F329968

General Info

Members Datasets Scaffolds Average Seq Length
218 145 436 99

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_12609035|Ga0157375_126090352
Length 119
Sequence VNGVPLIAYLGLGLFMFTCGVVGVIVRRNPIVIFMCIELMLNAVNLTFLSFARYQYVLPTGSPADVKNQIQQTAINGQIMVIFVMAVAAAEVAVGLGIIMAIFRLRDNVDLDELNLLKG

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
114 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
115 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 0.92
Rhizosphere 97.71
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_12609035 3300013308 Bacteria 604
2 JGI24735J21928_10147658 3300002067 Bacteria 679
3 Ga0065715_10004932 3300005293 Bacteria 3348
4 Ga0070658_10042269 3300005327 Bacteria 3680
5 Ga0070658_10603909 3300005327 Bacteria 951
6 Ga0070658_10981005 3300005327 Bacteria 735
7 Ga0070683_100001540 3300005329 Bacteria 17845
8 Ga0070683_100039152 3300005329 Bacteria 4350
9 Ga0070683_101263022 3300005329 Bacteria 710
10 Ga0070690_101232109 3300005330 Bacteria 598
11 Ga0068869_100468638 3300005334 Bacteria 1047
12 Ga0068869_100524409 3300005334 Bacteria 992
13 Ga0070666_10006851 3300005335 Bacteria 7019
14 Ga0070680_100078530 3300005336 Bacteria 2719
15 Ga0070680_100090242 3300005336 Bacteria 2536
16 Ga0070680_100186792 3300005336 Bacteria 1746
17 Ga0070680_100773545 3300005336 Bacteria 827
18 Ga0070682_100002061 3300005337 Bacteria 11212
19 Ga0070660_100000289 3300005339 Bacteria 33523
20 Ga0070689_101427158 3300005340 Bacteria 626
21 Ga0070691_10619320 3300005341 Bacteria 641
22 Ga0070661_100037710 3300005344 Bacteria 3516
23 Ga0070661_100067444 3300005344 Bacteria 2629
24 Ga0070692_10422180 3300005345 Bacteria 847
25 Ga0070668_102138346 3300005347 Bacteria 517
26 Ga0070669_100671298 3300005353 Bacteria 873
27 Ga0070675_100120518 3300005354 Bacteria 2228
28 Ga0070674_100053649 3300005356 Bacteria 2785
29 Ga0070673_102169242 3300005364 Bacteria 528
30 Ga0070688_100234356 3300005365 Bacteria 1300
31 Ga0070659_100116175 3300005366 Bacteria 2163
32 Ga0070659_100222426 3300005366 Bacteria 1558
33 Ga0070714_100015478 3300005435 Bacteria 6136
34 Ga0070713_100241160 3300005436 Bacteria 1646
35 Ga0070701_10480798 3300005438 Bacteria 803
36 Ga0070694_100351849 3300005444 Bacteria 1141
37 Ga0070694_101289484 3300005444 Bacteria 614
38 Ga0070681_10000222 3300005458 Bacteria 44616
39 Ga0070698_100000974 3300005471 Bacteria 31437
40 Ga0070698_100006917 3300005471 Bacteria 12295
41 Ga0070679_100014991 3300005530 Bacteria 7448
42 Ga0070679_100211973 3300005530 Bacteria 1900
43 Ga0070684_100004308 3300005535 Bacteria 10808
44 Ga0070704_100166011 3300005549 Bacteria 1750
45 Ga0070664_100002111 3300005564 Bacteria 15896
46 Ga0068857_100034225 3300005577 Bacteria 4494
47 Ga0068857_101901691 3300005577 Bacteria 583
48 Ga0068856_100671104 3300005614 Bacteria 1057
49 Ga0068852_100010293 3300005616 Bacteria 6980
50 Ga0068852_100084075 3300005616 Bacteria 2831
51 Ga0068859_100636820 3300005617 Bacteria 1158
