F329696

General Info

Members Datasets Scaffolds Average Seq Length
218 119 218 417

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100280370|Ga0070684_1002803701
Length 452
Sequence VEIAENSQLSAGSGLLLRIVMPQFSYKARRRSGEVVEGVLDVADRSAALVQIERLGLFPVMVDAAKGAAAAAPERASGTKVNFKSFLPPSMQKAMSRKRKPKMQELATFTQQLANLLNSGMPLTVALHSMTHLESKGIPTTVSRDLRQEVMEGRSLSDAMAKQPVIFSELYINMVRAGEQSGALVQVLRRMASHFQQFAEVQSKFTSALVYPAMVVCVGIAMVAFFMFFMLPKFMEMFNGFEIQLPLPTRMLMAFSHAVTNVWAIMGFVLGVAVLAILIGKFRASATGKRKIDQWKMKAPVVGKVVRLNLFGQFARVLATLLQNGVPVLTALKITEQVMPNILVKEAVAKTREAVTDGKTLAQPLARSKIFPQLMVDLVKIGEETGDVPGALSNIADTYESELQVGLRVMTNLIEPLLIVGMALVVGFLLLSVMLPMFKLIANINNSAASGK

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
49 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
63 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
64 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
67 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
68 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
69 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 0.92
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10149133 3300003323 Bacteria 4726
2 Ga0070690_100002425 3300005330 Bacteria 10027
3 Ga0070690_100053962 3300005330 Bacteria 2572
4 Ga0070689_100015054 3300005340 Bacteria 5632
5 Ga0070689_100070092 3300005340 Bacteria 2736
6 Ga0070689_100080565 3300005340 Unclassified 2555
7 Ga0070713_100288051 3300005436 Bacteria 1508
8 Ga0070678_100179465 3300005456 Unclassified 1732
9 Ga0070681_10125069 3300005458 Bacteria 2504
10 Ga0070681_10146651 3300005458 Bacteria 2289
11 Ga0070684_100280370 3300005535 Unclassified 1527
12 Ga0070686_100005191 3300005544 Bacteria 7193
13 Ga0070686_100013655 3300005544 Bacteria 4658
14 Ga0070686_100026637 3300005544 Bacteria 3491
15 Ga0070686_100057428 3300005544 Bacteria 2500
16 Ga0070686_100160376 3300005544 Bacteria 1583
17 Ga0068857_100006519 3300005577 Bacteria 10016
18 Ga0068856_100000102 3300005614 Bacteria 82381
19 Ga0068856_100040002 3300005614 Bacteria 4604
20 Ga0068856_100211215 3300005614 Bacteria 1956
21 Ga0068859_100144157 3300005617 Bacteria 2456
22 Ga0068864_100023846 3300005618 Bacteria 5141
23 Ga0068863_100205666 3300005841 Bacteria 1894
24 Ga0068863_100224372 3300005841 Bacteria 1811
25 Ga0081455_10066441 3300005937 Unclassified 3011
26 Ga0070717_10118662 3300006028 Unclassified 2264
27 Ga0075428_100002152 3300006844 Bacteria 21278
28 Ga0075430_100115774 3300006846 Unclassified 2234
29 Ga0075431_100040196 3300006847 Bacteria 4819
30 Ga0075429_100200560 3300006880 Unclassified 1748
31 Ga0097620_100144172 3300006931 Bacteria 2456
32 Ga0105240_10003552 3300009093 Bacteria 24193
33 Ga0105240_10167902 3300009093 Bacteria 2601
34 Ga0105240_10328196 3300009093 Bacteria 1742
35 Ga0111539_10167677 3300009094 Unclassified 2566
36 Ga0111539_10210687 3300009094 Bacteria 2265
37 Ga0111539_10224773 3300009094 Unclassified 2186
38 Ga0105245_10169394 3300009098 Unclassified 2079
39 Ga0105242_10059173 3300009176 Bacteria 3142
40 Ga0105248_10316465 3300009177 Bacteria 1758
41 Ga0105238_10097582 3300009551 Bacteria 2924
42 Ga0157370_10142045 3300013104 Bacteria 2237
43 Ga0157374_10166959 3300013296 Unclassified 2145
44 Ga0157375_10000326 3300013308 Bacteria 42849
45 Ga0163163_10000909 3300014325 Bacteria 25086
46 Ga0163163_10021456 3300014325 Bacteria 6095
