F329140

General Info

Members Datasets Scaffolds Average Seq Length
217 157 201 137

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0003080|Ga0495632_0003080_3737_4177
Length 146
Sequence MQLHRGRLIDHVHLRTRDLPAMKRFYKAVLEAVGVPIVEDEIPGAGDHFYADELWIDVGEPASHVHLAFQAADEATVQRFHAAALANGGRDNGGPGLRDYHPGYYAAFAYDPDGNNIEAVYHGPAERSAPSVVITWDDGADDGAKD

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
5 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
6 2643221584 Caulobacter sp. Root656 Isolate Unclassified
7 2643221645 Massilia sp. Root351 Isolate Unclassified
8 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
9 2738541300 Massilia sp. GV016 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543030 Massilia sp. GV097 Isolate Unclassified
12 2818991435 Caulobacter henricii 536 Isolate Unclassified
13 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
14 2849560528 Caulobacter zeae 410 Isolate Unclassified
15 2851153111 Caulobacter radicis 736 Isolate Unclassified
16 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
85 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
86 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
87 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
88 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
89 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
138 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
139 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
140 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
141 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
142 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
143 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
144 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
145 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
146 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
147 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
148 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
149 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
150 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
151 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
152 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
153 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
157 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.63
Metatranscriptomes 0
Isolates 7.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.41
Nodule 0
Rhizoplane 3.69
Rhizosphere 52.07
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10044993 3300003203 Unclassified 1524
2 Ga0055537_1001798 3300003773 Bacteria 7803
3 Ga0055524_1009131 3300003775 Bacteria 4058
4 Ga0055528_1030465 3300003790 Bacteria 1429
5 Ga0055531_10002320 3300003794 Bacteria 12846
6 Ga0065165_1001487 3300005262 Bacteria 24902
7 Ga0065165_1030308 3300005262 Bacteria 1722
8 Ga0070658_10378047 3300005327 Bacteria 1215
9 Ga0070676_10918746 3300005328 Bacteria 653
10 Ga0070677_10004643 3300005333 Bacteria 4493
11 Ga0068869_100402471 3300005334 Bacteria 1126
12 Ga0070661_100242007 3300005344 Bacteria 1390
13 Ga0070673_100069744 3300005364 Bacteria 2818
14 Ga0070659_100878392 3300005366 Bacteria 783
15 Ga0070678_100411970 3300005456 Bacteria 1176
16 Ga0070662_100714025 3300005457 Bacteria 849
17 Ga0068867_101820398 3300005459 Bacteria 573
