F329342

General Info

Members Datasets Scaffolds Average Seq Length
217 124 207 397

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541280|2738739665
Length 478
Sequence RADDAVIVINAGSSSIKFSMYAGADLQLRAKGKIENLYAGQTRFTAQDGAGQPSAEHVWPGAPLAHGEAMRYLVEYAQGHLQGHRVVAIGHRIVHGGTDFSGPVKLDEDVVARLDTLVPLAPLHQPHNLAPVRSIFALAPHVLQVGCFDTAFHTAQPPLAQAFALPPEITERGVRRYGFHGLSYEYIASVLPSLDDAQAAPPPAGSAAAQAGAGALGGVLPVLLGGAPAAASHAALGGAAPAARHAAPLAGGRVVAAHLGNGASMCAMHGGRSVATTMGFTAVDGLPMGTRCGSVDPGVVLYLMDELQMGQSDIQRLLYQQSGLLGVSGISSDMRTLEQSGDPRARLAIELMVYRIGRELGSLAAALGGLDGIVFSGGIGENSVALRSAVCRDAAWLGVRLDEAANAAGAAGAVGAAGAAGAAGAGAAAPDTAAAAARAPLPGGAFRISAAGSAVPVWVVPANEELMIARHAQSLLEA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2643221664 Massilia sp. Root418 Isolate Unclassified
4 2738541280 Massilia sp. GV090 Isolate Unclassified
5 2738541300 Massilia sp. GV016 Isolate Unclassified
6 2738543013 Variovorax sp. BT01 Isolate Unclassified
7 2738543018 Massilia sp. GV045 Isolate Unclassified
8 2738543030 Massilia sp. GV097 Isolate Unclassified
9 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
10 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
50 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
124 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.39
Metatranscriptomes 0
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0.92
Rhizoplane 5.99
Rhizosphere 82.49
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000278 3300002738 Bacteria 31200
2 Ga0055536_1019515 3300003781 Bacteria 2127
3 Ga0055534_1001802 3300003784 Bacteria 8049
4 Ga0070683_100141181 3300005329 Bacteria 2282
5 Ga0070680_100003288 3300005336 Bacteria 12060
6 Ga0070660_100037854 3300005339 Bacteria 3658
7 Ga0070668_100006094 3300005347 Bacteria 8943
8 Ga0070668_100007739 3300005347 Bacteria 7975
9 Ga0070668_100231663 3300005347 Bacteria 1527
10 Ga0070675_100155212 3300005354 Bacteria 1965
11 Ga0070673_100174158 3300005364 Bacteria 1838
12 Ga0070708_100048648 3300005445 Bacteria 3749
13 Ga0070678_100108793 3300005456 Bacteria 2164
14 Ga0070706_100077230 3300005467 Bacteria 3082
15 Ga0070706_100214615 3300005467 Bacteria 1796
16 Ga0070707_100029414 3300005468 Bacteria 5230
17 Ga0070707_100032340 3300005468 Bacteria 4984
18 Ga0070707_100041114 3300005468 Bacteria 4424
19 Ga0070707_100063117 3300005468 Bacteria 3555
20 Ga0070698_100031033 3300005471 Bacteria 5541
21 Ga0070698_100071746 3300005471 Bacteria 3472
22 Ga0070699_100046084 3300005518 Bacteria 3773
23 Ga0070699_100202062 3300005518 Bacteria 1767
24 Ga0070679_100010676 3300005530 Bacteria 8717
25 Ga0070697_100010443 3300005536 Bacteria 7247
26 Ga0070697_100047111 3300005536 Bacteria 3496
27 Ga0070697_100051230 3300005536 Bacteria 3354
28 Ga0070697_100144598 3300005536 Bacteria 2001
29 Ga0068855_100141694 3300005563 Bacteria 2740
30 Ga0068857_100059590 3300005577 Bacteria 3391
31 Ga0068854_100060112 3300005578 Bacteria 2748
32 Ga0068862_100051966 3300005844 Bacteria 3506
33 Ga0081455_10183170 3300005937 Bacteria 1584
34 Ga0081540_1001938 3300005983 Bacteria 17324
35 Ga0070717_10000801 3300006028 Bacteria 20674
36 Ga0070712_100003625 3300006175 Bacteria 9524
37 Ga0075428_100003260 3300006844 Bacteria 17772
38 Ga0075428_100012571 3300006844 Bacteria 9412
39 Ga0075428_100077251 3300006844 Bacteria 3634
40 Ga0075428_100101600 3300006844 Bacteria 3135
41 Ga0075428_100237726 3300006844 Bacteria 1966
42 Ga0075430_100021998 3300006846 Bacteria 5420
43 Ga0075430_100097923 3300006846 Bacteria 2450
44 Ga0075431_100000931 3300006847 Bacteria 25851
45 Ga0075431_100006194 3300006847 Bacteria 11874
