F329493

General Info

Members Datasets Scaffolds Average Seq Length
218 145 194 321

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10070547|Ga0065704_100705476
Length 362
Sequence MLGDDSLLHLSWARPGRWRVLYHKDDVEIFGCVYAVGECGLSHKKTVFVTGASGFVGSALIEHLVSTGSYQVLALVRRDGVVLPSDAIPVRVSEDYLAGEALPFAGVDALIHCGARVHVMSDTTSDPLAEYRKVNVQGTLRLAAQAAQAGVKRFIFISSIKVNGEGTQLGQPYTADDLPAPCDPYGISKMEAEQQLRLLSQETGMEVVIIRPVLVYGPGVKANFRKMMEWLNKGVALPLGAIHNRRSLVALDNLVDLIVTCLHHPAAANQTFLVSDDDDMSTSELLTRIGKALAKPARLIPVPATLLQWCMILIGRRGVGQRVCGSLQVDIKKTRDLLGWTPPSTVAVALRKTVECFKGNLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
3 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
4 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
5 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
6 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
7 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
8 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
9 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
10 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
11 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
12 2773857670 Pseudomonas sp. 478 Isolate Unclassified
13 2784132072 Pseudomonas sp. 460 Isolate Unclassified
14 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
15 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
16 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
17 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
18 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
19 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
20 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
21 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
22 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
23 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
24 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
27 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
94 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
95 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
99 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
100 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
101 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
102 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
103 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.99
Metatranscriptomes 0
Isolates 11.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.97
Nodule 0
Rhizoplane 2.75
Rhizosphere 62.39
Stem 0
Stem Tuber 0
Unclassified 17.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1029818 2162886007 Bacteria 7475
2 JGI25162J39368_1000330 3300002737 Bacteria 41675
3 JGI25163J39215_1000287 3300002771 Bacteria 17355
4 JGI25164J39214_1000251 3300002772 Bacteria 40327
5 JGI25150J39212_1001524 3300002774 Bacteria 6373
6 JGI25159J45721_1000247 3300002987 Bacteria 25599
7 JGI25151J46595_10000792 3300003187 Bacteria 25467
8 JGI25165J46597_1000362 3300003214 Bacteria 50814
9 Ga0055526_1000217 3300003771 Bacteria 49719
10 Ga0055537_1000029 3300003773 Bacteria 101797
11 Ga0055524_1000040 3300003775 Bacteria 157409
12 Ga0055536_1000265 3300003781 Bacteria 40334
13 Ga0055536_1000611 3300003781 Bacteria 24357
14 Ga0055534_1000271 3300003784 Bacteria 35350
15 Ga0055528_1000233 3300003790 Bacteria 46503
16 Ga0055530_10000143 3300003791 Bacteria 63940
