F329117

General Info

Members Datasets Scaffolds Average Seq Length
217 173 434 218

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0327893|Ga0495651_0327893_288_1007
Length 239
Sequence MSEFTVYSVPGSPFGRAALATLEEKGAAYRFSSVIPGTMRAPEHLSRHPFGRVPVLQHDGFSLYEGQAILRYLDRVLPNPALTPGDCKSAARMDQVMNVNDWYLFQGVGNVIGFQRVVKPRLMGLAPDEAAIEAAMPQAHAVFNELARLLGDQPYFAGDAVSLADLLVAPQLTFFAQTPEWSVLGAPQANLVSWLARMEARPSRPPPGSACLKIQSGLIRPLAGLKIGHWNGTIHRLPD

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
44 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
154 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
155 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
156 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
157 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
160 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
161 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
162 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
163 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
164 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
165 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
171 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
172 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
173 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 0
Isolates 1.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.98
Nodule 1.38
Rhizoplane 6.91
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0327893 3300046462 Archaea 1018
2 rootL2_10041149 3300003322 Bacteria 1880
3 rootH1_10204794 3300003323 Bacteria 1935
4 rootH1_10340217 3300003323 Bacteria 1320
5 Ga0070703_10073494 3300005406 Bacteria 1147
6 Ga0070709_10077519 3300005434 Bacteria 2160
7 Ga0070714_100022515 3300005435 Bacteria 5167
8 Ga0070713_100005054 3300005436 Bacteria 8970
9 Ga0070713_100031799 3300005436 Bacteria 4207
10 Ga0070713_100042522 3300005436 Bacteria 3709
11 Ga0070710_10003703 3300005437 Bacteria 7229
12 Ga0070710_10067392 3300005437 Bacteria 2054
13 Ga0070711_100012211 3300005439 Bacteria 5362
14 Ga0070685_10183369 3300005466 Bacteria 1349
15 Ga0070706_100209348 3300005467 Bacteria 1821
16 Ga0070706_100336757 3300005467 Bacteria 1407
17 Ga0070698_100749475 3300005471 Bacteria 920
18 Ga0070697_100431768 3300005536 Bacteria 1146
19 Ga0070665_100053083 3300005548 Bacteria 4065
20 Ga0070665_100123650 3300005548 Bacteria 2589
21 Ga0070665_100297414 3300005548 Bacteria 1617
22 Ga0068855_101125195 3300005563 Bacteria 820
23 Ga0068856_100085675 3300005614 Bacteria 3130
24 Ga0068859_100231083 3300005617 Bacteria 1938
25 Ga0068861_100165496 3300005719 Bacteria 1828
26 Ga0068863_100418925 3300005841 Bacteria 1312
27 Ga0068858_100137346 3300005842 Bacteria 2295
28 Ga0068860_100005261 3300005843 Bacteria 13134
29 Ga0081540_1000717 3300005983 Bacteria 30745
30 Ga0081540_1057476 3300005983 Bacteria 1881
31 Ga0070717_10001690 3300006028 Bacteria 15361
32 Ga0070717_10007043 3300006028 Bacteria 8326
33 Ga0070717_10411626 3300006028 Bacteria 1215
34 Ga0070715_10000972 3300006163 Bacteria 8002
35 Ga0070716_100065414 3300006173 Bacteria 2117
36 Ga0070716_100077412 3300006173 Bacteria 1974
37 Ga0070716_100248655 3300006173 Bacteria 1210
38 Ga0070712_100025754 3300006175 Bacteria 3913
39 Ga0070712_100032486 3300006175 Bacteria 3526
40 Ga0070712_100158661 3300006175 Bacteria 1745
41 Ga0075369_10283964 3300006186 Bacteria 771
42 Ga0075428_100032464 3300006844 Bacteria 5767
43 Ga0097620_100231077 3300006931 Bacteria 1938
44 Ga0099794_10001629 3300007265 Bacteria 7917
45 Ga0105240_10145747 3300009093 Bacteria 2825
46 Ga0111539_10428282 3300009094 Bacteria 1541
47 Ga0111539_10964828 3300009094 Unclassified 991
48 Ga0114129_10072050 3300009147 Bacteria 4817
49 Ga0105238_10066805 3300009551 Bacteria 3597
50 Ga0157374_10088467 3300013296 Bacteria 2950
51 Ga0157378_11085063 3300013297 Bacteria 837
52 Ga0157372_10543942 3300013307 Bacteria 1354
53 Ga0163163_10043634 3300014325 Bacteria 4397
54 Ga0213873_10002479 3300021358 Bacteria 3196
55 Ga0213874_10009527 3300021377 Unclassified 2404
56 Ga0213876_10002415 3300021384 Bacteria 10979
57 Ga0213876_10002421 3300021384 Bacteria 10972
58 Ga0213876_10162825 3300021384 Bacteria 1187
59 Ga0213875_10007887 3300021388 Bacteria 5473
60 Ga0213871_10027488 3300021441 Bacteria 1461
61 Ga0209677_100354 3300025253 Bacteria 28586