46 Ga0075431_100121406 3300006847 Bacteria 2696
47 Ga0075431_100204985 3300006847 Bacteria 2016
48 Ga0075433_10000747 3300006852 Bacteria 22314
49 Ga0075433_10001258 3300006852 Bacteria 18511
50 Ga0075433_10054452 3300006852 Bacteria 3490
51 Ga0075433_10113632 3300006852 Bacteria 2402
52 Ga0075433_10167932 3300006852 Bacteria 1953
53 Ga0075434_100001047 3300006871 Bacteria 22564
54 Ga0075434_100280024 3300006871 Bacteria 1687
55 Ga0075429_100004302 3300006880 Bacteria 12233
56 Ga0075429_100035581 3300006880 Bacteria 4331
57 Ga0075429_100068373 3300006880 Bacteria 3091
58 Ga0075429_100158101 3300006880 Bacteria 1985
59 Ga0079104_1017973 3300006946 Bacteria 2016
60 Ga0075435_100011078 3300007076 Bacteria 6613
61 Ga0075435_100034773 3300007076 Bacteria 3995
62 Ga0075435_100045279 3300007076 Bacteria 3527
63 Ga0075435_100280376 3300007076 Bacteria 1423
64 Ga0099794_10000411 3300007265 Bacteria 14409
65 Ga0114129_10002217 3300009147 Bacteria 26788
66 Ga0114129_10005606 3300009147 Bacteria 17768
67 Ga0114129_10008410 3300009147 Bacteria 14697
68 Ga0114129_10013610 3300009147 Bacteria 11592
69 Ga0114129_10040370 3300009147 Bacteria 6578
70 Ga0114129_10051621 3300009147 Bacteria 5773
71 Ga0114129_10081853 3300009147 Bacteria 4487
72 Ga0114129_10122318 3300009147 Bacteria 3581
73 Ga0114129_10175493 3300009147 Unclassified 2919
74 Ga0114129_10539109 3300009147 Bacteria 1519
75 Ga0105237_10037829 3300009545 Bacteria 4875
76 Ga0105238_10000229 3300009551 Bacteria 62541
77 Ga0105239_10313668 3300010375 Bacteria 1768
78 Ga0209646_1000023 3300025246 Bacteria 441100
79 Ga0209130_1003718 3300025284 Bacteria 6258
80 Ga0209675_1004162 3300025291 Bacteria 6553
81 Ga0209758_1002444 3300025297 Bacteria 18965
82 Ga0209257_1004936 3300025304 Bacteria 9791
83 Ga0207684_10002028 3300025910 Bacteria 20866
84 Ga0207684_10029172 3300025910 Bacteria 4699
85 Ga0207684_10075591 3300025910 Bacteria 2863
86 Ga0207707_10161023 3300025912 Bacteria 1962
87 Ga0207693_10006058 3300025915 Bacteria 10017
88 Ga0207663_10031149 3300025916 Bacteria 3154
89 Ga0207657_10029985 3300025919 Bacteria 4944
90 Ga0207646_10019185 3300025922 Bacteria 6357
91 Ga0207646_10032253 3300025922 Bacteria 4740
92 Ga0207646_10050634 3300025922 Bacteria 3716
93 Ga0207694_10000260 3300025924 Bacteria 50288
94 Ga0207659_10105667 3300025926 Bacteria 2131
95 Ga0207668_10015391 3300025972 Bacteria 4752
96 Ga0207668_10030224 3300025972 Bacteria 3558
97 Ga0207640_10048368 3300025981 Bacteria 2748
98 Ga0207641_10146731 3300026088 Bacteria 2134
99 Ga0207641_10231368 3300026088 Bacteria 1718
100 Ga0207683_10025292 3300026121 Bacteria 5121
101 Ga0209179_1001073 3300027512 Bacteria 3173
102 Ga0209588_1006835 3300027671 Bacteria 3336
103 Ga0207428_10124351 3300027907 Bacteria 1976
104 Ga0268265_10032808 3300028380 Bacteria 3768
105 Ga0265328_10000608 3300031239 Bacteria 16653
106 Ga0265339_10044325 3300031249 Bacteria 2454
107 Ga0307509_10067271 3300031507 Bacteria 3754
108 Ga0307508_10049824 3300031616 Bacteria 3730
109 Ga0307414_10005051 3300032004 Bacteria 7227
110 Ga0373937_0059926 3300036401 Bacteria 3498
111 Ga0373925_0262727 3300037068 Unclassified 1387
112 Ga0395900_0023424 3300037418 Bacteria 6320
113 Ga0395898_0018925 3300037466 Bacteria 7016
114 Ga0395898_0329649 3300037466 Bacteria 1455
115 Ga0436364_0077338 3300037853 Bacteria 4976
116 Ga0436360_0209156 3300039438 Bacteria 5151
117 Ga0436363_0467903 3300039450 Bacteria 2379
118 Ga0439460_0042220 3300042461 Bacteria 1343
119 Ga0453683_0009374 3300044673 Bacteria 6539
120 Ga0466970_0033009 3300044765 Bacteria 2736
