F329174

General Info

Members Datasets Scaffolds Average Seq Length
217 119 434 222

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0110120|Ga0495600_0110120_514_1290
Length 258
Sequence MVAEKIIITLNAVCSAAPLCGYMDSVMSTQAHRTLMLSGPAGRMETILWSIPGNEGNAPPLAAVVCHPHPLFGGTMHNKVVYQTAKTIHRFGLPVARFNFRGVGLSEGIHDKGLGEKDDVLVVLDFLEREFPGVPQLVAGFSFGSWVGLRAGCEDARVGELIGLGLPVGDLDNRSFSYLDRCDKPKLFVSGEFDRFGPPKKLRAMVEQFPPHVKDKTKVVIVAGGDHFFAGHLAELDRAIANWLLERHPELAAAESRE

Samples

Sample ID Description Type Environment
1 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
38 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
60 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
61 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
62 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
64 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 1.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.38
Rhizosphere 98.16
Stem 0
Stem Tuber 0
Unclassified 28.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495600_0110120 3300046809 Bacteria 1793
2 Ga0070709_10007959 3300005434 Bacteria 5822
3 Ga0070709_10014173 3300005434 Unclassified 4503
4 Ga0070713_100004192 3300005436 Bacteria 9622
5 Ga0070713_100175558 3300005436 Unclassified 1922
6 Ga0070711_100018051 3300005439 Bacteria 4501
7 Ga0070708_100000222 3300005445 Bacteria 42379
8 Ga0070708_100187006 3300005445 Bacteria 1937
9 Ga0070706_100377924 3300005467 Bacteria 1320
10 Ga0070707_100015701 3300005468 Bacteria 7111
11 Ga0070707_100185086 3300005468 Bacteria 2031
12 Ga0070699_100010490 3300005518 Bacteria 8014
13 Ga0070679_100022747 3300005530 Bacteria 6130
14 Ga0070697_100000338 3300005536 Bacteria 36980
15 Ga0070695_100000137 3300005545 Bacteria 33722
16 Ga0070695_100146947 3300005545 Bacteria 1641
17 Ga0070696_100013857 3300005546 Bacteria 5413
18 Ga0070693_100000607 3300005547 Bacteria 15853
19 Ga0070704_100012989 3300005549 Bacteria 5153
20 Ga0068859_100118608 3300005617 Bacteria 2712
21 Ga0068859_100615871 3300005617 Bacteria 1178
22 Ga0068866_10038522 3300005718 Bacteria 2354
23 Ga0068863_100420997 3300005841 Unclassified 1308
24 Ga0068860_100001128 3300005843 Bacteria 29373
25 Ga0070715_10139070 3300006163 Bacteria 1177
26 Ga0070716_100000850 3300006173 Bacteria 13174
27 Ga0070716_100038687 3300006173 Bacteria 2642
28 Ga0070716_100114458 3300006173 Unclassified 1677
29 Ga0070716_100385382 3300006173 Bacteria 1003
30 Ga0070716_100391310 3300006173 Unclassified 997
31 Ga0097621_100038231 3300006237 Unclassified 3851
32 Ga0075434_100028963 3300006871 Bacteria 5446
33 Ga0075436_100001264 3300006914 Bacteria 17167
34 Ga0075436_100013767 3300006914 Bacteria 5539
35 Ga0075436_100039095 3300006914 Unclassified 3273
36 Ga0075436_100344325 3300006914 Unclassified 1074
37 Ga0097620_100118605 3300006931 Bacteria 2712
38 Ga0097620_100615926 3300006931 Bacteria 1178
39 Ga0075435_100071346 3300007076 Bacteria 2836
40 Ga0075435_100121859 3300007076 Bacteria 2176