52 Ga0068861_101361865 3300005719 Bacteria 692
53 Ga0068851_10216708 3300005834 Bacteria 1074
54 Ga0068863_100496758 3300005841 Bacteria 1201
55 Ga0068858_100590260 3300005842 Bacteria 1077
56 Ga0068862_100182555 3300005844 Bacteria 1884
57 Ga0070717_10681081 3300006028 Bacteria 934
58 Ga0075428_100101254 3300006844 Bacteria 3141
59 Ga0075428_102501885 3300006844 Bacteria 529
60 Ga0075430_100041732 3300006846 Bacteria 3881
61 Ga0075430_100131407 3300006846 Bacteria 2086
62 Ga0075430_100132742 3300006846 Bacteria 2075
63 Ga0075431_100106714 3300006847 Bacteria 2890
64 Ga0075431_100322537 3300006847 Bacteria 1557
65 Ga0075431_101341210 3300006847 Bacteria 676
66 Ga0075429_100057452 3300006880 Bacteria 3388
67 Ga0075429_100673183 3300006880 Bacteria 907
68 Ga0068865_100582722 3300006881 Bacteria 943
69 Ga0097620_100636800 3300006931 Bacteria 1158
70 Ga0105240_10000028 3300009093 Bacteria 347789
71 Ga0105240_11033797 3300009093 Bacteria 877
72 Ga0105240_11632460 3300009093 Bacteria 674
73 Ga0111539_10004013 3300009094 Bacteria 19321
74 Ga0111539_10012435 3300009094 Bacteria 10670
75 Ga0114129_13013485 3300009147 Bacteria 553
76 Ga0105241_10000025 3300009174 Bacteria 132929
77 Ga0105242_11311510 3300009176 Bacteria 748
78 Ga0105248_11813872 3300009177 Bacteria 692
79 Ga0105237_10000008 3300009545 Bacteria 363335
80 Ga0105237_11216497 3300009545 Bacteria 760
81 Ga0105238_11746282 3300009551 Bacteria 654
82 Ga0105239_10029674 3300010375 Bacteria 6014
83 Ga0105239_10141900 3300010375 Bacteria 2677
84 Ga0105239_11164737 3300010375 Bacteria 888
85 Ga0157373_10916778 3300013100 Bacteria 651
86 Ga0157371_10208181 3300013102 Bacteria 1403
87 Ga0157369_10802160 3300013105 Bacteria 967
88 Ga0157372_10224549 3300013307 Bacteria 2177
89 Ga0157372_10227838 3300013307 Bacteria 2160
90 Ga0157375_12498313 3300013308 Bacteria 617
91 Ga0157380_10789377 3300014326 Bacteria 965
92 Ga0182008_10981380 3300014497 Bacteria 502
93 Ga0206353_10895501 3300020082 Bacteria 902
94 Ga0207680_10000485 3300025903 Bacteria 18857
95 Ga0207699_10927419 3300025906 Bacteria 643
96 Ga0207705_10255394 3300025909 Bacteria 1337
97 Ga0207705_11060935 3300025909 Archaea 625
98 Ga0207684_11068985 3300025910 Bacteria 673
99 Ga0207654_10000187 3300025911 Bacteria 38292
100 Ga0207707_10002900 3300025912 Bacteria 15289
101 Ga0207695_10000088 3300025913 Bacteria 275833
102 Ga0207671_10000005 3300025914 Bacteria 844816
103 Ga0207660_10075068 3300025917 Bacteria 2469
104 Ga0207657_10001670 3300025919 Bacteria 23944
105 Ga0207657_10037892 3300025919 Bacteria 4299
106 Ga0207649_10037392 3300025920 Bacteria 2932
107 Ga0207649_10709950 3300025920 Bacteria 780
108 Ga0207652_10013794 3300025921 Bacteria 6536
109 Ga0207652_10027601 3300025921 Bacteria 4731
110 Ga0207652_10120021 3300025921 Bacteria 2338
111 Ga0207700_10281120 3300025928 Bacteria 1432
112 Ga0207644_10433477 3300025931 Bacteria 1078
113 Ga0207690_10124569 3300025932 Bacteria 1877