121 Ga0466959_0164071 3300045049 Bacteria 1561
122 Ga0495638_0000055 3300046460 Bacteria 196038
123 Ga0495618_0131311 3300046514 Bacteria 1603
124 Ga0495674_0072000 3300047319 Bacteria 2982
125 Ga0495674_0121194 3300047319 Bacteria 2209
126 Ga0496102_0021616 3300048905 Bacteria 5692
127 Ga0496102_0085707 3300048905 Bacteria 2909
128 Ga0496103_0009934 3300048906 Bacteria 5628
129 Ga0496104_0016827 3300048907 Bacteria 6647
130 Ga0496106_0000385 3300048909 Bacteria 31419
131 Ga0496107_0001444 3300048910 Bacteria 14711
132 Ga0496108_0000516 3300048911 Bacteria 30275
133 Ga0496109_0001463 3300048912 Bacteria 19602
134 Ga0496110_0012604 3300048913 Bacteria 6954
135 Ga0496111_0092223 3300048914 Bacteria 2220
136 Ga0496112_0009104 3300048915 Bacteria 8922
137 Ga0496112_0257615 3300048915 Bacteria 1695
138 Ga0496115_0056186 3300048918 Bacteria 3163
139 Ga0496126_0320346 3300048929 Bacteria 1274
140 Ga0501031_0000010 3300049568 Bacteria 146435
141 Ga0501032_0000023 3300049569 Bacteria 146435
142 Ga0501032_0071668 3300049569 Bacteria 2309
143 Ga0501033_0000104 3300049570 Bacteria 81029
144 Ga0501033_0022130 3300049570 Bacteria 4796
145 Ga0501033_0079414 3300049570 Bacteria 2407
146 Ga0501033_0094700 3300049570 Bacteria 2183
147 Ga0501034_0000116 3300049571 Bacteria 146442
148 Ga0501034_0219038 3300049571 Bacteria 1856
149 Ga0501036_0000015 3300049572 Bacteria 146442
150 Ga0501036_0105402 3300049572 Bacteria 2384
151 Ga0501037_0000023 3300049573 Bacteria 146542
152 Ga0501038_0000025 3300049574 Bacteria 146542
153 Ga0501038_0037115 3300049574 Bacteria 4275
154 Ga0501038_0138195 3300049574 Bacteria 1995
155 Ga0501038_0291864 3300049574 Bacteria 1281
156 Ga0501039_0000691 3300049575 Bacteria 24283
157 Ga0501039_0035425 3300049575 Bacteria 3851
158 Ga0501040_0007003 3300049576 Bacteria 7306
159 Ga0501043_0000070 3300049579 Bacteria 89839
160 Ga0501047_0005596 3300049581 Bacteria 11833
161 Ga0501047_0073908 3300049581 Bacteria 3282
162 Ga0501070_0018099 3300049586 Bacteria 5910
163 Ga0501035_0001454 3300049822 Bacteria 24283
164 Ga0501035_0009629 3300049822 Bacteria 8986
165 Ga0501035_0024819 3300049822 Bacteria 5496
166 Ga0501035_0036072 3300049822 Bacteria 4483
167 Ga0501035_0073438 3300049822 Bacteria 3026
168 Ga0501035_0277531 3300049822 Bacteria 1417
169 Ga0501044_0000069 3300049823 Bacteria 125974
170 Ga0501044_0009510 3300049823 Bacteria 10581
171 Ga0501044_0024110 3300049823 Bacteria 6464
172 Ga0501044_0136081 3300049823 Bacteria 2448
173 Ga0501044_0159639 3300049823 Bacteria 2232
174 Ga0501044_0166766 3300049823 Bacteria 2176
175 Ga0501044_0234683 3300049823 Bacteria 1780
176 nmdc:mga05p37_10_c1 3300050507 Bacteria 113461
177 nmdc:mga05p37_11721_c1 3300050507 Bacteria 10450
178 nmdc:mga05p37_125225_c1 3300050507 Unclassified 3156
179 nmdc:mga05p37_141034_c1 3300050507 Bacteria 2953
180 nmdc:mga05p37_34713_c1 3300050507 Bacteria 6179
181 nmdc:mga05p37_391719_c1 3300050507 Bacteria 1625
182 nmdc:mga05p37_7529_c1 3300050507 Bacteria 12836
183 nmdc:mga05p37_7890_c1 3300050507 Bacteria 12564
184 nmdc:mga05p37_82100_c1 3300050507 Bacteria 3971
185 nmdc:mga05p37_87046_c1 3300050507 Bacteria 3851
186 nmdc:mga09592_25207_c1 3300050508 Bacteria 4920
187 nmdc:mga09592_41994_c1 3300050508 Bacteria 3847
188 nmdc:mga09592_8442_c1 3300050508 Bacteria 8375
189 nmdc:mga0qj67_35671_c1 3300050509 Bacteria 3889
190 nmdc:mga06r32_20482_c1 3300050510 Bacteria 6091
191 nmdc:mga06r32_5104_c1 3300050510 Bacteria 11805
192 nmdc:mga06r32_68496_c1 3300050510 Bacteria 3429
193 nmdc:mga08y16_102915_c1 3300050511 Bacteria 2973