47 Ga0157376_10111565 3300014969 Bacteria 2408
48 Ga0207707_10095830 3300025912 Bacteria 2593
49 Ga0207707_10193777 3300025912 Bacteria 1773
50 Ga0207695_10105543 3300025913 Bacteria 2804
51 Ga0207695_10221513 3300025913 Unclassified 1799
52 Ga0207652_10052133 3300025921 Unclassified 3510
53 Ga0207652_10252285 3300025921 Bacteria 1591
54 Ga0207694_10022481 3300025924 Bacteria 4784
55 Ga0207670_10008682 3300025936 Bacteria 5752
56 Ga0207670_10045995 3300025936 Bacteria 2897
57 Ga0207670_10113275 3300025936 Unclassified 1959
58 Ga0207711_10089881 3300025941 Unclassified 2699
59 Ga0207667_10069755 3300025949 Bacteria 3659
60 Ga0207703_10169270 3300026035 Bacteria 1920
61 Ga0207702_10005930 3300026078 Bacteria 10614
62 Ga0207702_10016333 3300026078 Bacteria 6145
63 Ga0207641_10122286 3300026088 Unclassified 2325
64 Ga0207676_10198886 3300026095 Bacteria 1769
65 Ga0207674_10011301 3300026116 Bacteria 10033
66 Ga0207674_10147849 3300026116 Bacteria 2308
67 Ga0265337_1000035 3300028556 Bacteria 58448
68 Ga0265337_1000699 3300028556 Bacteria 17732
69 Ga0265337_1004002 3300028556 Bacteria 6234
70 Ga0265337_1010841 3300028556 Bacteria 3171
71 Ga0265337_1032453 3300028556 Unclassified 1544
72 Ga0265326_10010129 3300028558 Unclassified 2805
73 Ga0265319_1000003 3300028563 Bacteria 340561
74 Ga0265319_1009547 3300028563 Unclassified 4122
75 Ga0265334_10053770 3300028573 Bacteria 1537
76 Ga0265323_10000147 3300028653 Bacteria 41074
77 Ga0265336_10000776 3300028666 Bacteria 16918
78 Ga0265338_10000208 3300028800 Bacteria 109817
79 Ga0265338_10000282 3300028800 Bacteria 91694
80 Ga0265338_10000670 3300028800 Bacteria 59227
81 Ga0265338_10002054 3300028800 Bacteria 31147
82 Ga0265338_10002629 3300028800 Bacteria 26496
83 Ga0265338_10003122 3300028800 Bacteria 23683
84 Ga0265338_10004110 3300028800 Bacteria 19936
85 Ga0265338_10005169 3300028800 Bacteria 17145
86 Ga0265338_10005911 3300028800 Bacteria 15772
87 Ga0265338_10007596 3300028800 Bacteria 13393
88 Ga0265338_10012611 3300028800 Bacteria 9626
89 Ga0265338_10015681 3300028800 Bacteria 8304
90 Ga0265338_10016117 3300028800 Bacteria 8153
91 Ga0265338_10020153 3300028800 Bacteria 7030
92 Ga0265338_10046998 3300028800 Unclassified 3947
93 Ga0265338_10089410 3300028800 Bacteria 2552
94 Ga0265338_10152333 3300028800 Unclassified 1795
95 Ga0265324_10000455 3300029957 Bacteria 28816
96 Ga0265324_10000475 3300029957 Bacteria 28206
97 Ga0265324_10004055 3300029957 Bacteria 6732
98 Ga0265324_10010902 3300029957 Bacteria 3484
99 Ga0265320_10000378 3300031240 Bacteria 36023
100 Ga0265320_10007638 3300031240 Bacteria 6692
101 Ga0265320_10010132 3300031240 Bacteria 5632
102 Ga0265320_10015789 3300031240 Bacteria 4256
103 Ga0265320_10029570 3300031240 Bacteria 2834
104 Ga0265325_10027636 3300031241 Bacteria 3065
105 Ga0265329_10004108 3300031242 Bacteria 6166
106 Ga0265340_10000224 3300031247 Bacteria 28844
107 Ga0265340_10029384 3300031247 Unclassified 2761
108 Ga0265340_10031028 3300031247 Bacteria 2675
109 Ga0265339_10016872 3300031249 Bacteria 4340
110 Ga0265327_10000215 3300031251 Bacteria 119243
111 Ga0265316_10001466 3300031344 Bacteria 25278
112 Ga0265316_10018471 3300031344 Bacteria 5990
113 Ga0265316_10033609 3300031344 Bacteria 4174
114 Ga0265316_10114731 3300031344 Unclassified 2037