114 Ga0207690_10440898 3300025932 Bacteria 1045
115 Ga0207686_10944575 3300025934 Bacteria 697
116 Ga0207691_11331948 3300025940 Bacteria 592
117 Ga0207661_10002693 3300025944 Bacteria 12216
118 Ga0207661_10303524 3300025944 Bacteria 1432
119 Ga0207679_10003936 3300025945 Bacteria 9226
120 Ga0207679_12065467 3300025945 Bacteria 518
121 Ga0207639_10276813 3300026041 Bacteria 1474
122 Ga0207708_10168165 3300026075 Bacteria 1735
123 Ga0207702_10273889 3300026078 Bacteria 1593
124 Ga0207674_10063622 3300026116 Bacteria 3724
125 Ga0207698_10077662 3300026142 Bacteria 2663
126 Ga0207428_10023348 3300027907 Bacteria 5201
127 Ga0207428_10232565 3300027907 Bacteria 1379
128 Ga0268265_10376570 3300028380 Bacteria 1304
129 Ga0268265_10406698 3300028380 Bacteria 1260
130 Ga0307515_10000008 3300028794 Bacteria 663660
131 Ga0265338_11112335 3300028800 Bacteria 532
132 Ga0265332_10293644 3300031238 Bacteria 671
133 Ga0307408_100446183 3300031548 Bacteria 1121
134 Ga0307408_101305147 3300031548 Bacteria 680
135 Ga0316575_10371221 3300031665 Bacteria 611
136 Ga0316579_10088746 3300031691 Bacteria 1476
137 Ga0316579_10174521 3300031691 Bacteria 1039
138 Ga0265314_10025993 3300031711 Bacteria 4406
139 Ga0307405_10000086 3300031731 Bacteria 39376
140 Ga0307405_10200614 3300031731 Bacteria 1448
141 Ga0307405_10427245 3300031731 Bacteria 1044
142 Ga0307405_11896608 3300031731 Bacteria 531
143 Ga0316577_10588092 3300031733 Bacteria 633
144 Ga0307413_10014820 3300031824 Bacteria 3974
145 Ga0307413_11742321 3300031824 Bacteria 556
146 Ga0307413_11762880 3300031824 Bacteria 553
147 Ga0307410_10015189 3300031852 Bacteria 4560
148 Ga0307406_10050203 3300031901 Bacteria 2643
149 Ga0307406_10779291 3300031901 Bacteria 805
150 Ga0307407_10107272 3300031903 Bacteria 1746
151 Ga0307412_10059511 3300031911 Bacteria 2561
152 Ga0307412_10418619 3300031911 Bacteria 1095
153 Ga0307412_10743125 3300031911 Bacteria 846
154 Ga0307409_100291898 3300031995 Bacteria 1512
155 Ga0307409_100737616 3300031995 Bacteria 988
156 Ga0307409_102102868 3300031995 Bacteria 594
157 Ga0307416_100047177 3300032002 Bacteria 3407
158 Ga0307416_100217648 3300032002 Bacteria 1828
159 Ga0307416_101161811 3300032002 Bacteria 877
160 Ga0307416_102493736 3300032002 Bacteria 616
161 Ga0307416_102897062 3300032002 Bacteria 574
162 Ga0307414_10014903 3300032004 Bacteria 4679
163 Ga0307411_10073365 3300032005 Bacteria 2328
164 Ga0307411_10076333 3300032005 Bacteria 2290
165 Ga0307411_10104858 3300032005 Bacteria 2009
166 Ga0307415_100467546 3300032126 Bacteria 1094
167 Ga0307415_100727807 3300032126 Bacteria 898
168 Ga0316574_0017559 3300035398 Bacteria 4190
169 Ga0316574_0042628 3300035398 Bacteria 2801
170 Ga0316582_0013221 3300036647 Bacteria 4640
171 Ga0316582_0036803 3300036647 Bacteria 3031
172 Ga0395905_0000341 3300037471 Bacteria 66401
173 Ga0316581_0244381 3300037588 Unclassified 551
174 Ga0316581_0256842 3300037588 Bacteria 537
175 Ga0439439_0134601 3300041406 Bacteria 695