41 Ga0099794_10000631 3300007265 Bacteria 11743
42 Ga0099794_10003131 3300007265 Bacteria 6264
43 Ga0099794_10011533 3300007265 Unclassified 3785
44 Ga0099794_10017551 3300007265 Bacteria 3192
45 Ga0099794_10018084 3300007265 Bacteria 3154
46 Ga0099794_10019590 3300007265 Unclassified 3052
47 Ga0099794_10034946 3300007265 Unclassified 2370
48 Ga0099794_10035454 3300007265 Unclassified 2354
49 Ga0099794_10063795 3300007265 Bacteria 1794
50 Ga0099794_10091268 3300007265 Bacteria 1512
51 Ga0099794_10221026 3300007265 Unclassified 973
52 Ga0099795_10048089 3300007788 Unclassified 1543
53 Ga0099795_10164553 3300007788 Bacteria 918
54 Ga0105245_10021900 3300009098 Bacteria 5608
55 Ga0105247_10202126 3300009101 Unclassified 1336
56 Ga0105248_10766561 3300009177 Unclassified 1089
57 Ga0099796_10107225 3300010159 Unclassified 1059
58 Ga0105239_10047470 3300010375 Bacteria 4706
59 Ga0105239_10763111 3300010375 Unclassified 1107
60 Ga0157378_10000122 3300013297 Bacteria 75146
61 Ga0157378_10030465 3300013297 Unclassified 4768
62 Ga0163163_10434045 3300014325 Bacteria 1373
63 Ga0157379_10196741 3300014968 Bacteria 1822
64 Ga0157376_10000057 3300014969 Bacteria 97940
65 Ga0228598_1003444 3300024227 Unclassified 3402
66 Ga0207653_10004412 3300025885 Unclassified 4409
67 Ga0207642_10022746 3300025899 Bacteria 2492
68 Ga0207710_10102873 3300025900 Unclassified 1349
69 Ga0207699_10059815 3300025906 Bacteria 2285
70 Ga0207684_10428793 3300025910 Unclassified 1136
71 Ga0207695_10126902 3300025913 Bacteria 2512
72 Ga0207663_10035957 3300025916 Bacteria 2976
73 Ga0207663_10084055 3300025916 Bacteria 2093
74 Ga0207663_10265311 3300025916 Bacteria 1270
75 Ga0207652_10009730 3300025921 Bacteria 7734
76 Ga0207646_10000754 3300025922 Bacteria 42028
77 Ga0207700_10003154 3300025928 Bacteria 9516
78 Ga0207700_10017886 3300025928 Bacteria 4746
79 Ga0207690_10069257 3300025932 Bacteria 2427
80 Ga0207665_10000213 3300025939 Bacteria 39281
81 Ga0207665_10001606 3300025939 Bacteria 15238
82 Ga0207665_10010905 3300025939 Bacteria 5965
83 Ga0207665_10060850 3300025939 Unclassified 2558
84 Ga0207665_10061606 3300025939 Bacteria 2543
85 Ga0207665_10203563 3300025939 Unclassified 1443
86 Ga0207711_10881044 3300025941 Unclassified 832
87 Ga0207641_10084361 3300026088 Bacteria 2765
88 Ga0209588_1003707 3300027671 Unclassified 4251
89 Ga0209588_1005218 3300027671 Bacteria 3709
90 Ga0209588_1006072 3300027671 Bacteria 3489
91 Ga0209588_1014178 3300027671 Unclassified 2438
92 Ga0209588_1033588 3300027671 Bacteria 1645
93 Ga0209588_1059506 3300027671 Bacteria 1235
94 Ga0209588_1069663 3300027671 Bacteria 1136
95 Ga0265354_1000339 3300028016 Bacteria 8274
96 Ga0265354_1003368 3300028016 Bacteria 1797
97 Ga0268266_10000112 3300028379 Bacteria 168186
98 Ga0268264_10158990 3300028381 Bacteria 2033
99 Ga0265770_1005211 3300030878 Bacteria 1786
100 Ga0265770_1018186 3300030878 Bacteria 1093
101 Ga0265765_1010135 3300030879 Bacteria 1047
102 Ga0265760_10023143 3300031090 Bacteria 1804
