0157371_100655672 231
178 3300013297 Ga0157378_10029276 Ga0157378_100292765 231
179 3300013306 Ga0163162_10000592 Ga0163162_1000059219 231
180 3300013306 Ga0163162_10004053 Ga0163162_100040538 231
181 3300014968 Ga0157379_10006888 Ga0157379_100068886 231
182 3300014969 Ga0157376_10144937 Ga0157376_101449372 231
183 3300025273 Ga0209673_1026385 Ga0209673_10263852 231
184 3300025295 Ga0209564_1001415 Ga0209564_10014157 231
185 3300025297 Ga0209758_1017005 Ga0209758_10170052 231
186 3300025302 Ga0207426_1000023 Ga0207426_1000023107 231
187 3300025321 Ga0207656_10152604 Ga0207656_101526042 231
188 3300025903 Ga0207680_10000220 Ga0207680_1000022016 231
189 3300025911 Ga0207654_10010731 Ga0207654_100107316 231
190 3300025914 Ga0207671_10003351 Ga0207671_1000335113 231
191 3300025931 Ga0207644_10051409 Ga0207644_100514094 231
192 3300025938 Ga0207704_10058232 Ga0207704_100582322 231
193 3300025942 Ga0207689_10000726 Ga0207689_1000072612 231
194 3300025942 Ga0207689_10123321 Ga0207689_101233213 231
195 3300025961 Ga0207712_10003559 Ga0207712_100035596 231
196 3300025972 Ga0207668_10097593 Ga0207668_100975932 231
197 3300026023 Ga0207677_10343612 Ga0207677_103436123 231
198 3300026088 Ga0207641_10001539 Ga0207641_1000153916 231
199 3300026095 Ga0207676_10051794 Ga0207676_100517942 231
200 3300028381 Ga0268264_10005391 Ga0268264_100053919 231
201 3300028800 Ga0265338_10073982 Ga0265338_100739823 231
202 3300033180 Ga0307510_10002329 Ga0307510_100023295 231
203 3300037068 Ga0373925_0551832 Ga0373925_0551832_87_788 231
204 3300046507 Ga0495606_0054494 Ga0495606_0054494_212_913 231
205 3300047443 Ga0495687_000014 Ga0495687_000014_38319_39020 231
206 3300053088 Ga0500644_0000081 Ga0500644_0000081_50042_50743 231
207 3300053090 Ga0500646_0002097 Ga0500646_0002097_2015_2716 231
208 3300053092 Ga0500583_0000038 Ga0500583_0000038_40546_41241 231
209 3300053092 Ga0500583_0024048 Ga0500583_0024048_1432_2133 231
210 3300053093 Ga0500651_0060316 Ga0500651_0060316_830_1531 231
211 3300053093 Ga0500651_0334838 Ga0500651_0334838_149_850 231
212 3300053109 Ga0500569_000352 Ga0500569_000352_6144_6845 231
213 3300053122 Ga0500608_225702 Ga0500608_225702_24_725 231
214 3300053131 Ga0500652_111639 Ga0500652_111639_383_1084 231
215 3300053134 Ga0500658_0001953 Ga0500658_0001953_6445_7146 231
216 3300053142 Ga0500577_0000829 Ga0500577_0000829_3886_4587 231
217 3300053153 Ga0500616_0038990 Ga0500616_0038990_1577_2278 231
218 3300053163 Ga0500639_097152 Ga0500639_097152_88_789 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

5

111

0.93

PF04397

LytTR

LytTr DNA-binding domain

167

259

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.9062 3 119
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.9044 3 113
6swf-assembly1.cif.gz_A selenomethionine derivative of the rec domain of arat, a response regulator from geobacillus stearothermophilus 0.9042 2 122
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9038 1 112
1mih-assembly2.cif.gz_B a role for chey glu 89 in chez-mediated dephosphorylation of the e. coli chemotaxis response regulator chey 0.8969 2 118
ID Description Score Start End Superfamily
af_P60611_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9116 3 126 3.40.50.2300
af_P0AGA6_2_194_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9089 2 116 3.40.50.2300
6m8oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9044 3 113 3.40.50.2300
2qv0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9028 3 119 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8951 3 77 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q5YEC4-F1-model_v4 Response regulator 0.9873 3 121 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1G8F6E8-F1-model_v4 Response regulator receiver domain-containing protein 0.9762 2 122 GO:0000160
AF-A0A4U1CGU6-F1-model_v4 Response regulator 0.9738 1 84 GO:0000160
AF-A0A2E9G1V1-F1-model_v4 deleted 0.9689 3 102
AF-A0A1F2VPX2-F1-model_v4 Response regulatory domain-containing protein 0.9628 1 120 GO:0000160
GO:0016791

Feature Viewer

pLDDT pTM Quality
91.98 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map