F329691

General Info

Members Datasets Scaffolds Average Seq Length
218 165 436 197

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100531830|Ga0070699_1005318301
Length 219
Sequence MKAGETAGRVAAGPAEETITFDENGLVPCVVQDWSTGEVLTLAYMNRDALDRTLASGDVHFWSRSRGELWRKGETSGNTQRLRSLRYDCDTDALLALVEPAGPACHTGNRTCFYRTIGAPQVAAHEALAALSRTLAERRRELPDGSYSAELFRAGPEAIGAKVEEEAEEVARAGREETDDRLRAEAADLIYHLGVLLHARGLSFSDALGELTERMPVAK

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 11.47
Rhizosphere 86.7
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100531830 3300005518 Bacteria 1069
2 JGI25406J46586_10015253 3300003203 Bacteria 3246
3 JGI25406J46586_10035235 3300003203 Bacteria 1828
4 Ga0070683_100020448 3300005329 Bacteria 5891
5 Ga0068869_100709316 3300005334 Bacteria 858
6 Ga0070682_100151752 3300005337 Bacteria 1591
7 Ga0070682_100172178 3300005337 Bacteria 1505
8 Ga0070682_100362116 3300005337 Bacteria 1085
9 Ga0070682_100391799 3300005337 Bacteria 1048
10 Ga0070660_100035508 3300005339 Bacteria 3773
11 Ga0070668_100173492 3300005347 Bacteria 1757
12 Ga0070668_100863939 3300005347 Bacteria 807
13 Ga0070669_100370759 3300005353 Bacteria 1166
14 Ga0070674_100438351 3300005356 Bacteria 1076
15 Ga0070673_100776359 3300005364 Bacteria 884
16 Ga0070688_100121326 3300005365 Bacteria 1751
17 Ga0070659_100107535 3300005366 Bacteria 2249
18 Ga0070714_100165277 3300005435 Bacteria 2005
19 Ga0070714_100362640 3300005435 Bacteria 1363
20 Ga0070710_10027177 3300005437 Bacteria 3049
21 Ga0070701_10099883 3300005438 Bacteria 1605
22 Ga0070705_100067405 3300005440 Bacteria 2150
23 Ga0070700_100028981 3300005441 Bacteria 3297
24 Ga0070663_100432349 3300005455 Bacteria 1082
25 Ga0070678_100721366 3300005456 Bacteria 900
26 Ga0070662_100444220 3300005457 Bacteria 1076
27 Ga0068867_100266095 3300005459 Bacteria 1400
28 Ga0070679_100594550 3300005530 Bacteria 1050
29 Ga0068853_100192483 3300005539 Bacteria 1853
30 Ga0070686_100155045 3300005544 Bacteria 1607
31 Ga0070665_100002397 3300005548 Bacteria 20680
32 Ga0068857_100157781 3300005577 Bacteria 2058
33 Ga0068857_100456608 3300005577 Bacteria 1195
34 Ga0068854_100796342 3300005578 Bacteria 823
35 Ga0070702_100038649 3300005615 Bacteria 2659
36 Ga0070702_100195171 3300005615 Bacteria 1335
37 Ga0068859_100132790 3300005617 Bacteria 2561
38 Ga0068866_10021908 3300005718 Bacteria 2949
39 Ga0068861_100081113 3300005719 Bacteria 2539
40 Ga0068870_10062810 3300005840 Bacteria 2002
41 Ga0068858_100543854 3300005842 Bacteria 1124
42 Ga0068860_100621887 3300005843 Bacteria 1086
43 Ga0068862_100026457 3300005844 Bacteria 4876
44 Ga0081455_10019352 3300005937 Bacteria 6444
45 Ga0081538_10002867 3300005981 Bacteria 16478
46 Ga0081538_10027364 3300005981 Bacteria 3955
47 Ga0081538_10032725 3300005981 Bacteria 3476
48 Ga0081538_10087726 3300005981 Bacteria 1622
49 Ga0081539_10003115 3300005985 Bacteria 21199
50 Ga0081539_10004464 3300005985 Bacteria 15425