103 Ga0316212_1002684 3300033547 Bacteria 2539
104 Ga0373926_0000650 3300035083 Bacteria 9490
105 Ga0373926_0024012 3300035083 Bacteria 2120
106 Ga0373934_0004520 3300035086 Bacteria 5141
107 Ga0373923_0047938 3300035111 Unclassified 1782
108 Ga0373953_0101997 3300035117 Bacteria 1208
109 Ga0373954_0000079 3300035118 Bacteria 34014
110 Ga0373956_0008104 3300035119 Unclassified 4252
111 Ga0373957_0003577 3300035120 Unclassified 4616
112 Ga0373943_0068510 3300035170 Bacteria 1792
113 Ga0373943_0328711 3300035170 Unclassified 873
114 Ga0373946_0143194 3300035171 Unclassified 1110
115 Ga0373955_0002899 3300035172 Bacteria 7524
116 Ga0373955_0375509 3300035172 Unclassified 862
117 Ga0373935_0006917 3300035692 Bacteria 6771
118 Ga0373935_0094175 3300035692 Bacteria 1965
119 Ga0373927_0006303 3300035695 Bacteria 8089
120 Ga0373927_0044562 3300035695 Unclassified 2869
121 Ga0373927_0385984 3300035695 Unclassified 924
122 Ga0373933_0000451 3300035724 Bacteria 25716
123 Ga0373947_0004474 3300035725 Bacteria 8205
124 Ga0373947_0006043 3300035725 Bacteria 7058
125 Ga0373937_0015753 3300036401 Bacteria 6696
126 Ga0373937_0032737 3300036401 Bacteria 4716
127 Ga0373937_0375095 3300036401 Bacteria 1349
128 Ga0373937_0405314 3300036401 Bacteria 1294
129 Ga0373925_0127147 3300037068 Unclassified 1984
130 Ga0451577_0048285 3300042876 Bacteria 3803
131 Ga0453683_0060917 3300044673 Bacteria 2359
132 Ga0453683_0215655 3300044673 Unclassified 1220
133 Ga0453684_0151407 3300044712 Bacteria 2756
134 Ga0495592_0002037 3300046454 Bacteria 14223
135 Ga0495592_0051403 3300046454 Bacteria 3061
136 Ga0495603_0516163 3300046455 Bacteria 684
137 Ga0495651_0000281 3300046462 Bacteria 39620
138 Ga0495651_0004297 3300046462 Bacteria 10921
139 Ga0495651_0029847 3300046462 Bacteria 4251
140 Ga0495651_0031988 3300046462 Unclassified 4104
141 Ga0495651_0260299 3300046462 Bacteria 1181
142 Ga0495651_0383682 3300046462 Bacteria 921
143 Ga0495653_0005052 3300046463 Bacteria 10707
144 Ga0495580_0003887 3300046472 Bacteria 12632
145 Ga0495580_0038611 3300046472 Bacteria 3419
146 Ga0495580_0051139 3300046472 Bacteria 2921
147 Ga0495580_0414754 3300046472 Unclassified 906
148 Ga0495582_0000243 3300046473 Bacteria 30324
149 Ga0495664_0070222 3300046477 Unclassified 2091
150 Ga0495664_0103128 3300046477 Unclassified 1719
151 Ga0495608_0001246 3300046511 Bacteria 18085
152 Ga0495608_0011427 3300046511 Bacteria 6180
153 Ga0495608_0035452 3300046511 Bacteria 3365
154 Ga0495608_0120693 3300046511 Bacteria 1681
155 Ga0495618_0019832 3300046514 Unclassified 4139
156 Ga0495628_0001874 3300046516 Bacteria 19103
157 Ga0495628_0011088 3300046516 Bacteria 7627
158 Ga0495630_0009910 3300046517 Bacteria 6862
159 Ga0495666_0136653 3300046526 Unclassified 1144
160 Ga0495652_0000890 3300046529 Bacteria 34362
161 Ga0495652_0039450 3300046529 Bacteria 4083
162 Ga0495586_0001931 3300046535 Bacteria 11297
163 Ga0495587_0008458 3300046536 Bacteria 6614
