F329194

General Info

Members Datasets Scaffolds Average Seq Length
217 164 157 361

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0018348|Ga0496101_0018348_380_1603
Length 407
Sequence MALDALFKPFEFKSLKLSNRVAMAPMTRSFSPGGVATDDVAAYYRRRAENQVGLIVTEGTGVARPASLNDANIPRFHGEKELAAWKKVVDEVHAAGGLIAPQLWHVGSARGKDVLGKIDSPSGLSKAGGAPFTEPMTDEDVADTIAAFASAAANAKALGFDAIELHGAHGYLIDQFFWDGTNVRDDHLGGPSIAERSKFAAEILKAVRAAVGPDYPVIIRLSQWKQQDYAVKNAETPQLLEAWLQPLADAGADIFHCSQRRFWEPEFEGSDLNFAGWAKKLTGAPTITVGSVGLSGEFIAAFGGEGSQPASIDGLLERLERDEFDLVGVGRAILQDPEWVVKIRDGREDELKSFERSALGVLDSSKDFPSPLWGGGTSEAGGWGPPSHKAPPVGFAATLPIKGRDGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
4 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
5 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
6 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
7 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
8 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
9 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
10 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
11 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
12 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
13 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
14 2643221583 Caulobacter sp. Root655 Isolate Unclassified
15 2643221584 Caulobacter sp. Root656 Isolate Unclassified
16 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
17 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
18 2643221640 Caulobacter sp. Root342 Isolate Unclassified
19 2643221642 Caulobacter sp. Root343 Isolate Unclassified
20 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
21 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
22 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
23 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
24 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
25 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
26 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
27 2671180694 Paenibacillus sp. A3 Isolate Unclassified
28 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
29 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
30 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
31 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
32 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
33 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
34 2818991435 Caulobacter henricii 536 Isolate Unclassified
35 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
36 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
37 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
38 2849560528 Caulobacter zeae 410 Isolate Unclassified
39 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
40 2851153111 Caulobacter radicis 736 Isolate Unclassified
41 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
42 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
43 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
44 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
45 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
46 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
47 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
48 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
49 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
50 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