176 Ga0439433_0140071 3300041999 Bacteria 618
177 Ga0439433_0181010 3300041999 Bacteria 552
178 Ga0439449_0292003 3300042007 Bacteria 615
179 Ga0439446_0034821 3300042156 Bacteria 1467
180 Ga0439434_0038599 3300042435 Bacteria 1464
181 Ga0439434_0156270 3300042435 Bacteria 756
182 Ga0451577_0000016 3300042876 Bacteria 531002
183 Ga0451577_0786092 3300042876 Bacteria 860
184 Ga0466969_0306264 3300044656 Bacteria 719
185 Ga0466966_0025364 3300044684 Bacteria 3873
186 Ga0466966_0063286 3300044684 Bacteria 2331
187 Ga0466961_0239550 3300044693 Bacteria 1115
188 Ga0466971_0226786 3300044719 Bacteria 886
189 Ga0466957_0604986 3300044842 Bacteria 768
190 Ga0466959_0049412 3300045049 Bacteria 3090
191 Ga0466959_0172249 3300045049 Bacteria 1518
192 Ga0466959_0178764 3300045049 Bacteria 1485
193 Ga0466958_0834004 3300045836 Bacteria 601
194 Ga0496102_1281156 3300048905 Bacteria 652
195 Ga0496115_0093956 3300048918 Bacteria 2453
196 Ga0501048_0143098 3300049582 Bacteria 1691
197 Ga0501073_0325927 3300049589 Bacteria 1060
198 Ga0501075_0289515 3300049591 Bacteria 1248
199 Ga0501079_0215165 3300049741 Bacteria 1501
200 Ga0501080_1035768 3300049742 Bacteria 711
201 Ga0501083_0476725 3300049744 Bacteria 812
202 Ga0501283_102910 3300049779 Bacteria 558
203 Ga0501045_0294278 3300049824 Bacteria 1208
204 nmdc:mga09592_172839_c1 3300050508 Bacteria 1868
205 nmdc:mga09592_94953_c1 3300050508 Bacteria 2550
206 nmdc:mga0qj67_158196_c1 3300050509 Bacteria 1839
207 nmdc:mga0qj67_246155_c1 3300050509 Bacteria 1451
208 nmdc:mga06r32_131418_c1 3300050510 Bacteria 2476
209 nmdc:mga06r32_2071190_c1 3300050510 Bacteria 502
210 nmdc:mga06r32_35158_c1 3300050510 Bacteria 4728
211 nmdc:mga06r32_452870_c1 3300050510 Bacteria 1263
212 nmdc:mga08y16_14864_c1 3300050511 Bacteria 8185
213 nmdc:mga08y16_433241_c1 3300050511 Bacteria 1343
214 nmdc:mga0a205_965897_c1 3300050515 Bacteria 699
215 Ga0500583_0029025 3300053092 Bacteria 2407
216 Ga0500604_0116713 3300053151 Bacteria 890
217 Ga0590077_013760 3300059426 Bacteria 1684
218 Ga0530510_0931978 3300061734 Bacteria 664
219 Ga0157375_12609035
220 JGI24735J21928_10147658
221 Ga0065715_10004932
222 Ga0070658_10042269
223 Ga0070658_10603909
224 Ga0070658_10981005
225 Ga0070683_100001540
226 Ga0070683_100039152
227 Ga0070683_101263022
228 Ga0070690_101232109
229 Ga0068869_100468638
230 Ga0068869_100524409
231 Ga0070666_10006851
232 Ga0070680_100078530
233 Ga0070680_100090242
234 Ga0070680_100186792
235 Ga0070680_100773545
236 Ga0070682_100002061
237 Ga0070660_100000289
238 Ga0070689_101427158
239 Ga0070691_10619320
240 Ga0070661_100037710
241 Ga0070661_100067444
242 Ga0070692_10422180
243 Ga0070668_102138346
244 Ga0070669_100671298
245 Ga0070675_100120518
246 Ga0070674_100053649
247 Ga0070673_102169242
248 Ga0070688_100234356
249 Ga0070659_100116175
250 Ga0070659_100222426
251 Ga0070714_100015478
252 Ga0070713_100241160
253 Ga0070701_10480798
254 Ga0070694_100351849
255 Ga0070694_101289484
256 Ga0070681_10000222