164 Ga0495587_0012816 3300046536 Bacteria 5272
165 Ga0495645_0034955 3300046543 Bacteria 3664
166 Ga0495645_0083752 3300046543 Viruses 2285
167 Ga0495667_0000500 3300046559 Bacteria 25042
168 Ga0495667_0010615 3300046559 Unclassified 6232
169 Ga0495667_0015593 3300046559 Bacteria 5137
170 Ga0495667_0096123 3300046559 Bacteria 1918
171 Ga0495667_0096588 3300046559 Unclassified 1913
172 Ga0495635_0053431 3300046663 Bacteria 2784
173 Ga0495635_0320571 3300046663 Unclassified 1037
174 Ga0495635_0404868 3300046663 Bacteria 906
175 Ga0495657_0063989 3300046675 Bacteria 2424
176 Ga0495599_0010265 3300046678 Bacteria 5731
177 Ga0495623_0001923 3300046679 Bacteria 13952
178 Ga0495623_0056423 3300046679 Bacteria 2473
179 Ga0495646_0027560 3300046680 Bacteria 3564
180 Ga0495613_0062940 3300046689 Bacteria 2715
181 Ga0495613_0122507 3300046689 Bacteria 1866
182 Ga0495624_0018853 3300046690 Bacteria 4611
183 Ga0495624_0124109 3300046690 Bacteria 1585
184 Ga0495624_0568503 3300046690 Viruses 677
185 Ga0495600_0002000 3300046809 Bacteria 11466
186 Ga0495600_0008508 3300046809 Bacteria 6307
187 Ga0495604_0005429 3300047317 Bacteria 10108
188 Ga0495604_0088469 3300047317 Unclassified 2304
189 Ga0495674_0025761 3300047319 Bacteria 5386
190 Ga0495676_0015198 3300047321 Bacteria 6864
191 Ga0495676_0412929 3300047321 Unclassified 894
192 Ga0495676_0435771 3300047321 Unclassified 866
193 Ga0495680_0000178 3300047322 Bacteria 67353
194 Ga0495680_0002040 3300047322 Bacteria 21141
195 Ga0495675_0000335 3300047444 Bacteria 33159
196 Ga0495675_0016201 3300047444 Bacteria 4714
197 Ga0495684_0002550 3300047471 Bacteria 14496
198 Ga0495684_0081825 3300047471 Bacteria 2450
199 Ga0495684_0345047 3300047471 Unclassified 1059
200 Ga0495593_0006121 3300047673 Bacteria 7079
201 Ga0495593_0223394 3300047673 Unclassified 945
202 Ga0495602_0022424 3300048088 Bacteria 6180
203 Ga0495602_0036152 3300048088 Bacteria 4600
204 Ga0495602_0465190 3300048088 Unclassified 890
205 Ga0495614_0007471 3300048089 Bacteria 4865
206 Ga0496102_0008826 3300048905 Bacteria 8647
207 Ga0496114_0017828 3300048917 Bacteria 5739
208 Ga0496115_0046518 3300048918 Unclassified 3468
209 nmdc:mga0n895_97561_c1 3300050512 Unclassified 2945
210 nmdc:mga08x19_25827_c1 3300050514 Unclassified 3662
211 nmdc:mga08x19_305441_c1 3300050514 Unclassified 1105
212 nmdc:mga08x19_413_c1 3300050514 Bacteria 29764
213 nmdc:mga08x19_54322_c1 3300050514 Unclassified 2578
214 Ga0495601_0198343 3300053077 Unclassified 1312
215 Ga0495612_0005823 3300053078 Bacteria 5089
216 Ga0495619_0508167 3300053085 Unclassified 828
217 Ga0495619_0519276 3300053085 Unclassified 818
218 Ga0495600_0110120
219 Ga0070709_10007959
220 Ga0070709_10014173
221 Ga0070713_100004192
222 Ga0070713_100175558
223 Ga0070711_100018051
224 Ga0070708_100000222
225 Ga0070708_100187006
226 Ga0070706_100377924
227 Ga0070707_100015701
228 Ga0070707_100185086
229 Ga0070699_100010490
230 Ga0070679_100022747
231 Ga0070697_100000338
232 Ga0070695_100000137