18 Ga0068853_100392954 3300005539 Bacteria 1297
19 Ga0068857_100070148 3300005577 Bacteria 3121
20 Ga0068854_102025974 3300005578 Bacteria 531
21 Ga0068863_100272695 3300005841 Unclassified 1638
22 Ga0081539_10000028 3300005985 Bacteria 328182
23 Ga0075365_10474758 3300006038 Bacteria 884
24 Ga0075365_11020172 3300006038 Bacteria 583
25 Ga0075368_10570169 3300006042 Bacteria 510
26 Ga0075363_100312629 3300006048 Bacteria 913
27 Ga0075363_100438069 3300006048 Bacteria 771
28 Ga0075364_10846052 3300006051 Bacteria 623
29 Ga0075362_10111718 3300006177 Bacteria 1287
30 Ga0075367_10127016 3300006178 Bacteria 1574
31 Ga0075367_10362784 3300006178 Bacteria 915
32 Ga0075369_10000087 3300006186 Bacteria 24719
33 Ga0075369_10615149 3300006186 Bacteria 521
34 Ga0075366_10280358 3300006195 Bacteria 1018
35 Ga0075366_10306569 3300006195 Bacteria 972
36 Ga0075370_10018147 3300006353 Bacteria 3813
37 Ga0111539_10699236 3300009094 Bacteria 1180
38 Ga0105237_10324037 3300009545 Bacteria 1544
39 Ga0163163_10704238 3300014325 Bacteria 1073
40 Ga0157379_10029336 3300014968 Bacteria 4892
41 Ga0157376_10561534 3300014969 Bacteria 1131
42 Ga0209565_1000173 3300025263 Bacteria 83698
43 Ga0209673_1002889 3300025273 Bacteria 10900
44 Ga0209675_1042947 3300025291 Bacteria 976
45 Ga0209564_1002013 3300025295 Bacteria 17733
46 Ga0209564_1015457 3300025295 Bacteria 3101
47 Ga0209758_1002101 3300025297 Bacteria 21151
48 Ga0209758_1003831 3300025297 Bacteria 13209
49 Ga0209256_1000336 3300025299 Bacteria 78476
50 Ga0209256_1005347 3300025299 Bacteria 7440
51 Ga0209257_1000074 3300025304 Bacteria 325641
52 Ga0209257_1000242 3300025304 Bacteria 126891
53 Ga0207680_10645514 3300025903 Bacteria 758
54 Ga0207705_10239283 3300025909 Bacteria 1382
55 Ga0207649_10516630 3300025920 Bacteria 910
56 Ga0207659_10828151 3300025926 Bacteria 795
57 Ga0207690_10657486 3300025932 Bacteria 859
58 Ga0207706_11116660 3300025933 Bacteria 658
59 Ga0207669_10473377 3300025937 Bacteria 997
60 Ga0207691_10041986 3300025940 Bacteria 4219
61 Ga0207679_10105879 3300025945 Bacteria 2209
62 Ga0207651_10113493 3300025960 Bacteria 2039
63 Ga0207640_11043073 3300025981 Bacteria 721
64 Ga0207658_10495414 3300025986 Unclassified 1088
65 Ga0207677_11619062 3300026023 Bacteria 600
66 Ga0207639_10290101 3300026041 Bacteria 1442
67 Ga0207641_10802942 3300026088 Unclassified 931
68 Ga0207674_10409298 3300026116 Bacteria 1311
69 Ga0207683_10287756 3300026121 Bacteria 1502
70 Ga0209813_10260968 3300027866 Bacteria 661
71 Ga0307515_10097864 3300028794 Bacteria 3580
72 Ga0307515_10115682 3300028794 Bacteria 3086
73 Ga0307513_10815692 3300031456 Bacteria 639
74 Ga0307408_100214655 3300031548 Bacteria 1566
75 Ga0307416_100117404 3300032002 Bacteria 2362
76 Ga0373961_0093172 3300035241 Bacteria 965
77 Ga0373931_0331611 3300035691 Bacteria 948
78 Ga0395905_0819156 3300037471 Bacteria 834
79 Ga0395905_1788926 3300037471 Bacteria 520
80 Ga0439465_0135019 3300041413 Bacteria 873
81 Ga0451800_1011174 3300041459 Bacteria 1128
82 Ga0451841_0408930 3300041498 Bacteria 646
83 Ga0439448_0254384 3300042005 Bacteria 620
84 Ga0450890_062489 3300042127 Bacteria 585
85 Ga0439459_0014847 3300042438 Bacteria 1421
86 Ga0439459_0189526 3300042438 Bacteria 556
87 Ga0495627_001222 3300046453 Bacteria 16022
88 Ga0495590_0003921 3300046457 Bacteria 6046