257 Ga0070698_100000974
258 Ga0070698_100006917
259 Ga0070679_100014991
260 Ga0070679_100211973
261 Ga0070684_100004308
262 Ga0070704_100166011
263 Ga0070664_100002111
264 Ga0068857_100034225
265 Ga0068857_101901691
266 Ga0068856_100671104
267 Ga0068852_100010293
268 Ga0068852_100084075
269 Ga0068859_100636820
270 Ga0068861_101361865
271 Ga0068851_10216708
272 Ga0068863_100496758
273 Ga0068858_100590260
274 Ga0068862_100182555
275 Ga0070717_10681081
276 Ga0075428_100101254
277 Ga0075428_102501885
278 Ga0075430_100041732
279 Ga0075430_100131407
280 Ga0075430_100132742
281 Ga0075431_100106714
282 Ga0075431_100322537
283 Ga0075431_101341210
284 Ga0075429_100057452
285 Ga0075429_100673183
286 Ga0068865_100582722
287 Ga0097620_100636800
288 Ga0105240_10000028
289 Ga0105240_11033797
290 Ga0105240_11632460
291 Ga0111539_10004013
292 Ga0111539_10012435
293 Ga0114129_13013485
294 Ga0105241_10000025
295 Ga0105242_11311510
296 Ga0105248_11813872
297 Ga0105237_10000008
298 Ga0105237_11216497
299 Ga0105238_11746282
300 Ga0105239_10029674
301 Ga0105239_10141900
302 Ga0105239_11164737
303 Ga0157373_10916778
304 Ga0157371_10208181
305 Ga0157369_10802160
306 Ga0157372_10224549
307 Ga0157372_10227838
308 Ga0157375_12498313
309 Ga0157380_10789377
310 Ga0182008_10981380
311 Ga0206353_10895501
312 Ga0207680_10000485
313 Ga0207699_10927419
314 Ga0207705_10255394
315 Ga0207705_11060935
316 Ga0207684_11068985
317 Ga0207654_10000187
318 Ga0207707_10002900
319 Ga0207695_10000088
320 Ga0207671_10000005
321 Ga0207660_10075068
322 Ga0207657_10001670
323 Ga0207657_10037892
324 Ga0207649_10037392
325 Ga0207649_10709950
326 Ga0207652_10013794
327 Ga0207652_10027601
328 Ga0207652_10120021
329 Ga0207700_10281120
330 Ga0207644_10433477
331 Ga0207690_10124569
332 Ga0207690_10440898
333 Ga0207686_10944575
334 Ga0207691_11331948
335 Ga0207661_10002693
336 Ga0207661_10303524
337 Ga0207679_10003936
338 Ga0207679_12065467
339 Ga0207639_10276813
340 Ga0207708_10168165
341 Ga0207702_10273889
342 Ga0207674_10063622
343 Ga0207698_10077662
344 Ga0207428_10023348
345 Ga0207428_10232565
346 Ga0268265_10376570
347 Ga0268265_10406698
348 Ga0307515_10000008
349 Ga0265338_11112335
350 Ga0265332_10293644
351 Ga0307408_100446183
352 Ga0307408_101305147
353 Ga0316575_10371221
354 Ga0316579_10088746
355 Ga0316579_10174521
356 Ga0265314_10025993
357 Ga0307405_10000086
358 Ga0307405_10200614
359 Ga0307405_10427245
360 Ga0307405_11896608
361 Ga0316577_10588092
362 Ga0307413_10014820
363 Ga0307413_11742321
364 Ga0307413_11762880
365 Ga0307410_10015189
366 Ga0307406_10050203
367 Ga0307406_10779291
368 Ga0307407_10107272
369 Ga0307412_10059511
370 Ga0307412_10418619
371 Ga0307412_10743125
372 Ga0307409_100291898
373 Ga0307409_100737616
374 Ga0307409_102102868
375 Ga0307416_100047177
376 Ga0307416_100217648
377 Ga0307416_101161811
378 Ga0307416_102493736
379 Ga0307416_102897062
380 Ga0307414_10014903
381 Ga0307411_10073365
382 Ga0307411_10076333
383 Ga0307411_10104858