51 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
52 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
53 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
54 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
55 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
56 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
57 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
58 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
59 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
60 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
63 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
105 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
147 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
148 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
151 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
152 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
153 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
154 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
155 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
156 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
157 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
158 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
163 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
164 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.35
Metatranscriptomes 0
Isolates 27.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.65
Nodule 0
Rhizoplane 2.76
Rhizosphere 44.7
Stem 0
Stem Tuber 0
Unclassified 24.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1926986 2162886007 Bacteria 2815
2 rootL2_10140063 3300003322 Bacteria 2863
3 Ga0055537_1001686 3300003773 Bacteria 8186
4 Ga0055524_1002745 3300003775 Bacteria 8878
5 Ga0055536_1000132 3300003781 Bacteria 63495
6 Ga0055536_1000807 3300003781 Bacteria 20725
7 Ga0055536_1005136 3300003781 Bacteria 6473
8 Ga0055528_1008144 3300003790 Bacteria 4537
9 Ga0055530_10001022 3300003791 Bacteria 22302
10 Ga0055530_10013884 3300003791 Bacteria 2720
11 Ga0055531_10000277 3300003794 Bacteria 52866
12 Ga0055531_10008353 3300003794 Bacteria 5478
13 Ga0065165_1001574 3300005262 Bacteria 23510
14 Ga0065704_10070242 3300005289 Bacteria 50451
15 Ga0065704_10070805 3300005289 Bacteria 15928
16 Ga0065704_10071102 3300005289 Bacteria 13171
17 Ga0070668_100087810 3300005347 Bacteria 2447
18 Ga0070663_100272864 3300005455 Bacteria 1345
19 Ga0068857_100042258 3300005577 Bacteria 4043
20 Ga0068862_100331732 3300005844 Bacteria 1407
21 Ga0075366_10068158 3300006195 Bacteria 2118
22 Ga0105244_10035958 3300009036 Bacteria 2598
23 Ga0105243_10000004 3300009148 Bacteria 601266
24 Ga0105243_10263635 3300009148 Bacteria 1544
25 Ga0157371_10012254 3300013102 Bacteria 6565
26 Ga0183365_10001 3300015684 Bacteria 2090444
27 Ga0209565_1000168 3300025263 Bacteria 85042
28 Ga0209673_1001427 3300025273 Bacteria 22859
29 Ga0209675_1005136 3300025291 Bacteria 5568
30 Ga0209676_1000046 3300025292 Bacteria 409173
31 Ga0209676_1000099 3300025292 Bacteria 230048
32 Ga0209676_1000150 3300025292 Bacteria 167474
33 Ga0209564_1003316 3300025295 Bacteria 11184
34 Ga0209564_1007990 3300025295 Bacteria 5316
35 Ga0209758_1001830 3300025297 Bacteria 23430
36 Ga0209758_1003175 3300025297 Bacteria 15408
37 Ga0209050_1000154 3300025298 Bacteria 159160