194 nmdc:mga08y16_177846_c1 3300050511 Bacteria 2210
195 nmdc:mga0n895_168389_c1 3300050512 Bacteria 2223
196 nmdc:mga0n895_1947_c1 3300050512 Bacteria 15854
197 nmdc:mga0n895_9227_c1 3300050512 Bacteria 8621
198 nmdc:mga0n895_97948_c1 3300050512 Bacteria 2939
199 nmdc:mga0rr50_3137_c1 3300050513 Bacteria 9438
200 nmdc:mga0a205_186343_c1 3300050515 Bacteria 1968
201 nmdc:mga0a205_230204_c1 3300050515 Bacteria 1737
202 nmdc:mga0a205_29532_c1 3300050515 Bacteria 5247
203 nmdc:mga0a205_4334_c1 3300050515 Bacteria 12721
204 nmdc:mga0a205_594_c1 3300050515 Bacteria 28735
205 nmdc:mga0a205_72072_c1 3300050515 Bacteria 3337
206 Ga0500647_0013311 3300053091 Bacteria 3719
207 Ga0500559_0001743 3300053136 Bacteria 11940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0033009 Ga0466970_0033009_1705_2706 322
2 3300048929 Ga0496126_0320346 Ga0496126_0320346_131_1240 357
3 3300053091 Ga0500647_0013311 Ga0500647_0013311_491_1738 361
4 3300049571 Ga0501034_0219038 Ga0501034_0219038_737_1828 363
5 3300053136 Ga0500559_0001743 Ga0500559_0001743_5562_6803 367
6 3300025297 Ga0209758_1002444 Ga0209758_100244412 369
7 3300005563 Ga0068855_100141694 Ga0068855_1001416942 372
8 3300006880 Ga0075429_100158101 Ga0075429_1001581012 372
9 3300006844 Ga0075428_100237726 Ga0075428_1002377262 373
10 3300006946 Ga0079104_1017973 Ga0079104_10179731 373
11 3300036401 Ga0373937_0059926 Ga0373937_0059926_2116_3300 376
12 3300037068 Ga0373925_0262727 Ga0373925_0262727_104_1288 376
13 3300047319 Ga0495674_0072000 Ga0495674_0072000_117_1301 376
14 3300005354 Ga0070675_100155212 Ga0070675_1001552122 383
15 3300005364 Ga0070673_100174158 Ga0070673_1001741582 383
16 3300005456 Ga0070678_100108793 Ga0070678_1001087932 383
17 3300006844 Ga0075428_100012571 Ga0075428_1000125714 383
18 3300006846 Ga0075430_100021998 Ga0075430_1000219983 383
19 3300006847 Ga0075431_100006194 Ga0075431_1000061946 383
20 3300006880 Ga0075429_100035581 Ga0075429_1000355813 383
21 3300009147 Ga0114129_10005606 Ga0114129_100056066 383
22 3300010375 Ga0105239_10313668 Ga0105239_103136681 383
23 3300025926 Ga0207659_10105667 Ga0207659_101056672 383
24 3300026121 Ga0207683_10025292 Ga0207683_100252924 383
25 3300049574 Ga0501038_0291864 Ga0501038_0291864_20_1171 383
26 3300050507 nmdc:mga05p37_10_c1 nmdc:mga05p37_10_c1_78486_79676 383
27 3300050508 nmdc:mga09592_41994_c1 nmdc:mga09592_41994_c1_1067_2257 383
28 3300050509 nmdc:mga0qj67_35671_c1 nmdc:mga0qj67_35671_c1_2056_3246 383
29 3300050510 nmdc:mga06r32_5104_c1 nmdc:mga06r32_5104_c1_6239_7429 383
30 3300027512 Ga0209179_1001073 Ga0209179_10010732 385
31 iso_pu_bacteria 2508501128 2509146469 385
32 3300005937 Ga0081455_10183170 Ga0081455_101831702 386
33 3300037853 Ga0436364_0077338 Ga0436364_0077338_3655_4839 386
34 iso_pu_bacteria 2919709256 2919709284 386
35 3300005578 Ga0068854_100060112 Ga0068854_1000601122 387
36 3300007076 Ga0075435_100045279 Ga0075435_1000452792 387
37 3300025981 Ga0207640_10048368 Ga0207640_100483682 387
38 3300032004 Ga0307414_10005051 Ga0307414_100050513 387
39 iso_pu_bacteria 2885429604 2885431733 387
40 3300006871 Ga0075434_100280024 Ga0075434_1002800242 388
41 3300009147 Ga0114129_10175493 Ga0114129_101754933 388
42 3300009545 Ga0105237_10037829 Ga0105237_100378294 388
43 3300045049 Ga0466959_0164071 Ga0466959_0164071_31_1242 388
44 3300048905 Ga0496102_0085707 Ga0496102_0085707_163_1374 388
45 3300048907 Ga0496104_0016827 Ga0496104_0016827_1496_2707 388
46 3300048909 Ga0496106_0000385 Ga0496106_0000385_20810_22021 388
47 3300048910 Ga0496107_0001444 Ga0496107_0001444_11063_12274 388