89 Ga0495638_0000147 3300046460 Bacteria 110817
90 Ga0495638_0003553 3300046460 Bacteria 12215
91 Ga0495638_0005229 3300046460 Bacteria 9693
92 Ga0495638_0014348 3300046460 Bacteria 5360
93 Ga0495650_0000045 3300046471 Bacteria 346204
94 Ga0495650_0085074 3300046471 Bacteria 1212
95 Ga0495650_0168022 3300046471 Bacteria 778
96 Ga0495607_0220412 3300046501 Bacteria 928
97 Ga0495607_0239675 3300046501 Bacteria 878
98 Ga0495606_0052902 3300046507 Bacteria 2637
99 Ga0495606_0495852 3300046507 Bacteria 617
100 Ga0495610_0000024 3300046512 Bacteria 304748
101 Ga0495610_0005167 3300046512 Bacteria 9355
102 Ga0495616_0000008 3300046513 Bacteria 226291
103 Ga0495620_0231645 3300046515 Bacteria 706
104 Ga0495631_0312451 3300046518 Bacteria 669
105 Ga0495632_0003080 3300046519 Bacteria 12099
106 Ga0495632_0026076 3300046519 Bacteria 3082
107 Ga0495632_0303700 3300046519 Bacteria 707
108 Ga0495637_0021559 3300046520 Bacteria 2953
109 Ga0495643_0209359 3300046522 Bacteria 931
110 Ga0495648_0045086 3300046524 Bacteria 2746
111 Ga0495642_0051987 3300046528 Bacteria 1687
112 Ga0495654_0000010 3300046530 Bacteria 378481
113 Ga0495609_0047465 3300046538 Bacteria 1921
114 Ga0495609_0135910 3300046538 Bacteria 1051
115 Ga0495597_0050831 3300046542 Bacteria 1828
116 Ga0495633_0307093 3300046558 Bacteria 720
117 Ga0495668_0003402 3300046616 Bacteria 11946
118 Ga0495668_0040537 3300046616 Bacteria 2596
119 Ga0495668_0306512 3300046616 Bacteria 871
120 Ga0495611_0159463 3300046648 Bacteria 1054
121 Ga0495625_0000406 3300046660 Bacteria 65341
122 Ga0495625_0000512 3300046660 Bacteria 57380
123 Ga0495625_0007286 3300046660 Bacteria 9671
124 Ga0495625_0013613 3300046660 Bacteria 6527
125 Ga0495625_0025833 3300046660 Bacteria 4446
126 Ga0495625_0069978 3300046660 Bacteria 2464
127 Ga0495671_0010524 3300046692 Bacteria 5119
128 Ga0495671_0054463 3300046692 Bacteria 1983
129 Ga0495671_0406131 3300046692 Bacteria 652
130 Ga0495589_0039691 3300046794 Bacteria 2352
131 Ga0495660_0000894 3300046810 Bacteria 22038
132 Ga0495660_0024156 3300046810 Bacteria 3463
133 Ga0495660_0091115 3300046810 Bacteria 1584
134 Ga0495660_0100359 3300046810 Bacteria 1491
135 Ga0495672_0002667 3300047320 Bacteria 16093
136 Ga0495679_006376 3300047446 Bacteria 5089
137 Ga0495673_0000264 3300047469 Bacteria 72931
138 Ga0495673_0002738 3300047469 Bacteria 12081
139 Ga0495686_0006093 3300047472 Bacteria 9340
140 Ga0495686_0007088 3300047472 Bacteria 8449
141 Ga0495686_0009980 3300047472 Bacteria 6791
142 Ga0495686_0145658 3300047472 Bacteria 1394
143 Ga0496101_1082686 3300048904 Bacteria 629
144 Ga0496101_1397679 3300048904 Bacteria 546
145 Ga0496106_0098882 3300048909 Bacteria 2261
146 Ga0496107_0003124 3300048910 Bacteria 11016
147 Ga0496113_1107704 3300048916 Bacteria 621
148 Ga0496115_0003445 3300048918 Bacteria 11363
149 Ga0496115_0243273 3300048918 Bacteria 1483
150 Ga0496121_0004039 3300048924 Bacteria 20163
151 Ga0495678_001959 3300049459 Bacteria 14845
152 Ga0501069_0965664 3300049585 Bacteria 520
153 Ga0501238_017415 3300049671 Bacteria 1000
154 nmdc:mga03683_13351_c1 3300050489 Bacteria 3021
155 nmdc:mga03683_198328_c1 3300050489 Bacteria 920
156 nmdc:mga03683_77374_c1 3300050489 Bacteria 1431
157 nmdc:mga03n38_145658_c1 3300050490 Bacteria 1187
158 nmdc:mga03n38_662009_c1 3300050490 Bacteria 599