51 Ga0070717_10073546 3300006028 Bacteria 2857
52 Ga0070715_10100440 3300006163 Bacteria 1348
53 Ga0070712_100283143 3300006175 Bacteria 1336
54 Ga0097621_100315002 3300006237 Bacteria 1385
55 Ga0075433_10155186 3300006852 Bacteria 2037
56 Ga0075434_100264274 3300006871 Bacteria 1740
57 Ga0075429_100836211 3300006880 Bacteria 806
58 Ga0068865_100102941 3300006881 Bacteria 2093
59 Ga0075436_100332487 3300006914 Bacteria 1093
60 Ga0097620_100132804 3300006931 Bacteria 2561
61 Ga0075435_100147152 3300007076 Bacteria 1979
62 Ga0105240_10881363 3300009093 Bacteria 964
63 Ga0105245_10202785 3300009098 Bacteria 1905
64 Ga0105245_10735456 3300009098 Bacteria 1022
65 Ga0105245_11075466 3300009098 Bacteria 850
66 Ga0105247_10327940 3300009101 Bacteria 1070
67 Ga0114129_10053713 3300009147 Bacteria 5651
68 Ga0114129_10831381 3300009147 Bacteria 1176
69 Ga0105243_11479669 3300009148 Bacteria 702
70 Ga0105242_10201658 3300009176 Bacteria 1767
71 Ga0105242_10488608 3300009176 Bacteria 1168
72 Ga0105242_10687941 3300009176 Bacteria 999
73 Ga0105248_10496694 3300009177 Bacteria 1375
74 Ga0105248_10812345 3300009177 Unclassified 1055
75 Ga0105237_10700497 3300009545 Bacteria 1019
76 Ga0105249_10277694 3300009553 Bacteria 1671
77 Ga0105249_10533726 3300009553 Bacteria 1222
78 Ga0105239_11135761 3300010375 Bacteria 900
79 Ga0105239_11969551 3300010375 Bacteria 678
80 Ga0105246_10125885 3300011119 Bacteria 1906
81 Ga0157374_10431137 3300013296 Bacteria 1318
82 Ga0163162_11217537 3300013306 Bacteria 855
83 Ga0157372_11278724 3300013307 Bacteria 847
84 Ga0157375_10732943 3300013308 Bacteria 1141
85 Ga0157379_10217304 3300014968 Bacteria 1731
86 Ga0213876_10006153 3300021384 Bacteria 6551
87 Ga0207642_10027903 3300025899 Bacteria 2317
88 Ga0207710_10040032 3300025900 Bacteria 2076
89 Ga0207688_10042310 3300025901 Bacteria 2536
90 Ga0207647_10283203 3300025904 Bacteria 946
91 Ga0207645_10196325 3300025907 Bacteria 1327
92 Ga0207643_10037839 3300025908 Bacteria 2708
93 Ga0207705_10579991 3300025909 Bacteria 872
94 Ga0207671_10368595 3300025914 Bacteria 1140
95 Ga0207693_10237012 3300025915 Bacteria 1432
96 Ga0207662_10085903 3300025918 Bacteria 1927
97 Ga0207657_10003986 3300025919 Bacteria 15694
98 Ga0207657_10083443 3300025919 Bacteria 2681
99 Ga0207681_10250376 3300025923 Bacteria 1383
100 Ga0207687_10158642 3300025927 Bacteria 1734
101 Ga0207690_10716185 3300025932 Bacteria 823
102 Ga0207706_10088990 3300025933 Bacteria 2714
103 Ga0207706_10315603 3300025933 Bacteria 1361
104 Ga0207686_10700454 3300025934 Bacteria 805
105 Ga0207709_10039457 3300025935 Bacteria 2820
106 Ga0207709_10576880 3300025935 Bacteria 888
107 Ga0207670_10195804 3300025936 Bacteria 1532
108 Ga0207669_10105219 3300025937 Bacteria 1877
109 Ga0207704_10080140 3300025938 Bacteria 2107
110 Ga0207691_10327908 3300025940 Bacteria 1312
111 Ga0207689_10479842 3300025942 Bacteria 1041
112 Ga0207661_10719602 3300025944 Bacteria 918