48 3300048911 Ga0496108_0000516 Ga0496108_0000516_8356_9567 388
49 3300048912 Ga0496109_0001463 Ga0496109_0001463_8267_9478 388
50 3300048913 Ga0496110_0012604 Ga0496110_0012604_3915_5126 388
51 3300048914 Ga0496111_0092223 Ga0496111_0092223_676_1887 388
52 3300048915 Ga0496112_0009104 Ga0496112_0009104_2465_3676 388
53 3300048918 Ga0496115_0056186 Ga0496115_0056186_112_1323 388
54 3300049569 Ga0501032_0071668 Ga0501032_0071668_173_1348 388
55 3300049581 Ga0501047_0073908 Ga0501047_0073908_20_1225 388
56 3300049823 Ga0501044_0136081 Ga0501044_0136081_1231_2436 388
57 3300006028 Ga0070717_10000801 Ga0070717_1000080121 389
58 3300006175 Ga0070712_100003625 Ga0070712_1000036256 389
59 3300025915 Ga0207693_10006058 Ga0207693_100060584 389
60 3300025916 Ga0207663_10031149 Ga0207663_100311493 389
61 3300031249 Ga0265339_10044325 Ga0265339_100443252 389
62 3300031507 Ga0307509_10067271 Ga0307509_100672712 389
63 3300037466 Ga0395898_0018925 Ga0395898_0018925_1577_2791 389
64 3300039450 Ga0436363_0467903 Ga0436363_0467903_567_1781 389
65 3300046514 Ga0495618_0131311 Ga0495618_0131311_76_1248 389
66 3300047319 Ga0495674_0121194 Ga0495674_0121194_541_1713 389
67 3300048915 Ga0496112_0257615 Ga0496112_0257615_309_1523 389
68 3300050515 nmdc:mga0a205_186343_c1 nmdc:mga0a205_186343_c1_31_1230 389
69 3300005347 Ga0070668_100006094 Ga0070668_10000609410 390
70 3300006847 Ga0075431_100204985 Ga0075431_1002049852 390
71 3300009147 Ga0114129_10008410 Ga0114129_1000841015 390
72 3300009147 Ga0114129_10081853 Ga0114129_100818532 390
73 3300025972 Ga0207668_10015391 Ga0207668_100153912 390
74 3300026088 Ga0207641_10231368 Ga0207641_102313682 390
75 3300037418 Ga0395900_0023424 Ga0395900_0023424_314_1486 390
76 3300037466 Ga0395898_0329649 Ga0395898_0329649_246_1418 390
77 3300044673 Ga0453683_0009374 Ga0453683_0009374_3099_4280 390
78 3300049568 Ga0501031_0000010 Ga0501031_0000010_124391_125563 390
79 3300049569 Ga0501032_0000023 Ga0501032_0000023_20873_22045 390
80 3300049570 Ga0501033_0000104 Ga0501033_0000104_79461_80633 390
81 3300049570 Ga0501033_0022130 Ga0501033_0022130_2941_4113 390
82 3300049570 Ga0501033_0079414 Ga0501033_0079414_424_1596 390
83 3300049570 Ga0501033_0094700 Ga0501033_0094700_779_1951 390
84 3300049571 Ga0501034_0000116 Ga0501034_0000116_124398_125570 390
85 3300049572 Ga0501036_0000015 Ga0501036_0000015_124398_125570 390
86 3300049572 Ga0501036_0105402 Ga0501036_0105402_161_1333 390
87 3300049573 Ga0501037_0000023 Ga0501037_0000023_124498_125670 390
88 3300049574 Ga0501038_0000025 Ga0501038_0000025_124498_125670 390
89 3300049574 Ga0501038_0037115 Ga0501038_0037115_2447_3619 390
90 3300049574 Ga0501038_0138195 Ga0501038_0138195_158_1330 390
91 3300049575 Ga0501039_0000691 Ga0501039_0000691_2239_3411 390
92 3300049575 Ga0501039_0035425 Ga0501039_0035425_2507_3679 390
93 3300049576 Ga0501040_0007003 Ga0501040_0007003_5309_6481 390
94 3300049579 Ga0501043_0000070 Ga0501043_0000070_67834_69006 390
95 3300049581 Ga0501047_0005596 Ga0501047_0005596_325_1497 390
96 3300049586 Ga0501070_0018099 Ga0501070_0018099_2745_3917 390
97 3300049822 Ga0501035_0001454 Ga0501035_0001454_20875_22047 390
98 3300049822 Ga0501035_0024819 Ga0501035_0024819_4078_5250 390
99 3300049822 Ga0501035_0036072 Ga0501035_0036072_3066_4238 390
100 3300049822 Ga0501035_0073438 Ga0501035_0073438_812_1984 390
101 3300049823 Ga0501044_0000069 Ga0501044_0000069_405_1577 390
102 3300049823 Ga0501044_0009510 Ga0501044_0009510_1185_2357 390
103 3300049823 Ga0501044_0166766 Ga0501044_0166766_600_1772 390