17 Ga0055530_10000493 3300003791 Bacteria 34162
18 Ga0055540_1000030 3300003792 Bacteria 177871
19 Ga0055531_10000720 3300003794 Bacteria 28176
20 Ga0065714_10002559 3300005288 Bacteria 17358
21 Ga0065714_10064906 3300005288 Bacteria 15783
22 Ga0065714_10090422 3300005288 Bacteria 1944
23 Ga0065714_10134405 3300005288 Bacteria 1222
24 Ga0065704_10070439 3300005289 Bacteria 24843
25 Ga0065704_10070547 3300005289 Bacteria 20984
26 Ga0065704_10070851 3300005289 Bacteria 15396
27 Ga0065704_10076772 3300005289 Bacteria 4982
28 Ga0070661_100000132 3300005344 Bacteria 62286
29 Ga0068855_100008592 3300005563 Bacteria 12345
30 Ga0070664_100000361 3300005564 Bacteria 33502
31 Ga0075432_10052653 3300006058 Bacteria 1438
32 Ga0105251_10000316 3300009011 Bacteria 48415
33 Ga0105251_10000751 3300009011 Bacteria 29613
34 Ga0105251_10001003 3300009011 Bacteria 24715
35 Ga0105251_10004810 3300009011 Bacteria 9034
36 Ga0105251_10079895 3300009011 Bacteria 1513
37 Ga0105244_10001592 3300009036 Bacteria 18035
38 Ga0105244_10024973 3300009036 Bacteria 3254
39 Ga0105250_10000586 3300009092 Bacteria 23882
40 Ga0105250_10001630 3300009092 Bacteria 11995
41 Ga0105250_10008192 3300009092 Bacteria 4450
42 Ga0105240_10426107 3300009093 Bacteria 1490
43 Ga0105243_10004552 3300009148 Bacteria 10950
44 Ga0157373_10022593 3300013100 Bacteria 4562
45 Ga0157371_10005772 3300013102 Bacteria 10368
46 Ga0157370_10023259 3300013104 Bacteria 6153
47 Ga0157369_10003354 3300013105 Bacteria 19017
48 Ga0157369_10091306 3300013105 Bacteria 3251
49 Ga0163162_10001271 3300013306 Bacteria 23584
50 Ga0163162_10002482 3300013306 Bacteria 17428
51 Ga0163162_10002990 3300013306 Bacteria 16150
52 Ga0157375_10109476 3300013308 Bacteria 2859
53 Ga0182008_10001249 3300014497 Bacteria 17458
54 Ga0182008_10001899 3300014497 Bacteria 13520
55 Ga0182008_10002796 3300014497 Bacteria 10799
56 Ga0182008_10011247 3300014497 Bacteria 4769
57 Ga0182006_1001509 3300015261 Bacteria 13942
58 Ga0182006_1069241 3300015261 Bacteria 1312
59 Ga0182007_10001349 3300015262 Bacteria 13236
60 Ga0182007_10011218 3300015262 Bacteria 3496
61 Ga0182005_1000325 3300015265 Bacteria 28280
62 Ga0182005_1000858 3300015265 Bacteria 13520
63 Ga0163161_10001454 3300017792 Bacteria 17494
64 Ga0163161_10002080 3300017792 Bacteria 14504
65 Ga0163161_10004889 3300017792 Bacteria 9336
66 Ga0209760_100043 3300025207 Bacteria 113964
67 Ga0207427_100082 3300025231 Bacteria 142809
68 Ga0209437_100006 3300025233 Bacteria 1042724
69 Ga0207425_1005258 3300025245 Bacteria 3721
70 Ga0209233_1000105 3300025261 Bacteria 272035
71 Ga0209565_1000026 3300025263 Bacteria 365910
72 Ga0209673_1000009 3300025273 Bacteria 620735
73 Ga0209673_1000012 3300025273 Bacteria 579480
74 Ga0209130_1000123 3300025284 Bacteria 125840
75 Ga0209675_1000155 3300025291 Bacteria 89020
76 Ga0209676_1000051 3300025292 Bacteria 389016
77 Ga0209676_1000223 3300025292 Bacteria 124359
78 Ga0209025_1002109 3300025294 Bacteria 22421
79 Ga0209564_1000228 3300025295 Bacteria 125206
80 Ga0209050_1000044 3300025298 Bacteria 391114
81 Ga0209256_1000003 3300025299 Bacteria 1661127
82 Ga0207426_1002599 3300025302 Bacteria 11211
83 Ga0209051_1000031 3300025303 Bacteria 391114
84 Ga0209257_1000058 3300025304 Bacteria 381686
85 Ga0207696_1000606 3300025711 Bacteria 26792