159 nmdc:mga0yw44_168387_c1 3300050492 Bacteria 1438
160 nmdc:mga0yw44_864424_c1 3300050492 Bacteria 614
161 nmdc:mga0k408_147808_c1 3300050493 Bacteria 1399
162 nmdc:mga0k408_179661_c1 3300050493 Bacteria 1262
163 nmdc:mga0k408_55442_c1 3300050493 Bacteria 2298
164 nmdc:mga06z11_18629_c1 3300050494 Bacteria 3175
165 nmdc:mga06z11_558412_c1 3300050494 Bacteria 695
166 nmdc:mga04h51_522450_c1 3300050495 Bacteria 509
167 nmdc:mga07m45_17298_c1 3300050496 Bacteria 3869
168 nmdc:mga0sz30_114848_c1 3300050516 Bacteria 1181
169 nmdc:mga0sz30_653_c1 3300050516 Bacteria 12844
170 Ga0495619_0801855 3300053085 Unclassified 637
171 Ga0500578_0000070 3300053086 Bacteria 113202
172 Ga0500643_037620 3300053087 Bacteria 1439
173 Ga0500643_079823 3300053087 Bacteria 900
174 Ga0500643_110108 3300053087 Bacteria 744
175 Ga0500644_0000385 3300053088 Bacteria 21466
176 Ga0500646_0152285 3300053090 Bacteria 766
177 Ga0500583_0097781 3300053092 Unclassified 1434
178 Ga0500641_0003821 3300053096 Bacteria 5322
179 Ga0500641_0145977 3300053096 Bacteria 1022
180 Ga0500641_0170695 3300053096 Bacteria 936
181 Ga0500554_000481 3300053102 Bacteria 8315
182 Ga0500555_110054 3300053103 Bacteria 694
183 Ga0500556_0001584 3300053104 Bacteria 9129
184 Ga0500556_0001804 3300053104 Bacteria 7915
185 Ga0500562_000273 3300053108 Bacteria 12817
186 Ga0500562_000877 3300053108 Bacteria 7312
187 Ga0500562_001960 3300053108 Bacteria 5159
188 Ga0500562_062202 3300053108 Bacteria 1003
189 Ga0500593_242846 3300053117 Bacteria 616
190 Ga0500594_0000072 3300053118 Bacteria 31852
191 Ga0500614_100284 3300053123 Bacteria 834
192 Ga0500618_000429 3300053125 Bacteria 27920
193 Ga0500652_337522 3300053131 Bacteria 573
194 Ga0500658_0012592 3300053134 Bacteria 3121
195 Ga0500658_0017332 3300053134 Bacteria 2690
196 Ga0500573_0386095 3300053140 Unclassified 668
197 Ga0500616_0313805 3300053153 Bacteria 647
198 Ga0500622_0000682 3300053156 Bacteria 30044
199 Ga0500645_002114 3300053730 Bacteria 9173
200 Ga0500645_121207 3300053730 Bacteria 730
201 Ga0500609_033607 3300053731 Bacteria 706

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0231645 Ga0495620_0231645_238_585 107
2 3300046518 Ga0495631_0312451 Ga0495631_0312451_275_634 111
3 3300046528 Ga0495642_0051987 Ga0495642_0051987_21_398 121
4 3300046471 Ga0495650_0000045 Ga0495650_0000045_185286_185693 125
5 3300046692 Ga0495671_0054463 Ga0495671_0054463_417_818 125
6 3300048916 Ga0496113_1107704 Ga0496113_1107704_118_501 125
7 3300053103 Ga0500555_110054 Ga0500555_110054_230_637 125
8 3300053153 Ga0500616_0313805 Ga0500616_0313805_135_542 125
9 3300005366 Ga0070659_100878392 Ga0070659_1008783921 126
10 3300005577 Ga0068857_100070148 Ga0068857_1000701483 126
11 iso_pu_bacteria 2582581279 2585146632 127
12 iso_pu_bacteria 2849560528 2849561796 127
13 iso_pu_bacteria 2851153111 2851157817 127
14 iso_pu_bacteria 2897803580 2897807020 127
15 iso_pu_bacteria 2582581280 2585152409 128
16 iso_pu_bacteria 2582581293 2585197631 128
17 iso_pu_bacteria 2643221545 2643746902 128
18 iso_pu_bacteria 2643221552 2643778769 128
19 iso_pu_bacteria 2643221584 2643930607 128
20 iso_pu_bacteria 2643221645 2644249904 128
21 iso_pu_bacteria 2643221691 2644507892 128
22 iso_pu_bacteria 2738541300 2738846077 128
23 iso_pu_bacteria 2738543018 2739275770 128
24 iso_pu_bacteria 2738543030 2739344814 128