115 Ga0265314_10000034 3300031711 Bacteria 241556
116 Ga0265314_10032404 3300031711 Bacteria 3844
117 Ga0265342_10038103 3300031712 Bacteria 2929
118 Ga0265342_10070778 3300031712 Unclassified 2034
119 Ga0316578_10024972 3300031728 Bacteria 3356
120 Ga0373928_0000514 3300035084 Bacteria 7586
121 Ga0373929_0002492 3300035085 Bacteria 3384
122 Ga0373944_0000012 3300035089 Bacteria 34389
123 Ga0373951_0009501 3300035091 Bacteria 2189
124 Ga0373932_0000001 3300035112 Bacteria 1459067
125 Ga0373945_0038417 3300035116 Bacteria 1722
126 Ga0373954_0012435 3300035118 Bacteria 3784
127 Ga0373956_0007368 3300035119 Bacteria 4429
128 Ga0373955_0090170 3300035172 Unclassified 1746
129 Ga0373962_0000030 3300035242 Bacteria 36514
130 Ga0373931_0000008 3300035691 Bacteria 362269
131 Ga0373935_0004792 3300035692 Bacteria 7956
132 Ga0373935_0060032 3300035692 Bacteria 2432
133 Ga0373927_0011638 3300035695 Bacteria 5855
134 Ga0373927_0022848 3300035695 Bacteria 4096
135 Ga0373927_0094507 3300035695 Bacteria 1943
136 Ga0373947_0003737 3300035725 Bacteria 8985
137 Ga0373947_0045103 3300035725 Bacteria 2638
138 Ga0373937_0003432 3300036401 Bacteria 13302
139 Ga0373937_0010675 3300036401 Bacteria 8034
140 Ga0373937_0350666 3300036401 Bacteria 1398
141 Ga0316584_0135427 3300036712 Unclassified 1839
142 Ga0373925_0000158 3300037068 Bacteria 72961
143 Ga0373925_0007487 3300037068 Bacteria 7963
144 Ga0395905_0013990 3300037471 Bacteria 7677
145 Ga0451577_0001038 3300042876 Bacteria 40222
146 Ga0451577_0013861 3300042876 Bacteria 7529
147 Ga0451577_0108218 3300042876 Bacteria 2485
148 Ga0453684_0000866 3300044712 Bacteria 101700
149 Ga0453684_0001984 3300044712 Bacteria 52481
150 Ga0453684_0020899 3300044712 Bacteria 9823
151 Ga0453684_0148587 3300044712 Unclassified 2788
152 Ga0453684_0491609 3300044712 Bacteria 1360
153 Ga0451576_0025456 3300045051 Bacteria 6374
154 Ga0451576_0038337 3300045051 Bacteria 5072
155 Ga0451576_0104405 3300045051 Unclassified 2948
156 Ga0451576_0108602 3300045051 Bacteria 2887
157 Ga0451576_0147550 3300045051 Bacteria 2453
158 Ga0451576_0185872 3300045051 Unclassified 2170
159 Ga0451576_0190900 3300045051 Unclassified 2140
160 Ga0495592_0000287 3300046454 Bacteria 43424
161 Ga0495641_0012504 3300046461 Unclassified 4742
162 Ga0495651_0085966 3300046462 Unclassified 2368
163 Ga0495664_0073251 3300046477 Unclassified 2048
164 Ga0495618_0000552 3300046514 Bacteria 26567
165 Ga0495618_0027702 3300046514 Bacteria 3528
166 Ga0495628_0013552 3300046516 Bacteria 6857
167 Ga0495630_0000326 3300046517 Bacteria 37927
168 Ga0495630_0031924 3300046517 Bacteria 3922
169 Ga0495630_0211859 3300046517 Bacteria 1479
170 Ga0495666_0010491 3300046526 Unclassified 4620
171 Ga0495666_0033346 3300046526 Bacteria 2515
172 Ga0495666_0108022 3300046526 Bacteria 1308
173 Ga0495640_0038940 3300046533 Bacteria 3340
174 Ga0495640_0041455 3300046533 Unclassified 3217
175 Ga0495640_0096560 3300046533 Bacteria 1944
176 Ga0495586_0000001 3300046535 Bacteria 231314
177 Ga0495586_0002000 3300046535 Bacteria 11063
178 Ga0495586_0002871 3300046535 Bacteria 9309
179 Ga0495586_0015766 3300046535 Unclassified 4020
180 Ga0495586_0089384 3300046535 Bacteria 1700
181 Ga0495645_0009148 3300046543 Bacteria 6922
182 Ga0495645_0040177 3300046543 Bacteria 3413
183 Ga0495645_0048766 3300046543 Bacteria 3084