38 Ga0209050_1000249 3300025298 Bacteria 116136
39 Ga0209050_1001822 3300025298 Bacteria 20749
40 Ga0209256_1001139 3300025299 Bacteria 30288
41 Ga0209256_1007105 3300025299 Bacteria 5647
42 Ga0209256_1019797 3300025299 Bacteria 2127
43 Ga0209051_1001723 3300025303 Bacteria 17464
44 Ga0209257_1000203 3300025304 Bacteria 146148
45 Ga0209257_1000430 3300025304 Bacteria 80826
46 Ga0209257_1000505 3300025304 Bacteria 68565
47 Ga0209257_1002627 3300025304 Bacteria 17336
48 Ga0207709_10000010 3300025935 Bacteria 601305
49 Ga0265319_1009680 3300028563 Bacteria 4078
50 Ga0307515_10061431 3300028794 Bacteria 5331
51 Ga0307515_10182389 3300028794 Bacteria 2043
52 Ga0265338_10007655 3300028800 Bacteria 13323
53 Ga0265338_10064646 3300028800 Bacteria 3180
54 Ga0265338_10107864 3300028800 Bacteria 2251
55 Ga0265330_10000322 3300031235 Bacteria 34393
56 Ga0265327_10000772 3300031251 Bacteria 49388
57 Ga0307406_10008931 3300031901 Bacteria 5603
58 Ga0307412_10003148 3300031911 Bacteria 9165
59 Ga0307510_10080942 3300033180 Bacteria 3154
60 Ga0316582_0189680 3300036647 Bacteria 1400
61 Ga0436363_0115159 3300039450 Bacteria 2603
62 Ga0439446_0001377 3300042156 Bacteria 5500
63 Ga0453683_0003116 3300044673 Bacteria 12378
64 Ga0453684_0021071 3300044712 Bacteria 9768
65 Ga0451576_0019266 3300045051 Bacteria 7449
66 Ga0495627_001569 3300046453 Bacteria 12971
67 Ga0495590_0002231 3300046457 Bacteria 8100
68 Ga0495638_0000411 3300046460 Bacteria 52379
69 Ga0495638_0001028 3300046460 Bacteria 27672
70 Ga0495638_0021400 3300046460 Bacteria 4263
71 Ga0495638_0072347 3300046460 Bacteria 2107
72 Ga0495638_0157321 3300046460 Bacteria 1313
73 Ga0495650_0000020 3300046471 Bacteria 533839
74 Ga0495650_0004931 3300046471 Bacteria 8914
75 Ga0495607_0030103 3300046501 Bacteria 3336
76 Ga0495583_0000001 3300046506 Bacteria 811973
77 Ga0495606_0023120 3300046507 Bacteria 4513
78 Ga0495606_0117008 3300046507 Bacteria 1600
79 Ga0495610_0000132 3300046512 Bacteria 82428
80 Ga0495610_0004200 3300046512 Bacteria 10756
81 Ga0495616_0000697 3300046513 Bacteria 24897
82 Ga0495616_0003580 3300046513 Bacteria 9932
83 Ga0495631_0013319 3300046518 Bacteria 3994
84 Ga0495632_0002173 3300046519 Bacteria 15138
85 Ga0495637_0008246 3300046520 Bacteria 5123
86 Ga0495643_0000378 3300046522 Bacteria 59359
87 Ga0495648_0000230 3300046524 Bacteria 64054
88 Ga0495648_0151514 3300046524 Bacteria 1209
89 Ga0495654_0000081 3300046530 Bacteria 109285
90 Ga0495633_0000371 3300046558 Bacteria 48203
91 Ga0495668_0000042 3300046616 Bacteria 229361
92 Ga0495668_0002566 3300046616 Bacteria 14756
93 Ga0495668_0050013 3300046616 Bacteria 2317
94 Ga0495625_0000283 3300046660 Bacteria 79056
95 Ga0495625_0001423 3300046660 Bacteria 29207
96 Ga0495625_0002876 3300046660 Bacteria 18016
97 Ga0495625_0009874 3300046660 Bacteria 7938
98 Ga0495625_0032384 3300046660 Bacteria 3876
99 Ga0495588_0007879 3300046674 Bacteria 4866
100 Ga0495649_0001201 3300046694 Bacteria 19994
101 Ga0495660_0004713 3300046810 Bacteria 8229
102 Ga0495636_0024651 3300047318 Bacteria 2441
103 Ga0495672_0004006 3300047320 Bacteria 12321
104 Ga0495683_0100983 3300047323 Bacteria 1387
105 Ga0495679_003928 3300047446 Bacteria 7017
106 Ga0495673_0000182 3300047469 Bacteria 101303
107 Ga0495673_0000186 3300047469 Bacteria 100563