104 3300049823 Ga0501044_0234683 Ga0501044_0234683_391_1563 390
105 3300050507 nmdc:mga05p37_11721_c1 nmdc:mga05p37_11721_c1_1886_3091 390
106 3300050507 nmdc:mga05p37_125225_c1 nmdc:mga05p37_125225_c1_1524_2726 390
107 3300050507 nmdc:mga05p37_141034_c1 nmdc:mga05p37_141034_c1_197_1399 390
108 3300005329 Ga0070683_100141181 Ga0070683_1001411812 391
109 3300005336 Ga0070680_100003288 Ga0070680_1000032889 391
110 3300005339 Ga0070660_100037854 Ga0070660_1000378545 391
111 3300005530 Ga0070679_100010676 Ga0070679_1000106761 391
112 3300005577 Ga0068857_100059590 Ga0068857_1000595902 391
113 3300005983 Ga0081540_1001938 Ga0081540_10019383 391
114 3300007265 Ga0099794_10000411 Ga0099794_1000041114 391
115 3300009551 Ga0105238_10000229 Ga0105238_1000022929 391
116 3300025910 Ga0207684_10075591 Ga0207684_100755913 391
117 3300025912 Ga0207707_10161023 Ga0207707_101610232 391
118 3300025919 Ga0207657_10029985 Ga0207657_100299852 391
119 3300025924 Ga0207694_10000260 Ga0207694_1000026026 391
120 3300027671 Ga0209588_1006835 Ga0209588_10068352 391
121 3300031616 Ga0307508_10049824 Ga0307508_100498243 391
122 3300039438 Ga0436360_0209156 Ga0436360_0209156_2156_3340 391
123 3300046460 Ga0495638_0000055 Ga0495638_0000055_29792_30985 391
124 3300048905 Ga0496102_0021616 Ga0496102_0021616_4376_5566 391
125 3300048906 Ga0496103_0009934 Ga0496103_0009934_4339_5529 391
126 3300049822 Ga0501035_0277531 Ga0501035_0277531_130_1350 391
127 3300049823 Ga0501044_0159639 Ga0501044_0159639_35_1255 391
128 3300006852 Ga0075433_10001258 Ga0075433_100012585 392
129 3300006852 Ga0075433_10167932 Ga0075433_101679322 392
130 3300006880 Ga0075429_100004302 Ga0075429_10000430210 392
131 3300007076 Ga0075435_100011078 Ga0075435_1000110784 392
132 3300009147 Ga0114129_10040370 Ga0114129_100403706 392
133 3300009147 Ga0114129_10051621 Ga0114129_100516213 392
134 3300050507 nmdc:mga05p37_34713_c1 nmdc:mga05p37_34713_c1_279_1466 392
135 3300050508 nmdc:mga09592_8442_c1 nmdc:mga09592_8442_c1_2507_3694 392
136 3300050512 nmdc:mga0n895_9227_c1 nmdc:mga0n895_9227_c1_4841_6028 392
137 3300050513 nmdc:mga0rr50_3137_c1 nmdc:mga0rr50_3137_c1_3464_4651 392
138 3300050515 nmdc:mga0a205_4334_c1 nmdc:mga0a205_4334_c1_7252_8439 392
139 iso_pu_bacteria 2738543013 2739250644 392
140 3300003781 Ga0055536_1019515 Ga0055536_10195152 393
141 3300003784 Ga0055534_1001802 Ga0055534_10018028 393
142 3300005347 Ga0070668_100007739 Ga0070668_1000077399 393
143 3300005347 Ga0070668_100231663 Ga0070668_1002316632 393
144 3300005445 Ga0070708_100048648 Ga0070708_1000486482 393
145 3300005467 Ga0070706_100077230 Ga0070706_1000772302 393
146 3300005467 Ga0070706_100214615 Ga0070706_1002146151 393
147 3300005468 Ga0070707_100029414 Ga0070707_1000294143 393
148 3300005468 Ga0070707_100032340 Ga0070707_1000323401 393
149 3300005468 Ga0070707_100041114 Ga0070707_1000411142 393
150 3300005468 Ga0070707_100063117 Ga0070707_1000631171 393
151 3300005471 Ga0070698_100031033 Ga0070698_1000310334 393
152 3300005471 Ga0070698_100071746 Ga0070698_1000717463 393
153 3300005518 Ga0070699_100046084 Ga0070699_1000460842 393
154 3300005518 Ga0070699_100202062 Ga0070699_1002020621 393
155 3300005536 Ga0070697_100010443 Ga0070697_1000104431 393
156 3300005536 Ga0070697_100047111 Ga0070697_1000471113 393
157 3300005536 Ga0070697_100051230 Ga0070697_1000512301 393
158 3300005536 Ga0070697_100144598 Ga0070697_1001445982 393
159 3300005844 Ga0068862_100051966 Ga0068862_1000519662 393
160 3300006844 Ga0075428_100003260 Ga0075428_1000032606 393
161 3300006844 Ga0075428_100077251 Ga0075428_1000772512 393