86 Ga0207696_1001711 3300025711 Bacteria 11378
87 Ga0207696_1024159 3300025711 Bacteria 1908
88 Ga0207655_1000005 3300025728 Bacteria 917277
89 Ga0207655_1000015 3300025728 Bacteria 600662
90 Ga0207655_1000744 3300025728 Bacteria 36545
91 Ga0207655_1001019 3300025728 Bacteria 28341
92 Ga0207713_1000769 3300025735 Bacteria 29621
93 Ga0207713_1001283 3300025735 Bacteria 20705
94 Ga0207713_1003387 3300025735 Bacteria 10909
95 Ga0207713_1014592 3300025735 Bacteria 4073
96 Ga0207713_1074761 3300025735 Bacteria 1238
97 Ga0207649_10000002 3300025920 Bacteria 498633
98 Ga0207709_10001759 3300025935 Bacteria 14567
99 Ga0207679_10000006 3300025945 Bacteria 498868
100 Ga0207667_10012439 3300025949 Bacteria 9806
101 Ga0209371_1000338 3300027312 Bacteria 51239
102 Ga0265338_10000110 3300028800 Bacteria 152188
103 Ga0268256_1000289 3300030500 Bacteria 51239
104 Ga0307408_100000779 3300031548 Bacteria 25638
105 Ga0395898_0002528 3300037466 Bacteria 21474
106 Ga0395901_0001985 3300038443 Bacteria 21042
107 Ga0400483_167309 3300039062 Bacteria 1329
108 Ga0439438_011783 3300041405 Bacteria 2707
109 Ga0439438_014291 3300041405 Bacteria 2367
110 Ga0439447_002542 3300041407 Bacteria 6636
111 Ga0439466_0000134 3300041411 Bacteria 29203
112 Ga0439466_0001273 3300041411 Bacteria 9796
113 Ga0439432_007517 3300042006 Bacteria 3861
114 Ga0439451_000029 3300042009 Bacteria 31111
115 Ga0439451_000087 3300042009 Bacteria 16419
116 Ga0439452_000238 3300042010 Bacteria 38069
117 Ga0439452_003224 3300042010 Bacteria 5772
118 Ga0439463_003835 3300042016 Bacteria 3792
119 Ga0439463_025320 3300042016 Bacteria 1488
120 Ga0450898_001238 3300042134 Bacteria 3311
121 Ga0450899_001745 3300042135 Bacteria 2413
122 Ga0450904_000187 3300042139 Bacteria 13562
123 Ga0450904_000709 3300042139 Bacteria 5911
124 Ga0439446_0001709 3300042156 Bacteria 5090
125 Ga0451576_0000724 3300045051 Bacteria 66525
126 Ga0495627_000798 3300046453 Bacteria 23016
127 Ga0495590_0000338 3300046457 Bacteria 24377
128 Ga0495591_000210 3300046458 Bacteria 59177
129 Ga0495638_0015938 3300046460 Bacteria 5037
130 Ga0495584_0002205 3300046491 Bacteria 11109
131 Ga0495585_0011911 3300046492 Bacteria 5136
132 Ga0495596_0001869 3300046500 Bacteria 11678
133 Ga0495607_0000195 3300046501 Bacteria 64300
134 Ga0495607_0001014 3300046501 Bacteria 25836
135 Ga0495607_0011643 3300046501 Bacteria 5846
136 Ga0495606_0000553 3300046507 Bacteria 59889
137 Ga0495606_0002169 3300046507 Bacteria 23618
138 Ga0495606_0002199 3300046507 Bacteria 23384
139 Ga0495610_0001566 3300046512 Bacteria 20155
140 Ga0495632_0001447 3300046519 Bacteria 19728
141 Ga0495632_0003947 3300046519 Bacteria 10296
142 Ga0495637_0000574 3300046520 Bacteria 26147
143 Ga0495644_0000192 3300046523 Bacteria 28718
144 Ga0495648_0000600 3300046524 Bacteria 38533
145 Ga0495648_0015665 3300046524 Bacteria 5492
146 Ga0495654_0000711 3300046530 Bacteria 26011
147 Ga0495597_0000822 3300046542 Bacteria 24434
148 Ga0495597_0001347 3300046542 Bacteria 17834
149 Ga0495611_0025418 3300046648 Bacteria 2581
150 Ga0495588_0039552 3300046674 Bacteria 2403
151 Ga0495671_0000341 3300046692 Bacteria 38904
152 Ga0495649_0000913 3300046694 Bacteria 23330
153 Ga0495649_0000926 3300046694 Bacteria 23257
154 Ga0495589_0000504 3300046794 Bacteria 27610
155 Ga0495660_0000971 3300046810 Bacteria 20957