108 Ga0495686_0001656 3300047472 Bacteria 23207
109 Ga0495686_0192892 3300047472 Bacteria 1173
110 Ga0496101_0018348 3300048904 Bacteria 4756
111 Ga0496107_0000071 3300048910 Bacteria 49253
112 Ga0496115_0053703 3300048918 Bacteria 3234
113 Ga0496115_0124819 3300048918 Bacteria 2120
114 Ga0496116_0003112 3300048919 Bacteria 16677
115 Ga0496116_0043557 3300048919 Bacteria 3056
116 Ga0496116_0052241 3300048919 Bacteria 2709
117 Ga0496117_0024231 3300048920 Bacteria 4807
118 Ga0496121_0001798 3300048924 Bacteria 34667
119 Ga0496121_0139580 3300048924 Bacteria 1800
120 Ga0496122_0003891 3300048925 Bacteria 19134
121 Ga0496122_0099696 3300048925 Bacteria 1946
122 Ga0496123_0000539 3300048926 Bacteria 65166
123 Ga0496124_0000793 3300048927 Bacteria 51468
124 Ga0496124_0005185 3300048927 Bacteria 14818
125 Ga0496125_0001006 3300048928 Bacteria 43901
126 Ga0496125_0004861 3300048928 Bacteria 15253
127 Ga0495678_002992 3300049459 Bacteria 10774
128 Ga0501033_0004887 3300049570 Bacteria 10673
129 Ga0501034_0053196 3300049571 Bacteria 4079
130 Ga0501044_0003146 3300049823 Bacteria 18661
131 nmdc:mga0k408_32467_c1 3300050493 Bacteria 2983
132 Ga0500635_0001212 3300053080 Bacteria 6169
133 Ga0500578_0000023 3300053086 Bacteria 153470
134 Ga0500578_0105088 3300053086 Bacteria 1784
135 Ga0500644_0000005 3300053088 Bacteria 164966
136 Ga0500644_0000718 3300053088 Bacteria 11724
137 Ga0500641_0000148 3300053096 Bacteria 25837
138 Ga0500556_0001689 3300053104 Bacteria 8493
139 Ga0500562_004467 3300053108 Bacteria 3535
140 Ga0500572_000057 3300053111 Bacteria 33904
141 Ga0500594_0000107 3300053118 Bacteria 24262
142 Ga0500595_005744 3300053119 Bacteria 5369
143 Ga0500608_000344 3300053122 Bacteria 17973
144 Ga0500608_001363 3300053122 Bacteria 8737
145 Ga0500618_000063 3300053125 Bacteria 93515
146 Ga0500559_0000285 3300053136 Bacteria 39102
147 Ga0500559_0006695 3300053136 Bacteria 5177
148 Ga0500559_0021521 3300053136 Bacteria 2733
149 Ga0500564_000642 3300053138 Bacteria 10745
150 Ga0500568_0001232 3300053139 Bacteria 17049
151 Ga0500616_0000142 3300053153 Bacteria 122026
152 Ga0500616_0156682 3300053153 Bacteria 1048
153 Ga0500622_0000878 3300053156 Bacteria 25588
154 Ga0500622_0027960 3300053156 Bacteria 2971
155 Ga0500627_0017069 3300053158 Bacteria 2845
156 Ga0500645_006326 3300053730 Bacteria 4243
157 Ga0500609_000827 3300053731 Bacteria 4658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0156682 Ga0500616_0156682_15_1004 316
2 3300046524 Ga0495648_0151514 Ga0495648_0151514_26_1042 325
3 3300028563 Ga0265319_1009680 Ga0265319_10096804 330
4 3300009036 Ga0105244_10035958 Ga0105244_100359583 341
5 3300048919 Ga0496116_0043557 Ga0496116_0043557_60_1100 341
6 3300048924 Ga0496121_0139580 Ga0496121_0139580_22_1062 341
7 3300048925 Ga0496122_0099696 Ga0496122_0099696_812_1852 341
8 3300048927 Ga0496124_0000793 Ga0496124_0000793_17918_18958 341
9 3300048928 Ga0496125_0001006 Ga0496125_0001006_28562_29602 341
10 iso_pu_bacteria 2512564039 2512729786 341
11 iso_pu_bacteria 2600255286 2601637926 341
12 iso_pu_bacteria 2643221543 2643736297 341
13 iso_pu_bacteria 2671180330 2672335690 341
14 iso_pu_bacteria 2671180694 2673818164 341
15 iso_pu_bacteria 2751185905 2753810552 341
16 iso_pu_bacteria 2791355222 2793182140 341
17 iso_pu_bacteria 2802428803 2802440615 341
18 iso_pu_bacteria 2885526491 2885528976 341