113 Ga0207679_10241874 3300025945 Bacteria 1529
114 Ga0207712_10094853 3300025961 Bacteria 2205
115 Ga0207712_10629311 3300025961 Bacteria 931
116 Ga0207640_10158360 3300025981 Bacteria 1672
117 Ga0207677_10359713 3300026023 Bacteria 1222
118 Ga0207703_10466130 3300026035 Bacteria 1182
119 Ga0207639_10264790 3300026041 Bacteria 1505
120 Ga0207708_10007220 3300026075 Bacteria 8214
121 Ga0207683_10372307 3300026121 Bacteria 1312
122 Ga0268266_10041361 3300028379 Bacteria 3932
123 Ga0268265_10085381 3300028380 Bacteria 2505
124 Ga0268264_11582325 3300028381 Bacteria 666
125 Ga0307405_10032601 3300031731 Bacteria 3081
126 Ga0307413_10252757 3300031824 Bacteria 1309
127 Ga0307406_10266993 3300031901 Bacteria 1298
128 Ga0307407_10071451 3300031903 Bacteria 2066
129 Ga0307412_10270709 3300031911 Bacteria 1329
130 Ga0307409_101169728 3300031995 Bacteria 792
131 Ga0307416_100037806 3300032002 Bacteria 3719
132 Ga0307415_100730355 3300032126 Bacteria 897
133 Ga0395900_0003919 3300037418 Bacteria 15892
134 Ga0395900_0061989 3300037418 Bacteria 3845
135 Ga0395900_1195768 3300037418 Bacteria 676
136 Ga0395898_0025350 3300037466 Bacteria 5976
137 Ga0395898_0598212 3300037466 Bacteria 1045
138 Ga0395905_0110585 3300037471 Bacteria 2580
139 Ga0395901_0013627 3300038443 Bacteria 8266
140 Ga0395901_0076083 3300038443 Bacteria 3502
141 Ga0395901_0985416 3300038443 Bacteria 820
142 Ga0436365_1508143 3300039437 Bacteria 2830
143 Ga0451853_1278942 3300041512 Bacteria 1241
144 Ga0466969_0021906 3300044656 Bacteria 3303
145 Ga0466969_0039288 3300044656 Bacteria 2377
146 Ga0466965_0198787 3300044683 Bacteria 1063
147 Ga0466966_0029362 3300044684 Bacteria 3578
148 Ga0466966_0036591 3300044684 Bacteria 3169
149 Ga0466961_0000956 3300044693 Bacteria 17868
150 Ga0466961_0316128 3300044693 Bacteria 953
151 Ga0466963_0080754 3300044694 Bacteria 2202
152 Ga0466963_0449138 3300044694 Bacteria 910
153 Ga0466964_0081247 3300044706 Bacteria 1392
154 Ga0466968_0071415 3300044735 Bacteria 1512
155 Ga0466968_0127654 3300044735 Bacteria 1155
156 Ga0466970_0322884 3300044765 Bacteria 873
157 Ga0466960_0011531 3300044901 Bacteria 3702
158 Ga0466960_0042044 3300044901 Bacteria 2168
159 Ga0466960_0098412 3300044901 Bacteria 1502
160 Ga0466959_0118880 3300045049 Bacteria 1880
161 Ga0466959_0267615 3300045049 Bacteria 1175
162 Ga0466958_0145138 3300045836 Bacteria 1495
163 Ga0466967_0003470 3300045976 Bacteria 10294
164 Ga0466967_0081255 3300045976 Bacteria 2927
165 Ga0466967_0692141 3300045976 Bacteria 1009
166 Ga0466967_0761700 3300045976 Bacteria 960
167 Ga0495584_0084901 3300046491 Bacteria 1595
168 Ga0495596_0073053 3300046500 Bacteria 1332
169 Ga0495607_0335255 3300046501 Bacteria 702
170 Ga0495642_0196269 3300046528 Bacteria 880
171 Ga0495609_0120397 3300046538 Bacteria 1129
172 Ga0495597_0145603 3300046542 Bacteria 975
173 Ga0495613_0472081 3300046689 Bacteria 848
174 Ga0496100_0051537 3300048903 Bacteria 2672