156 Ga0495660_0001190 3300046810 Bacteria 18276
157 Ga0495660_0019113 3300046810 Bacteria 3934
158 Ga0495660_0135136 3300046810 Bacteria 1233
159 Ga0495672_0001671 3300047320 Bacteria 21512
160 Ga0495679_000812 3300047446 Bacteria 19836
161 Ga0495681_0000304 3300047470 Bacteria 39427
162 Ga0495681_0002623 3300047470 Bacteria 12776
163 Ga0495681_0011575 3300047470 Bacteria 5243
164 Ga0495626_0012798 3300048091 Bacteria 4381
165 Ga0496115_0000723 3300048918 Bacteria 24444
166 Ga0496116_0000532 3300048919 Bacteria 51124
167 Ga0496116_0001782 3300048919 Bacteria 23403
168 Ga0496117_0001050 3300048920 Bacteria 42088
169 Ga0496117_0001815 3300048920 Bacteria 29016
170 Ga0496117_0002469 3300048920 Bacteria 23223
171 Ga0496118_0002174 3300048921 Bacteria 27294
172 Ga0496118_0002659 3300048921 Bacteria 23639
173 Ga0496118_0009905 3300048921 Bacteria 9525
174 Ga0496118_0013224 3300048921 Bacteria 7827
175 Ga0496118_0024896 3300048921 Bacteria 5151
176 Ga0496119_0001356 3300048922 Bacteria 29915
177 Ga0496120_0001399 3300048923 Bacteria 29187
178 Ga0496121_0002497 3300048924 Bacteria 27960
179 Ga0496121_0002844 3300048924 Bacteria 25542
180 Ga0496122_0002040 3300048925 Bacteria 29985
181 Ga0496122_0002170 3300048925 Bacteria 28749
182 Ga0496122_0003571 3300048925 Bacteria 20294
183 Ga0496122_0004377 3300048925 Bacteria 17599
184 Ga0496123_0001660 3300048926 Bacteria 29864
185 Ga0496123_0001722 3300048926 Bacteria 29076
186 Ga0496123_0002412 3300048926 Bacteria 23311
187 Ga0496124_0000699 3300048927 Bacteria 54987
188 Ga0496124_0004905 3300048927 Bacteria 15378
189 Ga0496125_0000714 3300048928 Bacteria 54950
190 Ga0496125_0002952 3300048928 Bacteria 21374
191 Ga0496125_0022710 3300048928 Bacteria 5816
192 Ga0496125_0052027 3300048928 Bacteria 3371
193 Ga0496126_0002379 3300048929 Bacteria 25600
194 Ga0495682_0006562 3300049460 Bacteria 4701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0052027 Ga0496125_0052027_2124_2933 269
2 3300005563 Ga0068855_100008592 Ga0068855_1000085925 293
3 3300009093 Ga0105240_10426107 Ga0105240_104261071 293
4 3300025949 Ga0207667_10012439 Ga0207667_100124395 293
5 3300009011 Ga0105251_10000316 Ga0105251_1000031614 295
6 3300025728 Ga0207655_1000005 Ga0207655_100000531 295
7 3300025728 Ga0207655_1000015 Ga0207655_1000015120 295
8 3300025735 Ga0207713_1001283 Ga0207713_100128311 295
9 3300009011 Ga0105251_10004810 Ga0105251_100048104 297
10 3300009092 Ga0105250_10001630 Ga0105250_100016305 297
11 3300046460 Ga0495638_0015938 Ga0495638_0015938_1840_2736 297
12 3300046519 Ga0495632_0003947 Ga0495632_0003947_4944_5840 297
13 3300046507 Ga0495606_0000553 Ga0495606_0000553_42274_43230 299
14 3300046694 Ga0495649_0000926 Ga0495649_0000926_6153_7109 299
15 3300042016 Ga0439463_025320 Ga0439463_025320_552_1454 300
16 iso_pu_bacteria 2919534386 2919537065 300
17 3300042134 Ga0450898_001238 Ga0450898_001238_26_934 301
18 3300031548 Ga0307408_100000779 Ga0307408_10000077915 302
19 3300042006 Ga0439432_007517 Ga0439432_007517_1764_2675 302
20 3300042009 Ga0439451_000087 Ga0439451_000087_11002_11913 302
21 3300042010 Ga0439452_003224 Ga0439452_003224_1355_2266 302
22 3300015261 Ga0182006_1069241 Ga0182006_10692411 305
23 3300048918 Ga0496115_0000723 Ga0496115_0000723_10104_11072 306