19 iso_pu_bacteria 2889042446 2889045836 341
20 iso_pu_bacteria 2904113452 2904119852 341
21 iso_pu_bacteria 2904162308 2904164366 341
22 iso_pu_bacteria 2904490793 2904492707 341
23 iso_pu_bacteria 2919160200 2919161934 341
24 iso_pu_bacteria 2925326138 2925333223 341
25 iso_pu_bacteria 2931384279 2931389281 341
26 iso_pu_bacteria 2936361878 2936365514 341
27 iso_pu_bacteria 2945991243 2945992147 341
28 iso_pu_bacteria 2946053406 2946054910 341
29 3300028800 Ga0265338_10007655 Ga0265338_100076559 345
30 3300005289 Ga0065704_10071102 Ga0065704_100711026 346
31 3300005347 Ga0070668_100087810 Ga0070668_1000878102 346
32 3300053096 Ga0500641_0000148 Ga0500641_0000148_2384_3481 346
33 iso_pu_bacteria 2510917020 2511123042 346
34 iso_pu_bacteria 2582581279 2585146024 346
35 iso_pu_bacteria 2582581280 2585150675 346
36 iso_pu_bacteria 2582581293 2585198192 346
37 iso_pu_bacteria 2585428106 2587916104 346
38 iso_pu_bacteria 2643221545 2643751102 346
39 iso_pu_bacteria 2643221552 2643782829 346
40 iso_pu_bacteria 2643221583 2643926756 346
41 iso_pu_bacteria 2643221584 2643928135 346
42 iso_pu_bacteria 2643221640 2644224368 346
43 iso_pu_bacteria 2643221642 2644234695 346
44 iso_pu_bacteria 2643221691 2644511068 346
45 iso_pu_bacteria 2739367756 2739790515 346
46 iso_pu_bacteria 2791355048 2792461383 346
47 iso_pu_bacteria 2818991435 2819539645 346
48 iso_pu_bacteria 2818991454 2819647006 346
49 iso_pu_bacteria 2843744320 2843749182 346
50 iso_pu_bacteria 2849560528 2849564490 346
51 iso_pu_bacteria 2849573788 2849575356 346
52 iso_pu_bacteria 2851153111 2851155414 346
53 iso_pu_bacteria 2857504554 2857507327 346
54 iso_pu_bacteria 2884960567 2884962855 346
55 iso_pu_bacteria 2898329390 2898331251 346
56 iso_pu_bacteria 2928531327 2928532629 346
57 iso_pu_bacteria 2643221574 2643883773 347
58 iso_pu_bacteria 2643221663 2644354136 347
59 iso_pu_bacteria 2643221699 2644547704 347
60 iso_pu_bacteria 2643221699 2644548185 347
61 iso_pu_bacteria 2860339153 2860339473 347
62 iso_pu_bacteria 2928972540 2928974872 347
63 iso_pu_bacteria 2977240413 2977242083 347
64 3300039450 Ga0436363_0115159 Ga0436363_0115159_437_1537 348
65 iso_pu_bacteria 2643221598 2643998951 348
66 iso_pu_bacteria 2643221614 2644086402 348
67 iso_pu_bacteria 2643221661 2644344900 348
68 iso_pu_bacteria 2643221666 2644367643 348
69 iso_pu_bacteria 2842775625 2842779802 348
70 3300053108 Ga0500562_004467 Ga0500562_004467_907_1998 349
71 3300003322 rootL2_10140063 rootL2_101400632 350
72 3300003773 Ga0055537_1001686 Ga0055537_10016864 350
73 3300003775 Ga0055524_1002745 Ga0055524_10027459 350
74 3300003781 Ga0055536_1000132 Ga0055536_100013246 350
75 3300003781 Ga0055536_1000807 Ga0055536_100080711 350
76 3300003790 Ga0055528_1008144 Ga0055528_10081443 350
77 3300003791 Ga0055530_10001022 Ga0055530_1000102218 350
78 3300003791 Ga0055530_10013884 Ga0055530_100138842 350
79 3300003794 Ga0055531_10000277 Ga0055531_1000027712 350
80 3300005262 Ga0065165_1001574 Ga0065165_10015741 350
81 3300006195 Ga0075366_10068158 Ga0075366_100681583 350
82 3300015684 Ga0183365_10001 Ga0183365_100011200 350
83 3300025263 Ga0209565_1000168 Ga0209565_100016874 350
84 3300025273 Ga0209673_1001427 Ga0209673_100142721 350
85 3300025291 Ga0209675_1005136 Ga0209675_10051366 350
86 3300025292 Ga0209676_1000099 Ga0209676_1000099221 350