25 iso_pu_bacteria 2818991435 2819535600 128
26 iso_pu_bacteria 2818991454 2819644875 128
27 3300053096 Ga0500641_0170695 Ga0500641_0170695_372_764 130
28 3300053108 Ga0500562_000877 Ga0500562_000877_3767_4159 130
29 3300005262 Ga0065165_1030308 Ga0065165_10303082 131
30 3300006038 Ga0075365_10474758 Ga0075365_104747582 131
31 3300006038 Ga0075365_11020172 Ga0075365_110201721 131
32 3300006042 Ga0075368_10570169 Ga0075368_105701691 131
33 3300006048 Ga0075363_100312629 Ga0075363_1003126292 131
34 3300006048 Ga0075363_100438069 Ga0075363_1004380692 131
35 3300006051 Ga0075364_10846052 Ga0075364_108460521 131
36 3300006177 Ga0075362_10111718 Ga0075362_101117182 131
37 3300006178 Ga0075367_10127016 Ga0075367_101270162 131
38 3300006178 Ga0075367_10362784 Ga0075367_103627842 131
39 3300006186 Ga0075369_10000087 Ga0075369_100000874 131
40 3300006186 Ga0075369_10615149 Ga0075369_106151491 131
41 3300006195 Ga0075366_10280358 Ga0075366_102803582 131
42 3300006353 Ga0075370_10018147 Ga0075370_100181472 131
43 3300027866 Ga0209813_10260968 Ga0209813_102609682 131
44 3300028794 Ga0307515_10115682 Ga0307515_101156823 131
45 3300031456 Ga0307513_10815692 Ga0307513_108156922 131
46 3300031548 Ga0307408_100214655 Ga0307408_1002146551 131
47 3300032002 Ga0307416_100117404 Ga0307416_1001174042 131
48 3300035241 Ga0373961_0093172 Ga0373961_0093172_408_806 131
49 3300035691 Ga0373931_0331611 Ga0373931_0331611_375_773 131
50 3300037471 Ga0395905_1788926 Ga0395905_1788926_70_468 131
51 3300041413 Ga0439465_0135019 Ga0439465_0135019_83_481 131
52 3300042438 Ga0439459_0014847 Ga0439459_0014847_356_751 131
53 3300046453 Ga0495627_001222 Ga0495627_001222_6971_7381 131
54 3300046457 Ga0495590_0003921 Ga0495590_0003921_5295_5708 131
55 3300046460 Ga0495638_0005229 Ga0495638_0005229_9200_9613 131
56 3300046512 Ga0495610_0005167 Ga0495610_0005167_1249_1662 131
57 3300046616 Ga0495668_0003402 Ga0495668_0003402_2373_2786 131
58 3300046692 Ga0495671_0406131 Ga0495671_0406131_59_466 131
59 3300046794 Ga0495589_0039691 Ga0495589_0039691_780_1193 131
60 3300047469 Ga0495673_0000264 Ga0495673_0000264_1133_1540 131
61 3300047472 Ga0495686_0009980 Ga0495686_0009980_5882_6295 131
62 3300049459 Ga0495678_001959 Ga0495678_001959_14071_14484 131
63 3300050489 nmdc:mga03683_13351_c1 nmdc:mga03683_13351_c1_1644_2039 131
64 3300050489 nmdc:mga03683_198328_c1 nmdc:mga03683_198328_c1_226_621 131
65 3300050490 nmdc:mga03n38_145658_c1 nmdc:mga03n38_145658_c1_586_981 131
66 3300050492 nmdc:mga0yw44_168387_c1 nmdc:mga0yw44_168387_c1_684_1079 131
67 3300050492 nmdc:mga0yw44_864424_c1 nmdc:mga0yw44_864424_c1_167_562 131
68 3300050493 nmdc:mga0k408_147808_c1 nmdc:mga0k408_147808_c1_529_924 131
69 3300050493 nmdc:mga0k408_55442_c1 nmdc:mga0k408_55442_c1_624_1019 131
70 3300050494 nmdc:mga06z11_18629_c1 nmdc:mga06z11_18629_c1_2031_2426 131
71 3300050494 nmdc:mga06z11_558412_c1 nmdc:mga06z11_558412_c1_210_605 131
72 3300050495 nmdc:mga04h51_522450_c1 nmdc:mga04h51_522450_c1_92_487 131
73 3300050496 nmdc:mga07m45_17298_c1 nmdc:mga07m45_17298_c1_2422_2817 131
74 3300050516 nmdc:mga0sz30_114848_c1 nmdc:mga0sz30_114848_c1_326_721 131
75 3300050516 nmdc:mga0sz30_653_c1 nmdc:mga0sz30_653_c1_5396_5791 131
76 3300053086 Ga0500578_0000070 Ga0500578_0000070_88947_89360 131