24 3300005288 Ga0065714_10090422 Ga0065714_100904222 308
25 3300009011 Ga0105251_10001003 Ga0105251_100010037 308
26 3300025735 Ga0207713_1003387 Ga0207713_10033877 308
27 3300046523 Ga0495644_0000192 Ga0495644_0000192_22831_23793 308
28 iso_pu_bacteria 2648501241 2649122173 308
29 3300028800 Ga0265338_10000110 Ga0265338_1000011034 309
30 iso_pu_bacteria 2690315857 2691331802 309
31 3300027312 Ga0209371_1000338 Ga0209371_100033823 310
32 3300030500 Ga0268256_1000289 Ga0268256_100028923 310
33 iso_pu_bacteria 2902682994 2902683302 310
34 3300039062 Ga0400483_167309 Ga0400483_167309_105_1058 312
35 3300042139 Ga0450904_000709 Ga0450904_000709_4892_5854 312
36 iso_pu_bacteria 2946006987 2946011229 314
37 iso_pu_bacteria 2606217733 2608381597 315
38 iso_pu_bacteria 2738541294 2738809685 315
39 iso_pu_bacteria 2738541309 2738897045 315
40 iso_pu_bacteria 2852667396 2852669862 315
41 iso_pu_bacteria 2773857670 2774121239 316
42 iso_pu_bacteria 2784132072 2784316569 316
43 iso_pu_bacteria 3007803356 3007807425 316
44 3300002737 JGI25162J39368_1000330 JGI25162J39368_100033010 317
45 3300002771 JGI25163J39215_1000287 JGI25163J39215_10002878 317
46 3300002772 JGI25164J39214_1000251 JGI25164J39214_10002518 317
47 3300003214 JGI25165J46597_1000362 JGI25165J46597_10003629 317
48 3300003773 Ga0055537_1000029 Ga0055537_100002982 317
49 3300003775 Ga0055524_1000040 Ga0055524_100004050 317
50 3300003791 Ga0055530_10000493 Ga0055530_1000049314 317
51 3300003792 Ga0055540_1000030 Ga0055540_1000030108 317
52 3300009148 Ga0105243_10004552 Ga0105243_1000455210 317
53 3300025207 Ga0209760_100043 Ga0209760_1000439 317
54 3300025231 Ga0207427_100082 Ga0207427_10008233 317
55 3300025233 Ga0209437_100006 Ga0209437_100006165 317
56 3300025261 Ga0209233_1000105 Ga0209233_1000105146 317
57 3300025294 Ga0209025_1002109 Ga0209025_100210911 317
58 3300025935 Ga0207709_10001759 Ga0207709_1000175913 317
59 3300037466 Ga0395898_0002528 Ga0395898_0002528_13695_14654 317
60 3300038443 Ga0395901_0001985 Ga0395901_0001985_6821_7780 317
61 3300048919 Ga0496116_0000532 Ga0496116_0000532_8188_9168 317
62 3300048920 Ga0496117_0001050 Ga0496117_0001050_8117_9097 317
63 3300048921 Ga0496118_0024896 Ga0496118_0024896_4122_5102 317
64 iso_pu_bacteria 2554235341 2555671317 317
65 iso_pu_bacteria 2599185302 2599941829 317
66 iso_pu_bacteria 2599185304 2599952651 317
67 iso_pu_bacteria 2599185316 2600022646 317
68 iso_pu_bacteria 2599185325 2600075921 317
69 iso_pu_bacteria 2825651385 2825653073 317
70 iso_pu_bacteria 2913036834 2913038553 317
71 iso_pu_bacteria 2917070673 2917075181 317
72 iso_pu_bacteria 2935353572 2935356169 317
73 iso_pu_bacteria 8056172158 8056173245 317
74 3300005288 Ga0065714_10134405 Ga0065714_101344052 318
75 3300005289 Ga0065704_10070851 Ga0065704_1007085111 318
76 3300006058 Ga0075432_10052653 Ga0075432_100526532 318
77 3300013306 Ga0163162_10002482 Ga0163162_1000248212 318
78 3300042156 Ga0439446_0001709 Ga0439446_0001709_1295_2254 318
79 3300045051 Ga0451576_0000724 Ga0451576_0000724_30687_31646 318
80 3300046492 Ga0495585_0011911 Ga0495585_0011911_1026_1985 318
81 3300046507 Ga0495606_0002169 Ga0495606_0002169_2420_3379 318
82 3300046519 Ga0495632_0001447 Ga0495632_0001447_13945_14904 318
83 3300046794 Ga0495589_0000504 Ga0495589_0000504_14015_14974 318