87 3300025292 Ga0209676_1000150 Ga0209676_100015038 350
88 3300025295 Ga0209564_1003316 Ga0209564_10033162 350
89 3300025295 Ga0209564_1007990 Ga0209564_10079902 350
90 3300025297 Ga0209758_1001830 Ga0209758_100183014 350
91 3300025297 Ga0209758_1003175 Ga0209758_10031755 350
92 3300025298 Ga0209050_1000154 Ga0209050_1000154112 350
93 3300025298 Ga0209050_1000249 Ga0209050_100024974 350
94 3300025298 Ga0209050_1001822 Ga0209050_100182210 350
95 3300025299 Ga0209256_1001139 Ga0209256_100113911 350
96 3300025299 Ga0209256_1007105 Ga0209256_10071052 350
97 3300025299 Ga0209256_1019797 Ga0209256_10197972 350
98 3300025303 Ga0209051_1001723 Ga0209051_10017237 350
99 3300025304 Ga0209257_1000203 Ga0209257_100020331 350
100 3300025304 Ga0209257_1000430 Ga0209257_100043052 350
101 3300025304 Ga0209257_1002627 Ga0209257_100262711 350
102 3300028794 Ga0307515_10061431 Ga0307515_100614312 350
103 3300028794 Ga0307515_10182389 Ga0307515_101823893 350
104 3300036647 Ga0316582_0189680 Ga0316582_0189680_236_1345 350
105 3300042156 Ga0439446_0001377 Ga0439446_0001377_560_1651 350
106 3300046453 Ga0495627_001569 Ga0495627_001569_10343_11434 350
107 3300046457 Ga0495590_0002231 Ga0495590_0002231_2888_3979 350
108 3300046460 Ga0495638_0000411 Ga0495638_0000411_25239_26330 350
109 3300046460 Ga0495638_0001028 Ga0495638_0001028_14060_15151 350
110 3300046460 Ga0495638_0021400 Ga0495638_0021400_2560_3651 350
111 3300046460 Ga0495638_0072347 Ga0495638_0072347_75_1166 350
112 3300046460 Ga0495638_0157321 Ga0495638_0157321_97_1266 350
113 3300046471 Ga0495650_0000020 Ga0495650_0000020_465981_467072 350
114 3300046501 Ga0495607_0030103 Ga0495607_0030103_1421_2512 350
115 3300046506 Ga0495583_0000001 Ga0495583_0000001_253704_254795 350
116 3300046507 Ga0495606_0023120 Ga0495606_0023120_882_1973 350
117 3300046507 Ga0495606_0117008 Ga0495606_0117008_414_1505 350
118 3300046512 Ga0495610_0000132 Ga0495610_0000132_18804_19895 350
119 3300046512 Ga0495610_0004200 Ga0495610_0004200_3755_4846 350
120 3300046513 Ga0495616_0000697 Ga0495616_0000697_4569_5660 350
121 3300046513 Ga0495616_0003580 Ga0495616_0003580_1680_2732 350
122 3300046518 Ga0495631_0013319 Ga0495631_0013319_62_1153 350
123 3300046519 Ga0495632_0002173 Ga0495632_0002173_9929_11020 350
124 3300046520 Ga0495637_0008246 Ga0495637_0008246_4006_5097 350
125 3300046522 Ga0495643_0000378 Ga0495643_0000378_50408_51460 350
126 3300046524 Ga0495648_0000230 Ga0495648_0000230_12522_13613 350
127 3300046530 Ga0495654_0000081 Ga0495654_0000081_64367_65458 350
128 3300046616 Ga0495668_0000042 Ga0495668_0000042_23991_25082 350
129 3300046616 Ga0495668_0002566 Ga0495668_0002566_993_2084 350
130 3300046616 Ga0495668_0050013 Ga0495668_0050013_1039_2130 350
131 3300046660 Ga0495625_0000283 Ga0495625_0000283_65581_66672 350
132 3300046660 Ga0495625_0001423 Ga0495625_0001423_20230_21321 350
133 3300046660 Ga0495625_0002876 Ga0495625_0002876_14206_15297 350
134 3300046660 Ga0495625_0009874 Ga0495625_0009874_6301_7392 350
135 3300046660 Ga0495625_0032384 Ga0495625_0032384_2716_3807 350
136 3300046810 Ga0495660_0004713 Ga0495660_0004713_1460_2551 350
137 3300047320 Ga0495672_0004006 Ga0495672_0004006_85_1176 350
138 3300047323 Ga0495683_0100983 Ga0495683_0100983_66_1157 350
139 3300047446 Ga0495679_003928 Ga0495679_003928_4753_5844 350