184 Ga0495667_0009138 3300046559 Bacteria 6731
185 Ga0495634_0000669 3300046642 Bacteria 33295
186 Ga0495634_0037904 3300046642 Unclassified 3291
187 Ga0495635_0115771 3300046663 Bacteria 1830
188 Ga0495599_0044996 3300046678 Bacteria 2767
189 Ga0495658_0004229 3300046683 Bacteria 7063
190 Ga0495658_0009410 3300046683 Unclassified 4871
191 Ga0495613_0002784 3300046689 Bacteria 13131
192 Ga0495674_0002507 3300047319 Bacteria 17878
193 Ga0495674_0057644 3300047319 Bacteria 3399
194 Ga0495680_0003402 3300047322 Bacteria 15700
195 Ga0495680_0157277 3300047322 Bacteria 1653
196 Ga0495675_0143287 3300047444 Bacteria 1480
197 Ga0495684_0099908 3300047471 Bacteria 2194
198 Ga0496106_0178542 3300048909 Bacteria 1685
199 Ga0496115_0010113 3300048918 Bacteria 7037
200 Ga0501031_0005148 3300049568 Bacteria 8519
201 Ga0501032_0008897 3300049569 Bacteria 7299
202 Ga0501032_0053991 3300049569 Bacteria 2705
203 Ga0501033_0017658 3300049570 Bacteria 5389
204 Ga0501033_0017838 3300049570 Bacteria 5360
205 Ga0501037_0055198 3300049573 Bacteria 2905
206 Ga0501070_0106815 3300049586 Bacteria 2314
207 Ga0501080_0167670 3300049742 Bacteria 2026
208 Ga0501035_0025720 3300049822 Bacteria 5395
209 Ga0501035_0039877 3300049822 Bacteria 4247
210 Ga0501044_0000079 3300049823 Bacteria 117924
211 Ga0501044_0053980 3300049823 Bacteria 4132
212 nmdc:mga05p37_211327_c1 3300050507 Unclassified 2345
213 nmdc:mga0qj67_96711_c1 3300050509 Unclassified 2377
214 nmdc:mga06r32_66563_c1 3300050510 Unclassified 3477
215 nmdc:mga08y16_220016_c1 3300050511 Bacteria 1966
216 nmdc:mga08y16_372406_c1 3300050511 Unclassified 1465
217 Ga0495601_0040862 3300053077 Bacteria 2906
218 Ga0500650_0005440 3300053098 Unclassified 4746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0108602 Ga0451576_0108602_1724_2800 341
2 3300046526 Ga0495666_0108022 Ga0495666_0108022_184_1263 357
3 3300028800 Ga0265338_10089410 Ga0265338_100894103 369
4 3300006880 Ga0075429_100200560 Ga0075429_1002005602 383
5 3300009094 Ga0111539_10167677 Ga0111539_101676772 383
6 3300028800 Ga0265338_10152333 Ga0265338_101523332 384
7 3300028563 Ga0265319_1009547 Ga0265319_10095474 391
8 3300042876 Ga0451577_0108218 Ga0451577_0108218_443_1678 391
9 3300028556 Ga0265337_1010841 Ga0265337_10108414 394
10 3300005544 Ga0070686_100057428 Ga0070686_1000574281 396
11 3300009093 Ga0105240_10003552 Ga0105240_100035527 396
12 3300025913 Ga0207695_10221513 Ga0207695_102215132 396
13 3300049742 Ga0501080_0167670 Ga0501080_0167670_502_1770 396
14 3300005458 Ga0070681_10125069 Ga0070681_101250692 398
15 3300013296 Ga0157374_10166959 Ga0157374_101669592 400
16 3300013308 Ga0157375_10000326 Ga0157375_1000032628 400
17 3300028800 Ga0265338_10016117 Ga0265338_100161174 400
18 3300031240 Ga0265320_10029570 Ga0265320_100295702 400
19 3300031241 Ga0265325_10027636 Ga0265325_100276362 400
20 3300046461 Ga0495641_0012504 Ga0495641_0012504_1271_2494 400
21 3300046517 Ga0495630_0211859 Ga0495630_0211859_227_1450 400
22 3300046533 Ga0495640_0041455 Ga0495640_0041455_46_1269 400
23 3300046642 Ga0495634_0037904 Ga0495634_0037904_480_1703 400
24 3300046683 Ga0495658_0009410 Ga0495658_0009410_125_1348 400
25 3300005456 Ga0070678_100179465 Ga0070678_1001794651 401
26 3300009094 Ga0111539_10210687 Ga0111539_102106872 401