77 3300053087 Ga0500643_037620 Ga0500643_037620_33_446 131
78 3300053087 Ga0500643_079823 Ga0500643_079823_154_561 131
79 3300053088 Ga0500644_0000385 Ga0500644_0000385_2149_2556 131
80 3300053096 Ga0500641_0003821 Ga0500641_0003821_2835_3230 131
81 3300053104 Ga0500556_0001804 Ga0500556_0001804_2203_2616 131
82 3300053108 Ga0500562_001960 Ga0500562_001960_3408_3821 131
83 3300053108 Ga0500562_062202 Ga0500562_062202_569_982 131
84 3300053118 Ga0500594_0000072 Ga0500594_0000072_7515_7928 131
85 3300053156 Ga0500622_0000682 Ga0500622_0000682_28656_29069 131
86 3300053730 Ga0500645_121207 Ga0500645_121207_196_591 131
87 3300003773 Ga0055537_1001798 Ga0055537_10017988 132
88 3300003775 Ga0055524_1009131 Ga0055524_10091312 132
89 3300003790 Ga0055528_1030465 Ga0055528_10304651 132
90 3300003794 Ga0055531_10002320 Ga0055531_100023205 132
91 3300005262 Ga0065165_1001487 Ga0065165_100148720 132
92 3300005334 Ga0068869_100402471 Ga0068869_1004024712 132
93 3300005841 Ga0068863_100272695 Ga0068863_1002726953 132
94 3300006195 Ga0075366_10306569 Ga0075366_103065693 132
95 3300009545 Ga0105237_10324037 Ga0105237_103240371 132
96 3300014968 Ga0157379_10029336 Ga0157379_100293368 132
97 3300014969 Ga0157376_10561534 Ga0157376_105615341 132
98 3300025263 Ga0209565_1000173 Ga0209565_10001731 132
99 3300025273 Ga0209673_1002889 Ga0209673_10028891 132
100 3300025291 Ga0209675_1042947 Ga0209675_10429471 132
101 3300025295 Ga0209564_1002013 Ga0209564_100201310 132
102 3300025295 Ga0209564_1015457 Ga0209564_10154572 132
103 3300025297 Ga0209758_1002101 Ga0209758_100210110 132
104 3300025297 Ga0209758_1003831 Ga0209758_10038318 132
105 3300025299 Ga0209256_1000336 Ga0209256_100033649 132
106 3300025299 Ga0209256_1005347 Ga0209256_10053477 132
107 3300025304 Ga0209257_1000074 Ga0209257_100007481 132
108 3300025304 Ga0209257_1000242 Ga0209257_100024282 132
109 3300025986 Ga0207658_10495414 Ga0207658_104954141 132
110 3300026023 Ga0207677_11619062 Ga0207677_116190621 132
111 3300026088 Ga0207641_10802942 Ga0207641_108029422 132
112 3300028794 Ga0307515_10097864 Ga0307515_100978643 132
113 3300037471 Ga0395905_0819156 Ga0395905_0819156_66_470 132
114 3300042005 Ga0439448_0254384 Ga0439448_0254384_151_579 132
115 3300042127 Ga0450890_062489 Ga0450890_062489_100_531 132
116 3300042438 Ga0439459_0189526 Ga0439459_0189526_11_439 132
117 3300046460 Ga0495638_0000147 Ga0495638_0000147_107106_107531 132
118 3300046460 Ga0495638_0003553 Ga0495638_0003553_3332_3754 132
119 3300046460 Ga0495638_0014348 Ga0495638_0014348_885_1316 132
120 3300046471 Ga0495650_0085074 Ga0495650_0085074_83_508 132
121 3300046471 Ga0495650_0168022 Ga0495650_0168022_302_718 132
122 3300046501 Ga0495607_0220412 Ga0495607_0220412_438_869 132
123 3300046501 Ga0495607_0239675 Ga0495607_0239675_213_623 132
124 3300046507 Ga0495606_0052902 Ga0495606_0052902_605_1012 132
125 3300046507 Ga0495606_0495852 Ga0495606_0495852_124_534 132
126 3300046512 Ga0495610_0000024 Ga0495610_0000024_36689_37111 132
127 3300046513 Ga0495616_0000008 Ga0495616_0000008_2052_2480 132
128 3300046519 Ga0495632_0003080 Ga0495632_0003080_3737_4177 132
129 3300046519 Ga0495632_0303700 Ga0495632_0303700_180_608 132
130 3300046520 Ga0495637_0021559 Ga0495637_0021559_134_562 132
131 3300046522 Ga0495643_0209359 Ga0495643_0209359_277_705 132