175 Ga0496100_0248687 3300048903 Bacteria 1314
176 Ga0496100_0541047 3300048903 Bacteria 900
177 Ga0496101_0003496 3300048904 Bacteria 9803
178 Ga0496101_0656846 3300048904 Bacteria 828
179 Ga0496102_0007601 3300048905 Bacteria 9261
180 Ga0496102_0269042 3300048905 Bacteria 1607
181 Ga0496102_0469907 3300048905 Bacteria 1179
182 Ga0496103_0041248 3300048906 Bacteria 2837
183 Ga0496104_0462695 3300048907 Bacteria 1180
184 Ga0496104_0484912 3300048907 Bacteria 1147
185 Ga0496105_0305372 3300048908 Bacteria 1278
186 Ga0496106_0001712 3300048909 Bacteria 16367
187 Ga0496107_0003028 3300048910 Bacteria 11140
188 Ga0496108_0212256 3300048911 Bacteria 1680
189 Ga0496111_0070353 3300048914 Bacteria 2545
190 Ga0496111_0176844 3300048914 Bacteria 1586
191 Ga0496112_0231988 3300048915 Bacteria 1800
192 Ga0496112_0375037 3300048915 Bacteria 1364
193 Ga0496112_1530462 3300048915 Bacteria 581
194 Ga0496113_0068121 3300048916 Bacteria 2700
195 Ga0496113_0116277 3300048916 Bacteria 2087
196 Ga0496114_0110051 3300048917 Bacteria 2359
197 Ga0496115_0135511 3300048918 Bacteria 2030
198 Ga0496115_0206421 3300048918 Bacteria 1623
199 Ga0501034_0399822 3300049571 Bacteria 1297
200 Ga0501036_0439945 3300049572 Bacteria 1086
201 Ga0501039_0511873 3300049575 Bacteria 942
202 Ga0501040_0099854 3300049576 Bacteria 2023
203 Ga0501042_0296316 3300049578 Bacteria 1168
204 Ga0501042_0337731 3300049578 Bacteria 1089
205 Ga0501069_0260918 3300049585 Bacteria 1012
206 Ga0501072_0150111 3300049588 Bacteria 1858
207 Ga0501074_0077515 3300049590 Bacteria 2385
208 Ga0501075_0148134 3300049591 Bacteria 1789
209 Ga0501080_0389922 3300049742 Bacteria 1254
210 nmdc:mga05p37_278100_c1 3300050507 Bacteria 1997
211 nmdc:mga05p37_44905_c1 3300050507 Bacteria 5436
212 nmdc:mga08y16_393181_c1 3300050511 Bacteria 1420
213 nmdc:mga0n895_22563_c1 3300050512 Bacteria 5903
214 nmdc:mga0rr50_394791_c1 3300050513 Bacteria 1168
215 nmdc:mga0a205_23571_c1 3300050515 Bacteria 5838
216 Ga0495655_0056962 3300053083 Bacteria 1053
217 Ga0495595_0202392 3300053084 Bacteria 989
218 Ga0500627_0229670 3300053158 Bacteria 826
219 Ga0070699_100531830
220 JGI25406J46586_10015253
221 JGI25406J46586_10035235
222 Ga0070683_100020448
223 Ga0068869_100709316
224 Ga0070682_100151752
225 Ga0070682_100172178
226 Ga0070682_100362116
227 Ga0070682_100391799
228 Ga0070660_100035508
229 Ga0070668_100173492
230 Ga0070668_100863939
231 Ga0070669_100370759
232 Ga0070674_100438351
233 Ga0070673_100776359
234 Ga0070688_100121326
235 Ga0070659_100107535
236 Ga0070714_100165277
237 Ga0070714_100362640
238 Ga0070710_10027177
239 Ga0070701_10099883
240 Ga0070705_100067405
241 Ga0070700_100028981
242 Ga0070663_100432349
243 Ga0070678_100721366
244 Ga0070662_100444220
245 Ga0068867_100266095
246 Ga0070679_100594550
247 Ga0068853_100192483
248 Ga0070686_100155045
249 Ga0070665_100002397
250 Ga0068857_100157781
251 Ga0068857_100456608
252 Ga0068854_100796342
253 Ga0070702_100038649