384 Ga0307415_100467546
385 Ga0307415_100727807
386 Ga0316574_0017559
387 Ga0316574_0042628
388 Ga0316582_0013221
389 Ga0316582_0036803
390 Ga0395905_0000341
391 Ga0316581_0244381
392 Ga0316581_0256842
393 Ga0439439_0134601
394 Ga0439433_0140071
395 Ga0439433_0181010
396 Ga0439449_0292003
397 Ga0439446_0034821
398 Ga0439434_0038599
399 Ga0439434_0156270
400 Ga0451577_0000016
401 Ga0451577_0786092
402 Ga0466969_0306264
403 Ga0466966_0025364
404 Ga0466966_0063286
405 Ga0466961_0239550
406 Ga0466971_0226786
407 Ga0466957_0604986
408 Ga0466959_0049412
409 Ga0466959_0172249
410 Ga0466959_0178764
411 Ga0466958_0834004
412 Ga0496102_1281156
413 Ga0496115_0093956
414 Ga0501048_0143098
415 Ga0501073_0325927
416 Ga0501075_0289515
417 Ga0501079_0215165
418 Ga0501080_1035768
419 Ga0501083_0476725
420 Ga0501283_102910
421 Ga0501045_0294278
422 nmdc:mga09592_172839_c1
423 nmdc:mga09592_94953_c1
424 nmdc:mga0qj67_158196_c1
425 nmdc:mga0qj67_246155_c1
426 nmdc:mga06r32_131418_c1
427 nmdc:mga06r32_2071190_c1
428 nmdc:mga06r32_35158_c1
429 nmdc:mga06r32_452870_c1
430 nmdc:mga08y16_14864_c1
431 nmdc:mga08y16_433241_c1
432 nmdc:mga0a205_965897_c1
433 Ga0500583_0029025
434 Ga0500604_0116713
435 Ga0590077_013760
436 Ga0530510_0931978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

8

119

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eyd-assembly1.cif.gz_D structure of mycobacterium smegmatis rna polymerase sigma-a holoenzyme 0.9259 30 95
7wff-assembly1.cif.gz_E subcomplexes b,m and l in the cylic electron transfer supercomplex ndh-psi from arabidopsis 0.9055 6 101
7ar7-assembly1.cif.gz_K cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.852 6 103
7wff-assembly1.cif.gz_E subcomplexes b,m and l in the cylic electron transfer supercomplex ndh-psi from arabidopsis 0.8491 6 101
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.847 5 101
ID Description Score Start End Superfamily
af_A0A1D6IER6_82_233_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8224 10 60 1.20.140.150
6nbqE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8025 4 114 1.10.287.3510
af_Q6R9N1_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.799 8 112 1.10.287.3510
6humE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7961 4 114 1.10.287.3510
6humE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7812 4 114 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A3D3CXZ9-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK 0.9649 4 96 GO:0016651
GO:0030964
GO:0042773
AF-A0A0R2U7Q2-F1-model_v4 NADH:ubiquinone oxidoreductase subunit K (EC 1.6.5.11) 0.9558 4 96 GO:0016651
GO:0030964
GO:0042773
GO:0048038
AF-A0A521KSZ9-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.9474 3 101 GO:0016651
GO:0030964
GO:0042773
AF-A0A533ZE72-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.9444 3 100 GO:0016651
GO:0030964
GO:0042773
AF-A0A3D3CXZ9-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK 0.9443 4 96 GO:0016651
GO:0030964
GO:0042773

Map