84 3300047320 Ga0495672_0001671 Ga0495672_0001671_8004_8966 318
85 3300047446 Ga0495679_000812 Ga0495679_000812_3987_4946 318
86 3300048091 Ga0495626_0012798 Ga0495626_0012798_2760_3722 318
87 3300048921 Ga0496118_0009905 Ga0496118_0009905_3774_4733 318
88 3300048922 Ga0496119_0001356 Ga0496119_0001356_13960_14919 318
89 3300048923 Ga0496120_0001399 Ga0496120_0001399_14776_15735 318
90 3300048925 Ga0496122_0003571 Ga0496122_0003571_16877_17836 318
91 3300048927 Ga0496124_0000699 Ga0496124_0000699_14121_15080 318
92 3300048928 Ga0496125_0000714 Ga0496125_0000714_14020_14979 318
93 iso_pu_bacteria 2947233263 2947236411 318
94 iso_pu_bacteria 2974289157 2974289915 318
95 3300005288 Ga0065714_10002559 Ga0065714_100025596 319
96 3300005289 Ga0065704_10070547 Ga0065704_100705476 319
97 3300005289 Ga0065704_10076772 Ga0065704_100767722 319
98 3300005344 Ga0070661_100000132 Ga0070661_10000013224 319
99 3300005564 Ga0070664_100000361 Ga0070664_10000036112 319
100 3300009011 Ga0105251_10000751 Ga0105251_100007514 319
101 3300009036 Ga0105244_10001592 Ga0105244_100015924 319
102 3300009092 Ga0105250_10008192 Ga0105250_100081922 319
103 3300013105 Ga0157369_10003354 Ga0157369_100033545 319
104 3300013306 Ga0163162_10001271 Ga0163162_1000127121 319
105 3300014497 Ga0182008_10001249 Ga0182008_100012494 319
106 3300015265 Ga0182005_1000325 Ga0182005_100032513 319
107 3300017792 Ga0163161_10004889 Ga0163161_100048892 319
108 3300025711 Ga0207696_1024159 Ga0207696_10241592 319
109 3300025728 Ga0207655_1000744 Ga0207655_100074418 319
110 3300025735 Ga0207713_1000769 Ga0207713_100076927 319
111 3300025920 Ga0207649_10000002 Ga0207649_1000000225 319
112 3300025945 Ga0207679_10000006 Ga0207679_10000006466 319
113 3300041411 Ga0439466_0000134 Ga0439466_0000134_19195_20157 319
114 3300042135 Ga0450899_001745 Ga0450899_001745_198_1160 319
115 3300046453 Ga0495627_000798 Ga0495627_000798_13260_14228 319
116 3300046501 Ga0495607_0001014 Ga0495607_0001014_5029_5991 319
117 3300046512 Ga0495610_0001566 Ga0495610_0001566_14357_15325 319
118 3300046524 Ga0495648_0015665 Ga0495648_0015665_1662_2630 319
119 3300046648 Ga0495611_0025418 Ga0495611_0025418_605_1573 319
120 3300046674 Ga0495588_0039552 Ga0495588_0039552_1219_2181 319
121 3300046810 Ga0495660_0000971 Ga0495660_0000971_3442_4404 319
122 3300046810 Ga0495660_0135136 Ga0495660_0135136_48_1016 319
123 3300047470 Ga0495681_0002623 Ga0495681_0002623_10564_11532 319
124 3300047470 Ga0495681_0011575 Ga0495681_0011575_2991_3953 319
125 3300048920 Ga0496117_0001815 Ga0496117_0001815_6583_7671 319
126 3300048921 Ga0496118_0002174 Ga0496118_0002174_4862_5950 319
127 3300048924 Ga0496121_0002497 Ga0496121_0002497_21343_22431 319
128 3300048925 Ga0496122_0002040 Ga0496122_0002040_2791_3753 319
129 3300048926 Ga0496123_0001660 Ga0496123_0001660_26137_27099 319
130 3300048927 Ga0496124_0004905 Ga0496124_0004905_10842_11930 319
131 3300048928 Ga0496125_0002952 Ga0496125_0002952_13678_14646 319
132 3300048928 Ga0496125_0022710 Ga0496125_0022710_1395_2483 319
133 3300048929 Ga0496126_0002379 Ga0496126_0002379_3319_4407 319
134 3300049460 Ga0495682_0006562 Ga0495682_0006562_3034_3996 319
135 3300002774 JGI25150J39212_1001524 JGI25150J39212_10015244 320
136 3300002987 JGI25159J45721_1000247 JGI25159J45721_10002475 320
137 3300003187 JGI25151J46595_10000792 JGI25151J46595_100007929 320