27 3300050511 nmdc:mga08y16_220016_c1 nmdc:mga08y16_220016_c1_350_1624 401
28 3300028800 Ga0265338_10004110 Ga0265338_1000411021 402
29 3300031249 Ga0265339_10016872 Ga0265339_100168725 402
30 3300028556 Ga0265337_1032453 Ga0265337_10324531 403
31 3300028800 Ga0265338_10003122 Ga0265338_1000312212 403
32 3300028800 Ga0265338_10005911 Ga0265338_100059116 403
33 3300029957 Ga0265324_10004055 Ga0265324_100040555 403
34 3300031240 Ga0265320_10007638 Ga0265320_100076384 403
35 3300031247 Ga0265340_10029384 Ga0265340_100293843 403
36 3300031712 Ga0265342_10038103 Ga0265342_100381034 403
37 3300035118 Ga0373954_0012435 Ga0373954_0012435_1222_2511 403
38 3300035119 Ga0373956_0007368 Ga0373956_0007368_2126_3415 403
39 3300036401 Ga0373937_0003432 Ga0373937_0003432_11903_13192 403
40 3300044712 Ga0453684_0000866 Ga0453684_0000866_4370_5674 403
41 3300044712 Ga0453684_0148587 Ga0453684_0148587_510_1787 403
42 3300046514 Ga0495618_0000552 Ga0495618_0000552_21777_23066 403
43 3300046517 Ga0495630_0031924 Ga0495630_0031924_1167_2456 403
44 3300046535 Ga0495586_0002000 Ga0495586_0002000_2342_3631 403
45 3300046642 Ga0495634_0000669 Ga0495634_0000669_21909_23198 403
46 3300046663 Ga0495635_0115771 Ga0495635_0115771_306_1595 403
47 3300046689 Ga0495613_0002784 Ga0495613_0002784_5034_6323 403
48 3300047322 Ga0495680_0003402 Ga0495680_0003402_7198_8487 403
49 3300005618 Ga0068864_100023846 Ga0068864_1000238464 404
50 3300005841 Ga0068863_100205666 Ga0068863_1002056663 404
51 3300014325 Ga0163163_10021456 Ga0163163_100214562 404
52 3300026095 Ga0207676_10198886 Ga0207676_101988862 404
53 3300031344 Ga0265316_10114731 Ga0265316_101147312 404
54 3300035084 Ga0373928_0000514 Ga0373928_0000514_109_1377 404
55 3300035085 Ga0373929_0002492 Ga0373929_0002492_766_2034 404
56 3300035089 Ga0373944_0000012 Ga0373944_0000012_10353_11621 404
57 3300035091 Ga0373951_0009501 Ga0373951_0009501_672_1940 404
58 3300035112 Ga0373932_0000001 Ga0373932_0000001_700418_701686 404
59 3300035116 Ga0373945_0038417 Ga0373945_0038417_14_1282 404
60 3300035242 Ga0373962_0000030 Ga0373962_0000030_6359_7627 404
61 3300035691 Ga0373931_0000008 Ga0373931_0000008_166992_168260 404
62 3300035692 Ga0373935_0060032 Ga0373935_0060032_1033_2301 404
63 3300035725 Ga0373947_0045103 Ga0373947_0045103_289_1557 404
64 3300037068 Ga0373925_0000158 Ga0373925_0000158_34580_35848 404
65 3300037471 Ga0395905_0013990 Ga0395905_0013990_6224_7501 404
66 3300009093 Ga0105240_10328196 Ga0105240_103281961 405
67 3300028800 Ga0265338_10007596 Ga0265338_100075969 405
68 3300046454 Ga0495592_0000287 Ga0495592_0000287_36934_38217 405
69 3300046514 Ga0495618_0027702 Ga0495618_0027702_152_1435 405
70 3300046516 Ga0495628_0013552 Ga0495628_0013552_4353_5636 405
71 3300046526 Ga0495666_0033346 Ga0495666_0033346_448_1731 405
72 3300046533 Ga0495640_0038940 Ga0495640_0038940_952_2235 405
73 3300046535 Ga0495586_0002871 Ga0495586_0002871_3084_4367 405
74 3300046543 Ga0495645_0048766 Ga0495645_0048766_728_2011 405
75 3300046678 Ga0495599_0044996 Ga0495599_0044996_598_1881 405
76 3300047319 Ga0495674_0057644 Ga0495674_0057644_562_1845 405
77 3300042876 Ga0451577_0001038 Ga0451577_0001038_3152_4432 406
78 3300044712 Ga0453684_0001984 Ga0453684_0001984_2950_4230 406
79 3300046535 Ga0495586_0089384 Ga0495586_0089384_19_1317 406