233 Ga0070695_100146947
234 Ga0070696_100013857
235 Ga0070693_100000607
236 Ga0070704_100012989
237 Ga0068859_100118608
238 Ga0068859_100615871
239 Ga0068866_10038522
240 Ga0068863_100420997
241 Ga0068860_100001128
242 Ga0070715_10139070
243 Ga0070716_100000850
244 Ga0070716_100038687
245 Ga0070716_100114458
246 Ga0070716_100385382
247 Ga0070716_100391310
248 Ga0097621_100038231
249 Ga0075434_100028963
250 Ga0075436_100001264
251 Ga0075436_100013767
252 Ga0075436_100039095
253 Ga0075436_100344325
254 Ga0097620_100118605
255 Ga0097620_100615926
256 Ga0075435_100071346
257 Ga0075435_100121859
258 Ga0099794_10000631
259 Ga0099794_10003131
260 Ga0099794_10011533
261 Ga0099794_10017551
262 Ga0099794_10018084
263 Ga0099794_10019590
264 Ga0099794_10034946
265 Ga0099794_10035454
266 Ga0099794_10063795
267 Ga0099794_10091268
268 Ga0099794_10221026
269 Ga0099795_10048089
270 Ga0099795_10164553
271 Ga0105245_10021900
272 Ga0105247_10202126
273 Ga0105248_10766561
274 Ga0099796_10107225
275 Ga0105239_10047470
276 Ga0105239_10763111
277 Ga0157378_10000122
278 Ga0157378_10030465
279 Ga0163163_10434045
280 Ga0157379_10196741
281 Ga0157376_10000057
282 Ga0228598_1003444
283 Ga0207653_10004412
284 Ga0207642_10022746
285 Ga0207710_10102873
286 Ga0207699_10059815
287 Ga0207684_10428793
288 Ga0207695_10126902
289 Ga0207663_10035957
290 Ga0207663_10084055
291 Ga0207663_10265311
292 Ga0207652_10009730
293 Ga0207646_10000754
294 Ga0207700_10003154
295 Ga0207700_10017886
296 Ga0207690_10069257
297 Ga0207665_10000213
298 Ga0207665_10001606
299 Ga0207665_10010905
300 Ga0207665_10060850
301 Ga0207665_10061606
302 Ga0207665_10203563
303 Ga0207711_10881044
304 Ga0207641_10084361
305 Ga0209588_1003707
306 Ga0209588_1005218
307 Ga0209588_1006072
308 Ga0209588_1014178
309 Ga0209588_1033588
310 Ga0209588_1059506
311 Ga0209588_1069663
312 Ga0265354_1000339
313 Ga0265354_1003368
314 Ga0268266_10000112
315 Ga0268264_10158990
316 Ga0265770_1005211
317 Ga0265770_1018186
318 Ga0265765_1010135
319 Ga0265760_10023143
320 Ga0316212_1002684
321 Ga0373926_0000650
322 Ga0373926_0024012
323 Ga0373934_0004520
324 Ga0373923_0047938
325 Ga0373953_0101997
326 Ga0373954_0000079
327 Ga0373956_0008104
328 Ga0373957_0003577
329 Ga0373943_0068510
330 Ga0373943_0328711
331 Ga0373946_0143194
332 Ga0373955_0002899
333 Ga0373955_0375509
334 Ga0373935_0006917
335 Ga0373935_0094175
336 Ga0373927_0006303
337 Ga0373927_0044562
338 Ga0373927_0385984
339 Ga0373933_0000451
340 Ga0373947_0004474
341 Ga0373947_0006043
342 Ga0373937_0015753
343 Ga0373937_0032737
344 Ga0373937_0375095
345 Ga0373937_0405314
346 Ga0373925_0127147
347 Ga0451577_0048285
348 Ga0453683_0060917
349 Ga0453683_0215655
350 Ga0453684_0151407
351 Ga0495592_0002037
352 Ga0495592_0051403
353 Ga0495603_0516163
354 Ga0495651_0000281
355 Ga0495651_0004297
356 Ga0495651_0029847
357 Ga0495651_0031988
358 Ga0495651_0260299
359 Ga0495651_0383682
360 Ga0495653_0005052
361 Ga0495580_0003887
362 Ga0495580_0038611