138 3300003771 Ga0055526_1000217 Ga0055526_100021746 320
139 3300003781 Ga0055536_1000611 Ga0055536_100061115 320
140 3300003784 Ga0055534_1000271 Ga0055534_100027127 320
141 3300003790 Ga0055528_1000233 Ga0055528_100023341 320
142 3300003791 Ga0055530_10000143 Ga0055530_1000014310 320
143 3300003794 Ga0055531_10000720 Ga0055531_1000072018 320
144 3300009036 Ga0105244_10024973 Ga0105244_100249732 320
145 3300009092 Ga0105250_10000586 Ga0105250_100005864 320
146 3300013308 Ga0157375_10109476 Ga0157375_101094762 320
147 3300014497 Ga0182008_10001899 Ga0182008_100018993 320
148 3300015261 Ga0182006_1001509 Ga0182006_100150910 320
149 3300015262 Ga0182007_10001349 Ga0182007_100013499 320
150 3300015265 Ga0182005_1000858 Ga0182005_10008583 320
151 3300017792 Ga0163161_10002080 Ga0163161_100020804 320
152 3300025245 Ga0207425_1005258 Ga0207425_10052583 320
153 3300025263 Ga0209565_1000026 Ga0209565_1000026332 320
154 3300025273 Ga0209673_1000009 Ga0209673_1000009339 320
155 3300025273 Ga0209673_1000012 Ga0209673_1000012240 320
156 3300025284 Ga0209130_1000123 Ga0209130_100012314 320
157 3300025291 Ga0209675_1000155 Ga0209675_100015523 320
158 3300025292 Ga0209676_1000051 Ga0209676_1000051108 320
159 3300025295 Ga0209564_1000228 Ga0209564_100022834 320
160 3300025298 Ga0209050_1000044 Ga0209050_1000044238 320
161 3300025299 Ga0209256_1000003 Ga0209256_1000003494 320
162 3300025302 Ga0207426_1002599 Ga0207426_10025999 320
163 3300025303 Ga0209051_1000031 Ga0209051_1000031238 320
164 3300025304 Ga0209257_1000058 Ga0209257_1000058232 320
165 3300025711 Ga0207696_1000606 Ga0207696_100060622 320
166 3300041405 Ga0439438_011783 Ga0439438_011783_693_1667 320
167 3300041405 Ga0439438_014291 Ga0439438_014291_45_1010 320
168 3300041407 Ga0439447_002542 Ga0439447_002542_2054_3028 320
169 3300041411 Ga0439466_0001273 Ga0439466_0001273_6675_7649 320
170 3300042010 Ga0439452_000238 Ga0439452_000238_26430_27395 320
171 3300046692 Ga0495671_0000341 Ga0495671_0000341_27271_28236 320
172 3300046810 Ga0495660_0001190 Ga0495660_0001190_13217_14182 320
173 3300047470 Ga0495681_0000304 Ga0495681_0000304_30127_31092 320
174 3300048919 Ga0496116_0001782 Ga0496116_0001782_11595_12560 320
175 3300048920 Ga0496117_0002469 Ga0496117_0002469_11436_12401 320
176 3300048921 Ga0496118_0002659 Ga0496118_0002659_11151_12116 320
177 3300048925 Ga0496122_0004377 Ga0496122_0004377_11548_12513 320
178 3300048926 Ga0496123_0002412 Ga0496123_0002412_11528_12493 320
179 2162886007 SwRhRL2b_contig_1029818 SwRhRL2b_0881.00005210 321
180 3300003781 Ga0055536_1000265 Ga0055536_10002659 321
181 3300005288 Ga0065714_10064906 Ga0065714_100649069 321
182 3300005289 Ga0065704_10070439 Ga0065704_1007043918 321
183 3300009011 Ga0105251_10079895 Ga0105251_100798952 321
184 3300013100 Ga0157373_10022593 Ga0157373_100225931 321
185 3300013102 Ga0157371_10005772 Ga0157371_100057729 321
186 3300013104 Ga0157370_10023259 Ga0157370_100232591 321
187 3300013105 Ga0157369_10091306 Ga0157369_100913062 321
188 3300013306 Ga0163162_10002990 Ga0163162_100029908 321
189 3300014497 Ga0182008_10002796 Ga0182008_100027968 321
190 3300014497 Ga0182008_10011247 Ga0182008_100112473 321
191 3300015262 Ga0182007_10011218 Ga0182007_100112182 321
192 3300017792 Ga0163161_10001454 Ga0163161_100014549 321