80 3300048918 Ga0496115_0010113 Ga0496115_0010113_1694_2992 406
81 3300049569 Ga0501032_0053991 Ga0501032_0053991_42_1280 406
82 3300028573 Ga0265334_10053770 Ga0265334_100537702 407
83 3300046462 Ga0495651_0085966 Ga0495651_0085966_769_2064 407
84 3300026078 Ga0207702_10016333 Ga0207702_100163332 408
85 3300028558 Ga0265326_10010129 Ga0265326_100101291 408
86 3300035692 Ga0373935_0004792 Ga0373935_0004792_5136_6410 408
87 3300035695 Ga0373927_0011638 Ga0373927_0011638_3364_4638 408
88 3300035725 Ga0373947_0003737 Ga0373947_0003737_4512_5786 408
89 3300045051 Ga0451576_0185872 Ga0451576_0185872_698_1972 408
90 3300005614 Ga0068856_100000102 Ga0068856_10000010260 409
91 3300026078 Ga0207702_10005930 Ga0207702_100059308 409
92 3300044712 Ga0453684_0491609 Ga0453684_0491609_31_1284 409
93 3300014325 Ga0163163_10000909 Ga0163163_100009097 410
94 3300026116 Ga0207674_10147849 Ga0207674_101478491 410
95 3300028800 Ga0265338_10002054 Ga0265338_1000205426 410
96 3300031344 Ga0265316_10001466 Ga0265316_1000146610 410
97 3300035172 Ga0373955_0090170 Ga0373955_0090170_65_1360 410
98 3300045051 Ga0451576_0147550 Ga0451576_0147550_70_1374 410
99 3300046477 Ga0495664_0073251 Ga0495664_0073251_651_1946 410
100 3300046535 Ga0495586_0015766 Ga0495586_0015766_1432_2727 410
101 3300046543 Ga0495645_0009148 Ga0495645_0009148_2032_3327 410
102 3300047322 Ga0495680_0157277 Ga0495680_0157277_195_1487 410
103 3300005544 Ga0070686_100005191 Ga0070686_1000051913 411
104 3300048909 Ga0496106_0178542 Ga0496106_0178542_82_1362 411
105 3300006844 Ga0075428_100002152 Ga0075428_10000215213 412
106 3300028800 Ga0265338_10046998 Ga0265338_100469984 412
107 3300053098 Ga0500650_0005440 Ga0500650_0005440_1587_2855 412
108 3300009094 Ga0111539_10224773 Ga0111539_102247732 413
109 3300050511 nmdc:mga08y16_372406_c1 nmdc:mga08y16_372406_c1_54_1337 413
110 3300031728 Ga0316578_10024972 Ga0316578_100249722 414
111 3300036712 Ga0316584_0135427 Ga0316584_0135427_335_1612 414
112 3300045051 Ga0451576_0190900 Ga0451576_0190900_180_1454 414
113 3300049568 Ga0501031_0005148 Ga0501031_0005148_1574_2866 414
114 3300049569 Ga0501032_0008897 Ga0501032_0008897_2329_3621 414
115 3300049822 Ga0501035_0025720 Ga0501035_0025720_3609_4901 414
116 3300049823 Ga0501044_0000079 Ga0501044_0000079_84892_86184 414
117 3300031242 Ga0265329_10004108 Ga0265329_100041082 415
118 3300031711 Ga0265314_10000034 Ga0265314_10000034144 415
119 3300050507 nmdc:mga05p37_211327_c1 nmdc:mga05p37_211327_c1_50_1324 417
120 3300005330 Ga0070690_100053962 Ga0070690_1000539622 418
121 3300005340 Ga0070689_100070092 Ga0070689_1000700922 418
122 3300005436 Ga0070713_100288051 Ga0070713_1002880511 418
123 3300005544 Ga0070686_100013655 Ga0070686_1000136555 418
124 3300005544 Ga0070686_100026637 Ga0070686_1000266373 418
125 3300005544 Ga0070686_100160376 Ga0070686_1001603761 418
126 3300005614 Ga0068856_100211215 Ga0068856_1002112151 418
127 3300005841 Ga0068863_100224372 Ga0068863_1002243722 418
128 3300006028 Ga0070717_10118662 Ga0070717_101186622 418
129 3300009098 Ga0105245_10169394 Ga0105245_101693942 418
130 3300009177 Ga0105248_10316465 Ga0105248_103164652 418
131 3300014969 Ga0157376_10111565 Ga0157376_101115652 418
132 3300025936 Ga0207670_10045995 Ga0207670_100459952 418
133 3300026035 Ga0207703_10169270 Ga0207703_101692702 418