363 Ga0495580_0051139
364 Ga0495580_0414754
365 Ga0495582_0000243
366 Ga0495664_0070222
367 Ga0495664_0103128
368 Ga0495608_0001246
369 Ga0495608_0011427
370 Ga0495608_0035452
371 Ga0495608_0120693
372 Ga0495618_0019832
373 Ga0495628_0001874
374 Ga0495628_0011088
375 Ga0495630_0009910
376 Ga0495666_0136653
377 Ga0495652_0000890
378 Ga0495652_0039450
379 Ga0495586_0001931
380 Ga0495587_0008458
381 Ga0495587_0012816
382 Ga0495645_0034955
383 Ga0495645_0083752
384 Ga0495667_0000500
385 Ga0495667_0010615
386 Ga0495667_0015593
387 Ga0495667_0096123
388 Ga0495667_0096588
389 Ga0495635_0053431
390 Ga0495635_0320571
391 Ga0495635_0404868
392 Ga0495657_0063989
393 Ga0495599_0010265
394 Ga0495623_0001923
395 Ga0495623_0056423
396 Ga0495646_0027560
397 Ga0495613_0062940
398 Ga0495613_0122507
399 Ga0495624_0018853
400 Ga0495624_0124109
401 Ga0495624_0568503
402 Ga0495600_0002000
403 Ga0495600_0008508
404 Ga0495604_0005429
405 Ga0495604_0088469
406 Ga0495674_0025761
407 Ga0495676_0015198
408 Ga0495676_0412929
409 Ga0495676_0435771
410 Ga0495680_0000178
411 Ga0495680_0002040
412 Ga0495675_0000335
413 Ga0495675_0016201
414 Ga0495684_0002550
415 Ga0495684_0081825
416 Ga0495684_0345047
417 Ga0495593_0006121
418 Ga0495593_0223394
419 Ga0495602_0022424
420 Ga0495602_0036152
421 Ga0495602_0465190
422 Ga0495614_0007471
423 Ga0496102_0008826
424 Ga0496114_0017828
425 Ga0496115_0046518
426 nmdc:mga0n895_97561_c1
427 nmdc:mga08x19_25827_c1
428 nmdc:mga08x19_305441_c1
429 nmdc:mga08x19_413_c1
430 nmdc:mga08x19_54322_c1
431 Ga0495601_0198343
432 Ga0495612_0005823
433 Ga0495619_0508167
434 Ga0495619_0519276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

64

240

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.9347 8 209
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.9162 8 215
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.9092 6 211
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.9004 8 209
2i3d-assembly1.cif.gz_A crystal structure of protein of unknown function atu1826, a putative alpha/beta hydrolase from agrobacterium tumefaciens 0.8762 8 215
ID Description Score Start End Superfamily
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9347 8 209 3.40.50.1820
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9092 6 211 3.40.50.1820
3trdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9004 8 209 3.40.50.1820
2i3dA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8992 8 215 3.40.50.1820
af_Q6ZGV2_2_204_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8929 8 193 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A800EVG4-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9781 51 210
AF-A0A7V9GAA5-F1-model_v4 Alpha/beta fold hydrolase 0.978 69 214 GO:0016787
AF-A0A2V8Q4R2-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9748 94 215
AF-A0A0U2P1Q8-F1-model_v4 Alpha/beta hydrolase family 0.9736 75 214 GO:0016787
AF-A0A2V8FT69-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9726 69 211

Map