193 3300025292 Ga0209676_1000223 Ga0209676_100022396 321
194 3300025711 Ga0207696_1001711 Ga0207696_10017116 321
195 3300025728 Ga0207655_1001019 Ga0207655_100101911 321
196 3300025735 Ga0207713_1014592 Ga0207713_10145922 321
197 3300025735 Ga0207713_1074761 Ga0207713_10747612 321
198 3300042009 Ga0439451_000029 Ga0439451_000029_4133_5098 321
199 3300042016 Ga0439463_003835 Ga0439463_003835_697_1668 321
200 3300042139 Ga0450904_000187 Ga0450904_000187_10666_11637 321
201 3300046457 Ga0495590_0000338 Ga0495590_0000338_19745_20710 321
202 3300046458 Ga0495591_000210 Ga0495591_000210_32840_33811 321
203 3300046491 Ga0495584_0002205 Ga0495584_0002205_9105_10070 321
204 3300046500 Ga0495596_0001869 Ga0495596_0001869_6685_7656 321
205 3300046501 Ga0495607_0000195 Ga0495607_0000195_54060_55040 321
206 3300046501 Ga0495607_0011643 Ga0495607_0011643_500_1471 321
207 3300046507 Ga0495606_0002199 Ga0495606_0002199_18569_19534 321
208 3300046520 Ga0495637_0000574 Ga0495637_0000574_5288_6253 321
209 3300046524 Ga0495648_0000600 Ga0495648_0000600_8472_9443 321
210 3300046530 Ga0495654_0000711 Ga0495654_0000711_5310_6275 321
211 3300046542 Ga0495597_0000822 Ga0495597_0000822_19741_20706 321
212 3300046542 Ga0495597_0001347 Ga0495597_0001347_8383_9360 321
213 3300046694 Ga0495649_0000913 Ga0495649_0000913_3650_4615 321
214 3300046810 Ga0495660_0019113 Ga0495660_0019113_476_1447 321
215 3300048921 Ga0496118_0013224 Ga0496118_0013224_5959_6942 321
216 3300048924 Ga0496121_0002844 Ga0496121_0002844_12455_13438 321
217 3300048925 Ga0496122_0002170 Ga0496122_0002170_11824_12807 321
218 3300048926 Ga0496123_0001722 Ga0496123_0001722_12130_13113 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

47

275

0.86

PF04321

RmlD_sub_bind

RmlD substrate binding domain

45

303

0.85

PF07993

NAD_binding_4

Male sterility protein

99

258

0.82

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

48

301

0.79

PF13460

NAD_binding_10

NAD(P)H-binding

51

229

0.77

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

99

353

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8976 4 316
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8958 4 316
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8948 4 316
3m2p-assembly1.cif.gz_A the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8902 4 316
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8848 4 316
ID Description Score Start End Superfamily
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8926 5 233 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8835 4 235 3.40.50.720
3m2pE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8759 4 313 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8735 4 174 3.40.50.720
af_Q2G1J5_1_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8599 1 288 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q3QFD4-F1-model_v4 deleted 0.9861 51 315
AF-A0A0B8NZT0-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.977 69 321 GO:0003978
AF-A0A7Y2KF59-F1-model_v4 deleted 0.9732 5 311
AF-A0A291B7W9-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9731 4 320 GO:0003978
AF-A0A6M8SN13-F1-model_v4 SDR family oxidoreductase 0.9729 1 319

Feature Viewer

pLDDT pTM Quality
89.82 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map