254 Ga0070702_100195171
255 Ga0068859_100132790
256 Ga0068866_10021908
257 Ga0068861_100081113
258 Ga0068870_10062810
259 Ga0068858_100543854
260 Ga0068860_100621887
261 Ga0068862_100026457
262 Ga0081455_10019352
263 Ga0081538_10002867
264 Ga0081538_10027364
265 Ga0081538_10032725
266 Ga0081538_10087726
267 Ga0081539_10003115
268 Ga0081539_10004464
269 Ga0070717_10073546
270 Ga0070715_10100440
271 Ga0070712_100283143
272 Ga0097621_100315002
273 Ga0075433_10155186
274 Ga0075434_100264274
275 Ga0075429_100836211
276 Ga0068865_100102941
277 Ga0075436_100332487
278 Ga0097620_100132804
279 Ga0075435_100147152
280 Ga0105240_10881363
281 Ga0105245_10202785
282 Ga0105245_10735456
283 Ga0105245_11075466
284 Ga0105247_10327940
285 Ga0114129_10053713
286 Ga0114129_10831381
287 Ga0105243_11479669
288 Ga0105242_10201658
289 Ga0105242_10488608
290 Ga0105242_10687941
291 Ga0105248_10496694
292 Ga0105248_10812345
293 Ga0105237_10700497
294 Ga0105249_10277694
295 Ga0105249_10533726
296 Ga0105239_11135761
297 Ga0105239_11969551
298 Ga0105246_10125885
299 Ga0157374_10431137
300 Ga0163162_11217537
301 Ga0157372_11278724
302 Ga0157375_10732943
303 Ga0157379_10217304
304 Ga0213876_10006153
305 Ga0207642_10027903
306 Ga0207710_10040032
307 Ga0207688_10042310
308 Ga0207647_10283203
309 Ga0207645_10196325
310 Ga0207643_10037839
311 Ga0207705_10579991
312 Ga0207671_10368595
313 Ga0207693_10237012
314 Ga0207662_10085903
315 Ga0207657_10003986
316 Ga0207657_10083443
317 Ga0207681_10250376
318 Ga0207687_10158642
319 Ga0207690_10716185
320 Ga0207706_10088990
321 Ga0207706_10315603
322 Ga0207686_10700454
323 Ga0207709_10039457
324 Ga0207709_10576880
325 Ga0207670_10195804
326 Ga0207669_10105219
327 Ga0207704_10080140
328 Ga0207691_10327908
329 Ga0207689_10479842
330 Ga0207661_10719602
331 Ga0207679_10241874
332 Ga0207712_10094853
333 Ga0207712_10629311
334 Ga0207640_10158360
335 Ga0207677_10359713
336 Ga0207703_10466130
337 Ga0207639_10264790
338 Ga0207708_10007220
339 Ga0207683_10372307
340 Ga0268266_10041361
341 Ga0268265_10085381
342 Ga0268264_11582325
343 Ga0307405_10032601
344 Ga0307413_10252757
345 Ga0307406_10266993
346 Ga0307407_10071451
347 Ga0307412_10270709
348 Ga0307409_101169728
349 Ga0307416_100037806
350 Ga0307415_100730355
351 Ga0395900_0003919
352 Ga0395900_0061989
353 Ga0395900_1195768
354 Ga0395898_0025350
355 Ga0395898_0598212
356 Ga0395905_0110585
357 Ga0395901_0013627
358 Ga0395901_0076083
359 Ga0395901_0985416
360 Ga0436365_1508143
361 Ga0451853_1278942
362 Ga0466969_0021906
363 Ga0466969_0039288
364 Ga0466965_0198787
365 Ga0466966_0029362
366 Ga0466966_0036591
367 Ga0466961_0000956
368 Ga0466961_0316128
369 Ga0466963_0080754
370 Ga0466963_0449138
371 Ga0466964_0081247
372 Ga0466968_0071415
373 Ga0466968_0127654
374 Ga0466970_0322884
375 Ga0466960_0011531
376 Ga0466960_0042044
377 Ga0466960_0098412
378 Ga0466959_0118880
379 Ga0466959_0267615
380 Ga0466958_0145138