140 3300047469 Ga0495673_0000182 Ga0495673_0000182_26307_27398 350
141 3300047469 Ga0495673_0000186 Ga0495673_0000186_29458_30549 350
142 3300047472 Ga0495686_0001656 Ga0495686_0001656_11109_12200 350
143 3300047472 Ga0495686_0192892 Ga0495686_0192892_63_1154 350
144 3300048904 Ga0496101_0018348 Ga0496101_0018348_380_1603 350
145 3300048910 Ga0496107_0000071 Ga0496107_0000071_15432_16523 350
146 3300048918 Ga0496115_0053703 Ga0496115_0053703_17_1108 350
147 3300048924 Ga0496121_0001798 Ga0496121_0001798_26551_27642 350
148 3300048927 Ga0496124_0005185 Ga0496124_0005185_4268_5359 350
149 3300048928 Ga0496125_0004861 Ga0496125_0004861_10172_11263 350
150 3300049459 Ga0495678_002992 Ga0495678_002992_9590_10681 350
151 3300049571 Ga0501034_0053196 Ga0501034_0053196_1642_2736 350
152 3300050493 nmdc:mga0k408_32467_c1 nmdc:mga0k408_32467_c1_200_1291 350
153 3300053080 Ga0500635_0001212 Ga0500635_0001212_37_1131 350
154 3300053086 Ga0500578_0000023 Ga0500578_0000023_12291_13382 350
155 3300053086 Ga0500578_0105088 Ga0500578_0105088_387_1478 350
156 3300053088 Ga0500644_0000005 Ga0500644_0000005_154258_155349 350
157 3300053104 Ga0500556_0001689 Ga0500556_0001689_7354_8445 350
158 3300053118 Ga0500594_0000107 Ga0500594_0000107_15559_16650 350
159 3300053119 Ga0500595_005744 Ga0500595_005744_3935_5194 350
160 3300053122 Ga0500608_000344 Ga0500608_000344_12762_13853 350
161 3300053122 Ga0500608_001363 Ga0500608_001363_7439_8533 350
162 3300053125 Ga0500618_000063 Ga0500618_000063_58717_59808 350
163 3300053136 Ga0500559_0000285 Ga0500559_0000285_9829_10920 350
164 3300053136 Ga0500559_0021521 Ga0500559_0021521_1489_2580 350
165 3300053138 Ga0500564_000642 Ga0500564_000642_206_1297 350
166 3300053156 Ga0500622_0000878 Ga0500622_0000878_9906_10997 350
167 3300053156 Ga0500622_0027960 Ga0500622_0027960_1783_2874 350
168 3300053158 Ga0500627_0017069 Ga0500627_0017069_1697_2788 350
169 3300053730 Ga0500645_006326 Ga0500645_006326_509_1600 350
170 3300053731 Ga0500609_000827 Ga0500609_000827_129_1220 350
171 iso_pu_bacteria 2599185359 2600228819 350
172 iso_pu_bacteria 2721755487 2722727486 350
173 iso_pu_bacteria 2904780799 2904781754 350
174 iso_pu_bacteria 2919177583 2919181511 350
175 3300003781 Ga0055536_1005136 Ga0055536_10051365 351
176 3300003794 Ga0055531_10008353 Ga0055531_100083534 351
177 3300005455 Ga0070663_100272864 Ga0070663_1002728641 351
178 3300009148 Ga0105243_10263635 Ga0105243_102636351 351
179 3300013102 Ga0157371_10012254 Ga0157371_100122545 351
180 3300025292 Ga0209676_1000046 Ga0209676_1000046118 351
181 3300025304 Ga0209257_1000505 Ga0209257_100050567 351
182 3300031901 Ga0307406_10008931 Ga0307406_100089312 351
183 3300031911 Ga0307412_10003148 Ga0307412_1000314812 351
184 3300046471 Ga0495650_0004931 Ga0495650_0004931_1593_2687 351
185 3300046558 Ga0495633_0000371 Ga0495633_0000371_43407_44534 351
186 3300046694 Ga0495649_0001201 Ga0495649_0001201_12634_13731 351
187 3300048918 Ga0496115_0124819 Ga0496115_0124819_1009_2106 351
188 3300048919 Ga0496116_0052241 Ga0496116_0052241_254_1375 351
189 3300048925 Ga0496122_0003891 Ga0496122_0003891_12485_13582 351
190 3300048926 Ga0496123_0000539 Ga0496123_0000539_64030_65127 351
191 3300053088 Ga0500644_0000718 Ga0500644_0000718_1722_2819 351
192 3300053139 Ga0500568_0001232 Ga0500568_0001232_4451_5614 351