162 3300006844 Ga0075428_100101600 Ga0075428_1001016002 393
163 3300006846 Ga0075430_100097923 Ga0075430_1000979232 393
164 3300006847 Ga0075431_100000931 Ga0075431_1000009315 393
165 3300006847 Ga0075431_100121406 Ga0075431_1001214063 393
166 3300006852 Ga0075433_10000747 Ga0075433_1000074716 393
167 3300006852 Ga0075433_10054452 Ga0075433_100544522 393
168 3300006852 Ga0075433_10113632 Ga0075433_101136322 393
169 3300006871 Ga0075434_100001047 Ga0075434_1000010474 393
170 3300006880 Ga0075429_100068373 Ga0075429_1000683733 393
171 3300007076 Ga0075435_100034773 Ga0075435_1000347732 393
172 3300007076 Ga0075435_100280376 Ga0075435_1002803762 393
173 3300009147 Ga0114129_10002217 Ga0114129_1000221720 393
174 3300009147 Ga0114129_10013610 Ga0114129_100136105 393
175 3300009147 Ga0114129_10122318 Ga0114129_101223182 393
176 3300009147 Ga0114129_10539109 Ga0114129_105391092 393
177 3300025284 Ga0209130_1003718 Ga0209130_10037182 393
178 3300025291 Ga0209675_1004162 Ga0209675_10041622 393
179 3300025304 Ga0209257_1004936 Ga0209257_100493612 393
180 3300025910 Ga0207684_10002028 Ga0207684_100020285 393
181 3300025910 Ga0207684_10029172 Ga0207684_100291723 393
182 3300025922 Ga0207646_10019185 Ga0207646_100191852 393
183 3300025922 Ga0207646_10032253 Ga0207646_100322532 393
184 3300025922 Ga0207646_10050634 Ga0207646_100506342 393
185 3300025972 Ga0207668_10030224 Ga0207668_100302242 393
186 3300026088 Ga0207641_10146731 Ga0207641_101467312 393
187 3300027907 Ga0207428_10124351 Ga0207428_101243512 393
188 3300028380 Ga0268265_10032808 Ga0268265_100328082 393
189 3300031239 Ga0265328_10000608 Ga0265328_1000060813 393
190 3300042461 Ga0439460_0042220 Ga0439460_0042220_31_1221 393
191 3300049822 Ga0501035_0009629 Ga0501035_0009629_4544_5809 393
192 3300049823 Ga0501044_0024110 Ga0501044_0024110_4241_5506 393
193 3300050507 nmdc:mga05p37_391719_c1 nmdc:mga05p37_391719_c1_261_1451 393
194 3300050507 nmdc:mga05p37_7529_c1 nmdc:mga05p37_7529_c1_5472_6662 393
195 3300050507 nmdc:mga05p37_7890_c1 nmdc:mga05p37_7890_c1_2929_4134 393
196 3300050507 nmdc:mga05p37_82100_c1 nmdc:mga05p37_82100_c1_442_1632 393
197 3300050507 nmdc:mga05p37_87046_c1 nmdc:mga05p37_87046_c1_332_1522 393
198 3300050508 nmdc:mga09592_25207_c1 nmdc:mga09592_25207_c1_222_1412 393
199 3300050510 nmdc:mga06r32_20482_c1 nmdc:mga06r32_20482_c1_602_1792 393
200 3300050510 nmdc:mga06r32_68496_c1 nmdc:mga06r32_68496_c1_1838_3028 393
201 3300050511 nmdc:mga08y16_102915_c1 nmdc:mga08y16_102915_c1_1502_2737 393
202 3300050511 nmdc:mga08y16_177846_c1 nmdc:mga08y16_177846_c1_460_1650 393
203 3300050512 nmdc:mga0n895_168389_c1 nmdc:mga0n895_168389_c1_555_1745 393
204 3300050512 nmdc:mga0n895_1947_c1 nmdc:mga0n895_1947_c1_11791_12996 393
205 3300050512 nmdc:mga0n895_97948_c1 nmdc:mga0n895_97948_c1_1056_2246 393
206 3300050515 nmdc:mga0a205_230204_c1 nmdc:mga0a205_230204_c1_400_1590 393
207 3300050515 nmdc:mga0a205_29532_c1 nmdc:mga0a205_29532_c1_819_2090 393
208 3300050515 nmdc:mga0a205_594_c1 nmdc:mga0a205_594_c1_16190_17395 393
209 3300050515 nmdc:mga0a205_72072_c1 nmdc:mga0a205_72072_c1_944_2134 393
210 iso_pu_bacteria 2643221645 2644250068 395
211 iso_pu_bacteria 2738541280 2738739665 395
212 iso_pu_bacteria 2738541300 2738846882 395
213 iso_pu_bacteria 2738543018 2739277857 395
214 iso_pu_bacteria 2738543030 2739346900 395
215 iso_pu_bacteria 2643221664 2644358757 396
216 3300002738 JGI25154J39366_1000278 JGI25154J39366_100027827 397
217 3300025246 Ga0209646_1000023 Ga0209646_1000023334 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00871