134 3300028800 Ga0265338_10015681 Ga0265338_100156812 418
135 3300036401 Ga0373937_0010675 Ga0373937_0010675_2862_4136 418
136 3300042876 Ga0451577_0013861 Ga0451577_0013861_1933_3204 418
137 3300044712 Ga0453684_0020899 Ga0453684_0020899_5120_6394 418
138 3300045051 Ga0451576_0038337 Ga0451576_0038337_970_2256 418
139 3300045051 Ga0451576_0104405 Ga0451576_0104405_1220_2491 418
140 3300046517 Ga0495630_0000326 Ga0495630_0000326_23649_24926 418
141 3300046526 Ga0495666_0010491 Ga0495666_0010491_3283_4560 418
142 3300046533 Ga0495640_0096560 Ga0495640_0096560_76_1353 418
143 3300046535 Ga0495586_0000001 Ga0495586_0000001_164591_165868 418
144 3300046543 Ga0495645_0040177 Ga0495645_0040177_1236_2510 418
145 3300046683 Ga0495658_0004229 Ga0495658_0004229_557_1837 418
146 3300047319 Ga0495674_0002507 Ga0495674_0002507_1804_3081 418
147 3300047471 Ga0495684_0099908 Ga0495684_0099908_162_1436 418
148 3300005330 Ga0070690_100002425 Ga0070690_1000024252 419
149 3300005340 Ga0070689_100015054 Ga0070689_1000150543 419
150 3300005577 Ga0068857_100006519 Ga0068857_1000065194 419
151 3300005617 Ga0068859_100144157 Ga0068859_1001441572 419
152 3300006931 Ga0097620_100144172 Ga0097620_1001441722 419
153 3300009176 Ga0105242_10059173 Ga0105242_100591731 419
154 3300025936 Ga0207670_10008682 Ga0207670_100086825 419
155 3300026088 Ga0207641_10122286 Ga0207641_101222862 419
156 3300026116 Ga0207674_10011301 Ga0207674_100113014 419
157 3300028556 Ga0265337_1000035 Ga0265337_100003527 419
158 3300031247 Ga0265340_10031028 Ga0265340_100310282 419
159 3300031344 Ga0265316_10033609 Ga0265316_100336093 419
160 3300031711 Ga0265314_10032404 Ga0265314_100324044 419
161 3300045051 Ga0451576_0025456 Ga0451576_0025456_4453_5730 419
162 3300046559 Ga0495667_0009138 Ga0495667_0009138_2597_3880 419
163 3300047444 Ga0495675_0143287 Ga0495675_0143287_71_1351 419
164 3300053077 Ga0495601_0040862 Ga0495601_0040862_138_1418 419
165 3300006846 Ga0075430_100115774 Ga0075430_1001157741 420
166 3300006847 Ga0075431_100040196 Ga0075431_1000401965 420
167 3300025941 Ga0207711_10089881 Ga0207711_100898813 420
168 3300028563 Ga0265319_1000003 Ga0265319_100000385 420
169 3300028653 Ga0265323_10000147 Ga0265323_100001478 420
170 3300028800 Ga0265338_10000282 Ga0265338_100002826 420
171 3300028800 Ga0265338_10000670 Ga0265338_1000067020 420
172 3300028800 Ga0265338_10005169 Ga0265338_100051697 420
173 3300029957 Ga0265324_10000455 Ga0265324_100004556 420
174 3300029957 Ga0265324_10010902 Ga0265324_100109023 420
175 3300031240 Ga0265320_10015789 Ga0265320_100157894 420
176 3300031344 Ga0265316_10018471 Ga0265316_100184715 420
177 3300050509 nmdc:mga0qj67_96711_c1 nmdc:mga0qj67_96711_c1_216_1502 420
178 3300050510 nmdc:mga06r32_66563_c1 nmdc:mga06r32_66563_c1_1823_3109 420
179 3300005340 Ga0070689_100080565 Ga0070689_1000805651 421
180 3300025924 Ga0207694_10022481 Ga0207694_100224814 421
181 3300025936 Ga0207670_10113275 Ga0207670_101132752 421
182 3300028556 Ga0265337_1000699 Ga0265337_100069916 421
183 3300028556 Ga0265337_1004002 Ga0265337_10040025 421
184 3300028666 Ga0265336_10000776 Ga0265336_1000077615 421
185 3300028800 Ga0265338_10000208 Ga0265338_1000020849 421
186 3300028800 Ga0265338_10002629 Ga0265338_1000262917 421
187 3300028800 Ga0265338_10012611 Ga0265338_100126119 421