132 3300046524 Ga0495648_0045086 Ga0495648_0045086_2270_2698 132
133 3300046530 Ga0495654_0000010 Ga0495654_0000010_209771_210199 132
134 3300046538 Ga0495609_0047465 Ga0495609_0047465_1001_1411 132
135 3300046538 Ga0495609_0135910 Ga0495609_0135910_581_1009 132
136 3300046542 Ga0495597_0050831 Ga0495597_0050831_1219_1626 132
137 3300046558 Ga0495633_0307093 Ga0495633_0307093_53_481 132
138 3300046616 Ga0495668_0040537 Ga0495668_0040537_156_587 132
139 3300046616 Ga0495668_0306512 Ga0495668_0306512_158_568 132
140 3300046648 Ga0495611_0159463 Ga0495611_0159463_497_913 132
141 3300046660 Ga0495625_0000406 Ga0495625_0000406_4369_4794 132
142 3300046660 Ga0495625_0000512 Ga0495625_0000512_54138_54566 132
143 3300046660 Ga0495625_0007286 Ga0495625_0007286_2666_3088 132
144 3300046660 Ga0495625_0013613 Ga0495625_0013613_3748_4176 132
145 3300046660 Ga0495625_0025833 Ga0495625_0025833_778_1185 132
146 3300046660 Ga0495625_0069978 Ga0495625_0069978_1865_2293 132
147 3300046810 Ga0495660_0000894 Ga0495660_0000894_17503_17913 132
148 3300046810 Ga0495660_0024156 Ga0495660_0024156_2708_3136 132
149 3300046810 Ga0495660_0091115 Ga0495660_0091115_71_499 132
150 3300046810 Ga0495660_0100359 Ga0495660_0100359_646_1053 132
151 3300047320 Ga0495672_0002667 Ga0495672_0002667_12389_12811 132
152 3300047446 Ga0495679_006376 Ga0495679_006376_3878_4306 132
153 3300047469 Ga0495673_0002738 Ga0495673_0002738_5648_6079 132
154 3300047472 Ga0495686_0006093 Ga0495686_0006093_4999_5409 132
155 3300047472 Ga0495686_0007088 Ga0495686_0007088_1933_2352 132
156 3300047472 Ga0495686_0145658 Ga0495686_0145658_63_482 132
157 3300048904 Ga0496101_1082686 Ga0496101_1082686_164_571 132
158 3300048904 Ga0496101_1397679 Ga0496101_1397679_71_499 132
159 3300048909 Ga0496106_0098882 Ga0496106_0098882_213_629 132
160 3300048910 Ga0496107_0003124 Ga0496107_0003124_4213_4641 132
161 3300048918 Ga0496115_0003445 Ga0496115_0003445_5582_6010 132
162 3300048918 Ga0496115_0243273 Ga0496115_0243273_922_1347 132
163 3300048924 Ga0496121_0004039 Ga0496121_0004039_5528_5956 132
164 3300049671 Ga0501238_017415 Ga0501238_017415_40_465 132
165 3300050489 nmdc:mga03683_77374_c1 nmdc:mga03683_77374_c1_827_1243 132
166 3300050490 nmdc:mga03n38_662009_c1 nmdc:mga03n38_662009_c1_159_575 132
167 3300050493 nmdc:mga0k408_179661_c1 nmdc:mga0k408_179661_c1_177_605 132
168 3300053085 Ga0495619_0801855 Ga0495619_0801855_51_467 132
169 3300053087 Ga0500643_110108 Ga0500643_110108_223_639 132
170 3300053102 Ga0500554_000481 Ga0500554_000481_7722_8153 132
171 3300053104 Ga0500556_0001584 Ga0500556_0001584_5380_5808 132
172 3300053108 Ga0500562_000273 Ga0500562_000273_7211_7615 132
173 3300053117 Ga0500593_242846 Ga0500593_242846_178_579 132
174 3300053123 Ga0500614_100284 Ga0500614_100284_173_604 132
175 3300053125 Ga0500618_000429 Ga0500618_000429_13724_14152 132
176 3300053134 Ga0500658_0012592 Ga0500658_0012592_42_464 132
177 3300053140 Ga0500573_0386095 Ga0500573_0386095_177_593 132
178 3300053730 Ga0500645_002114 Ga0500645_002114_3195_3623 132
179 3300053731 Ga0500609_033607 Ga0500609_033607_103_534 132
180 3300049585 Ga0501069_0965664 Ga0501069_0965664_13_438 134
181 3300053090 Ga0500646_0152285 Ga0500646_0152285_60_464 134
182 3300046692 Ga0495671_0010524 Ga0495671_0010524_2604_3017 135
183 3300041498 Ga0451841_0408930 Ga0451841_0408930_41_451 136