Acetate_kinase

Acetokinase family

243

420

0.94

PF00871

Acetate_kinase

Acetokinase family

5

200

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ioy-assembly2.cif.gz_C crystal structure of porphyromonas gingivalis acetate kinase 0.9323 5 392
7fjb-assembly1.cif.gz_B kpacka (pduw) with amppnp, sodium acetate complex structure 0.9241 6 391
4iz9-assembly1.cif.gz_A-2 crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese 0.9207 3 394
3khy-assembly1.cif.gz_B crystal structure of a propionate kinase from francisella tularensis subsp. tularensis schu s4 0.9205 1 392
3r9p-assembly1.cif.gz_B-2 crystal structure of acka from mycobacterium paratuberculosis atcc baa-968 / k-10 0.9153 5 394
ID Description Score Start End Superfamily
1x3mA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9606 200 393 3.30.420.40
2iirA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9554 200 395 3.30.420.40
4h0oB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9224 200 395 3.30.420.40
3khyB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9174 200 393 3.30.420.40
2iirA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9103 200 395 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A524BGV5-F1-model_v4 Acetate kinase 0.9919 235 393 GO:0005737
GO:0006083
GO:0008776
AF-A0A529JKC7-F1-model_v4 deleted 0.9846 216 393
AF-A0A6N6RZ08-F1-model_v4 Acetate kinase 0.9839 136 395 GO:0005524
GO:0005829
GO:0006083
GO:0008776
GO:0047761
AF-A0A5R9FXH9-F1-model_v4 Acetate kinase 0.983 238 395 GO:0005829
GO:0006083
GO:0008776
AF-A0A434I293-F1-model_v4 Acetate kinase 0.9827 234 395 GO:0005829
GO:0006083
GO:0008776

Feature Viewer

pLDDT pTM Quality
92.85 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map