188 3300029957 Ga0265324_10000475 Ga0265324_1000047520 421
189 3300031240 Ga0265320_10000378 Ga0265320_1000037821 421
190 3300031240 Ga0265320_10010132 Ga0265320_100101322 421
191 3300031247 Ga0265340_10000224 Ga0265340_1000022425 421
192 3300035695 Ga0373927_0022848 Ga0373927_0022848_109_1377 421
193 3300049570 Ga0501033_0017658 Ga0501033_0017658_390_1673 421
194 3300049573 Ga0501037_0055198 Ga0501037_0055198_1367_2650 421
195 3300049586 Ga0501070_0106815 Ga0501070_0106815_858_2141 421
196 3300049822 Ga0501035_0039877 Ga0501035_0039877_2524_3807 421
197 3300049823 Ga0501044_0053980 Ga0501044_0053980_2516_3799 421
198 3300005937 Ga0081455_10066441 Ga0081455_100664412 422
199 3300036401 Ga0373937_0350666 Ga0373937_0350666_67_1350 422
200 3300003323 rootH1_10149133 rootH1_101491332 423
201 3300005458 Ga0070681_10146651 Ga0070681_101466512 423
202 3300005535 Ga0070684_100280370 Ga0070684_1002803701 423
203 3300005614 Ga0068856_100040002 Ga0068856_1000400022 423
204 3300009093 Ga0105240_10167902 Ga0105240_101679022 423
205 3300009551 Ga0105238_10097582 Ga0105238_100975821 423
206 3300013104 Ga0157370_10142045 Ga0157370_101420452 423
207 3300025912 Ga0207707_10095830 Ga0207707_100958303 423
208 3300025912 Ga0207707_10193777 Ga0207707_101937772 423
209 3300025913 Ga0207695_10105543 Ga0207695_101055432 423
210 3300025921 Ga0207652_10052133 Ga0207652_100521334 423
211 3300025921 Ga0207652_10252285 Ga0207652_102522852 423
212 3300025949 Ga0207667_10069755 Ga0207667_100697552 423
213 3300028800 Ga0265338_10020153 Ga0265338_100201535 423
214 3300031251 Ga0265327_10000215 Ga0265327_10000215109 423
215 3300031712 Ga0265342_10070778 Ga0265342_100707782 423
216 3300035695 Ga0373927_0094507 Ga0373927_0094507_270_1547 423
217 3300037068 Ga0373925_0007487 Ga0373925_0007487_5389_6666 423
218 3300049570 Ga0501033_0017838 Ga0501033_0017838_1689_2990 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

109

232

0.99

PF00482

T2SSF

Type II secretion system (T2SS), protein F

314

436

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.9519 286 383
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.9462 286 383
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9441 81 186
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9413 81 182
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.9364 81 190
ID Description Score Start End Superfamily
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9552 276 384 1.20.81.30
af_P41441_261_365_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9539 287 388 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9462 286 383 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9306 276 384 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.9198 80 187 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A3D0TQ32-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9551 135 419 GO:0005886
GO:0015628
AF-A0A3D0TQ32-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9454 135 419 GO:0005886
GO:0015628
AF-A0A0G1Q785-F1-model_v4 Type IV pilin 0.939 99 422 GO:0005886
AF-A0A7C2BQY5-F1-model_v4 Type II secretion system F family protein 0.936 68 422 GO:0005886
GO:0015628
AF-A0A0G1Q785-F1-model_v4 Type IV pilin 0.9307 99 422 GO:0005886

Feature Viewer

pLDDT pTM Quality
73.92 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map