184 3300046519 Ga0495632_0026076 Ga0495632_0026076_1619_2029 136
185 3300053092 Ga0500583_0097781 Ga0500583_0097781_377_790 136
186 3300053096 Ga0500641_0145977 Ga0500641_0145977_191_604 136
187 3300053134 Ga0500658_0017332 Ga0500658_0017332_1219_1629 136
188 3300003203 JGI25406J46586_10044993 JGI25406J46586_100449933 137
189 3300005327 Ga0070658_10378047 Ga0070658_103780471 137
190 3300005328 Ga0070676_10918746 Ga0070676_109187461 137
191 3300005333 Ga0070677_10004643 Ga0070677_100046433 137
192 3300005344 Ga0070661_100242007 Ga0070661_1002420073 137
193 3300005364 Ga0070673_100069744 Ga0070673_1000697443 137
194 3300005456 Ga0070678_100411970 Ga0070678_1004119702 137
195 3300005457 Ga0070662_100714025 Ga0070662_1007140252 137
196 3300005459 Ga0068867_101820398 Ga0068867_1018203981 137
197 3300005539 Ga0068853_100392954 Ga0068853_1003929542 137
198 3300005578 Ga0068854_102025974 Ga0068854_1020259741 137
199 3300005985 Ga0081539_10000028 Ga0081539_1000002813 137
200 3300009094 Ga0111539_10699236 Ga0111539_106992363 137
201 3300014325 Ga0163163_10704238 Ga0163163_107042382 137
202 3300025903 Ga0207680_10645514 Ga0207680_106455142 137
203 3300025909 Ga0207705_10239283 Ga0207705_102392833 137
204 3300025920 Ga0207649_10516630 Ga0207649_105166302 137
205 3300025926 Ga0207659_10828151 Ga0207659_108281512 137
206 3300025932 Ga0207690_10657486 Ga0207690_106574862 137
207 3300025933 Ga0207706_11116660 Ga0207706_111166602 137
208 3300025937 Ga0207669_10473377 Ga0207669_104733771 137
209 3300025940 Ga0207691_10041986 Ga0207691_100419863 137
210 3300025945 Ga0207679_10105879 Ga0207679_101058792 137
211 3300025960 Ga0207651_10113493 Ga0207651_101134932 137
212 3300025981 Ga0207640_11043073 Ga0207640_110430732 137
213 3300026041 Ga0207639_10290101 Ga0207639_102901012 137
214 3300026116 Ga0207674_10409298 Ga0207674_104092982 137
215 3300026121 Ga0207683_10287756 Ga0207683_102877562 137
216 3300041459 Ga0451800_1011174 Ga0451800_1011174_393_806 137
217 3300053131 Ga0500652_337522 Ga0500652_337522_11_430 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

8

119

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8624 9 126
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.831 9 122
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8204 9 122
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8182 9 122
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8175 9 126
ID Description Score Start End Superfamily
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8756 67 122 3.30.720.110
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8624 9 126 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8175 9 126 3.10.180.10
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8093 14 122 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8075 67 122 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A3A6RYZ4-F1-model_v4 VOC family protein 0.9925 67 122
AF-A0A7X2XSM6-F1-model_v4 deleted 0.9655 62 125
AF-A0A2R5EWJ1-F1-model_v4 Putative glyoxalase 0.9498 68 122
AF-A0A7W6HKI9-F1-model_v4 Putative lactoylglutathione lyase 0.944 69 126 GO:0016829
AF-A0A2W5Z7K5-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.937 9 122 GO:0051213

Feature Viewer

pLDDT pTM Quality
88.63 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map