381 Ga0466967_0003470
382 Ga0466967_0081255
383 Ga0466967_0692141
384 Ga0466967_0761700
385 Ga0495584_0084901
386 Ga0495596_0073053
387 Ga0495607_0335255
388 Ga0495642_0196269
389 Ga0495609_0120397
390 Ga0495597_0145603
391 Ga0495613_0472081
392 Ga0496100_0051537
393 Ga0496100_0248687
394 Ga0496100_0541047
395 Ga0496101_0003496
396 Ga0496101_0656846
397 Ga0496102_0007601
398 Ga0496102_0269042
399 Ga0496102_0469907
400 Ga0496103_0041248
401 Ga0496104_0462695
402 Ga0496104_0484912
403 Ga0496105_0305372
404 Ga0496106_0001712
405 Ga0496107_0003028
406 Ga0496108_0212256
407 Ga0496111_0070353
408 Ga0496111_0176844
409 Ga0496112_0231988
410 Ga0496112_0375037
411 Ga0496112_1530462
412 Ga0496113_0068121
413 Ga0496113_0116277
414 Ga0496114_0110051
415 Ga0496115_0135511
416 Ga0496115_0206421
417 Ga0501034_0399822
418 Ga0501036_0439945
419 Ga0501039_0511873
420 Ga0501040_0099854
421 Ga0501042_0296316
422 Ga0501042_0337731
423 Ga0501069_0260918
424 Ga0501072_0150111
425 Ga0501074_0077515
426 Ga0501075_0148134
427 Ga0501080_0389922
428 nmdc:mga05p37_278100_c1
429 nmdc:mga05p37_44905_c1
430 nmdc:mga08y16_393181_c1
431 nmdc:mga0n895_22563_c1
432 nmdc:mga0rr50_394791_c1
433 nmdc:mga0a205_23571_c1
434 Ga0495655_0056962
435 Ga0495595_0202392
436 Ga0500627_0229670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

41

114

0.99

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

128

215

0.96

PF03819

MazG

MazG nucleotide pyrophosphohydrolase domain

154

217

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c90-assembly1.cif.gz_X the 1.25 a resolution structure of phosphoribosyl-atp pyrophosphohydrolase from mycobacterium tuberculosis, crystal form ii 0.9528 110 190
7aoi-assembly1.cif.gz_XF trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.9365 137 180
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9256 8 194
1yvw-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13. 0.9242 110 196
6j2l-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9211 8 194
ID Description Score Start End Superfamily
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9884 10 89 3.10.20.810
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9787 3 89 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9725 3 89 3.10.20.810
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9721 8 89 3.10.20.810
af_K7K2K1_122_247_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9599 140 181 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A7K4FBC3-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9916 8 78 GO:0000105
GO:0004635
AF-A0A7W1SMB6-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9907 3 84 GO:0000105
GO:0004635
AF-A0A534WIR8-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9901 9 83 GO:0000105
GO:0004635
AF-A0A3B8R6N5-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9893 3 97 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A1V5SDG1-F1-model_v4 deleted 0.9876 1 97

Map