193 3300053153 Ga0500616_0000142 Ga0500616_0000142_47165_48361 351
194 iso_pu_bacteria 2671180139 2671692367 351
195 3300005289 Ga0065704_10070242 Ga0065704_1007024238 352
196 3300005577 Ga0068857_100042258 Ga0068857_1000422582 352
197 3300005844 Ga0068862_100331732 Ga0068862_1003317321 352
198 3300028800 Ga0265338_10064646 Ga0265338_100646462 352
199 3300028800 Ga0265338_10107864 Ga0265338_101078641 352
200 3300031235 Ga0265330_10000322 Ga0265330_1000032210 352
201 3300031251 Ga0265327_10000772 Ga0265327_1000077230 352
202 3300033180 Ga0307510_10080942 Ga0307510_100809422 352
203 3300044673 Ga0453683_0003116 Ga0453683_0003116_5940_7043 352
204 3300044712 Ga0453684_0021071 Ga0453684_0021071_1820_2923 352
205 3300045051 Ga0451576_0019266 Ga0451576_0019266_2722_3825 352
206 3300046674 Ga0495588_0007879 Ga0495588_0007879_2266_3366 352
207 3300047318 Ga0495636_0024651 Ga0495636_0024651_693_1793 352
208 3300049570 Ga0501033_0004887 Ga0501033_0004887_8696_9883 352
209 3300049823 Ga0501044_0003146 Ga0501044_0003146_12670_13788 352
210 3300053111 Ga0500572_000057 Ga0500572_000057_9184_10302 352
211 3300053136 Ga0500559_0006695 Ga0500559_0006695_3995_5110 352
212 2162886007 SwRhRL2b_contig_1926986 SwRhRL2b_0208.00004020 354
213 3300005289 Ga0065704_10070805 Ga0065704_1007080513 354
214 3300009148 Ga0105243_10000004 Ga0105243_10000004153 354
215 3300025935 Ga0207709_10000010 Ga0207709_10000010155 354
216 3300048919 Ga0496116_0003112 Ga0496116_0003112_466_1530 354
217 3300048920 Ga0496117_0024231 Ga0496117_0024231_2295_3359 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

5

305

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ot7-assembly1.cif.gz_A x-structure of a variant of ncr from zymomonas mobilis 0.8746 5 337
8e5h-assembly1.cif.gz_A old yellow enzyme 5 (pcoye5) from pseudomonas chloritidismutans 0.853 5 354
4ab4-assembly1.cif.gz_A structure of xenobiotic reductase b from pseudomonas putida in complex with tnt 0.8443 5 337
1icq-assembly2.cif.gz_B crystal structure of 12-oxophytodienoate reductase 1 from tomato complexed with 9r,13r-opda 0.8421 5 350
2hs8-assembly2.cif.gz_B crystal structure of the y364f mutant of 12-oxophytodienoate reductase 3 from tomato 0.8418 6 337
ID Description Score Start End Superfamily
4ot7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8746 5 337 3.20.20.70
af_Q4CNI1_1_256_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8648 1 210 3.20.20.70
af_Q8GYA3_1_324_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8445 12 337 3.20.20.70
af_E9AGH7_3_365_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8414 3 337 3.20.20.70
5k1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8329 1 354 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3B9N8P5-F1-model_v4 12-oxophytodienoate reductase 0.9913 158 354 GO:0009056
GO:0010181
GO:0016491
AF-A0A519Y922-F1-model_v4 12-oxophytodienoate reductase 0.9868 124 354 GO:0009056
GO:0010181
GO:0016491
AF-A0A0D7X512-F1-model_v4 1,2-oxophytodienoate reductase 0.9861 3 354 GO:0005829
GO:0010181
GO:0016491
AF-A0A3B8XQV6-F1-model_v4 12-oxophytodienoate reductase 0.9818 1 109 GO:0005829
GO:0010181
GO:0016491
AF-A0A3B9N8P5-F1-model_v4 12-oxophytodienoate reductase 0.9814 158 354 GO:0009056
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
93.48 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map