62 Ga0209148_1000447 3300025254 Bacteria 45273
63 Ga0209233_1025871 3300025261 Bacteria 1445
64 Ga0209455_1008135 3300025272 Bacteria 2882
65 Ga0209455_1008855 3300025272 Bacteria 2693
66 Ga0209455_1028380 3300025272 Bacteria 979
67 Ga0207692_10001610 3300025898 Bacteria 8506
68 Ga0207685_10012061 3300025905 Bacteria 2625
69 Ga0207699_10227939 3300025906 Bacteria 1275
70 Ga0207684_10180164 3300025910 Bacteria 1822
71 Ga0207695_10680797 3300025913 Bacteria 909
72 Ga0207695_10897063 3300025913 Bacteria 766
73 Ga0207693_10050892 3300025915 Bacteria 3252
74 Ga0207663_10002302 3300025916 Bacteria 9151
75 Ga0207700_10007192 3300025928 Bacteria 6788
76 Ga0207700_10023271 3300025928 Bacteria 4268
77 Ga0207700_10062187 3300025928 Bacteria 2835
78 Ga0207664_10005855 3300025929 Bacteria 8408
79 Ga0207665_10000992 3300025939 Bacteria 19173
80 Ga0207665_10319106 3300025939 Bacteria 1165
81 Ga0207667_10410072 3300025949 Bacteria 1379
82 Ga0207641_10766548 3300026088 Bacteria 953
83 Ga0207675_100124199 3300026118 Bacteria 2444
84 Ga0209588_1087786 3300027671 Bacteria 1003
85 Ga0268266_10000823 3300028379 Bacteria 40627
86 Ga0268266_10252309 3300028379 Bacteria 1632
87 Ga0268264_10000035 3300028381 Bacteria 398196
88 Ga0265334_10067098 3300028573 Bacteria 1341
89 Ga0265338_10083614 3300028800 Bacteria 2669
90 Ga0265324_10031569 3300029957 Bacteria 1855
91 Ga0265328_10040687 3300031239 Bacteria 1712
92 Ga0265328_10186705 3300031239 Bacteria 785
93 Ga0265327_10003251 3300031251 Bacteria 15760
94 Ga0265316_10133006 3300031344 Bacteria 1872
95 Ga0307509_10228496 3300031507 Bacteria 1666
96 Ga0307509_10238076 3300031507 Bacteria 1616
97 Ga0307508_10034106 3300031616 Bacteria 4590
98 Ga0307508_10304814 3300031616 Bacteria 1185
99 Ga0265314_10024937 3300031711 Bacteria 4521
100 Ga0307516_10000729 3300031730 Bacteria 44867
101 Ga0307406_10082789 3300031901 Bacteria 2138
102 Ga0307409_100636133 3300031995 Bacteria 1059
103 Ga0307510_10006633 3300033180 Bacteria 13810
104 Ga0373934_0051665 3300035086 Bacteria 1629
105 Ga0373923_0088047 3300035111 Bacteria 1355
106 Ga0373936_0029380 3300035113 Bacteria 2164
107 Ga0373953_0007363 3300035117 Bacteria 3683
108 Ga0373954_0006887 3300035118 Bacteria 4961
109 Ga0373956_0008411 3300035119 Bacteria 4177
110 Ga0373957_0040418 3300035120 Bacteria 1753
111 Ga0373927_0159761 3300035695 Bacteria 1476
112 Ga0373933_0004866 3300035724 Bacteria 7328
113 Ga0373947_0487266 3300035725 Bacteria 837
114 Ga0373937_0133874 3300036401 Bacteria 2316
115 Ga0373925_0362489 3300037068 Bacteria 1178
116 Ga0395899_0176454 3300037312 Bacteria 1502
117 Ga0395898_0025224 3300037466 Bacteria 5993
118 Ga0395898_0184327 3300037466 Bacteria 1995
119 Ga0395898_0483514 3300037466 Bacteria 1178
120 Ga0436364_1155091 3300037853 Bacteria 4953
121 Ga0436365_0118086 3300039437 Bacteria 30402
122 Ga0436365_1622498 3300039437 Bacteria 69059
123 Ga0436365_1717644 3300039437 Bacteria 2907
124 Ga0436361_0257023 3300039447 Bacteria 3032
125 Ga0436361_0288205 3300039447 Bacteria 2645
126 Ga0436361_1043816 3300039447 Bacteria 2770
127 Ga0436363_0614181 3300039450 Bacteria 1383
128 Ga0436363_1225739 3300039450 Bacteria 660
129 Ga0436363_1278623 3300039450 Bacteria 43595
130 Ga0436362_0176561 3300039453 Bacteria 1198
131 Ga0436362_0956620 3300039453 Bacteria 1930
132 Ga0466972_0338246 3300044658 Bacteria 704
133 Ga0466966_0143654 3300044684 Bacteria 1457
134 Ga0466966_0514425 3300044684 Bacteria 720
135 Ga0466968_0341944 3300044735 Bacteria 726
136 Ga0466959_0011519 3300045049 Bacteria 6358
137 Ga0495592_0001539 3300046454 Bacteria 16097
138 Ga0495603_0001784 3300046455 Bacteria 12697
139 Ga0495603_0046765 3300046455 Bacteria 2578
140 Ga0495629_0001699 3300046459 Bacteria 17299
141 Ga0495651_0076027 3300046462 Bacteria 2544
142 Ga0495653_0057312 3300046463 Bacteria 2965
143 Ga0495584_0132642 3300046491 Bacteria 1264
144 Ga0495608_0096737 3300046511 Bacteria 1906
145 Ga0495618_0154895 3300046514 Bacteria 1463
146 Ga0495628_0026035 3300046516 Bacteria 4775
147 Ga0495630_0166605 3300046517 Bacteria 1678
148 Ga0495652_0121995 3300046529 Bacteria 2076
149 Ga0495640_0032618 3300046533 Bacteria 3709
150 Ga0495587_0032679 3300046536 Bacteria 3144
151 Ga0495645_0046691 3300046543 Bacteria 3156
152 Ga0495667_0001807 3300046559 Bacteria 14207
153 Ga0495656_0268799 3300046615 Bacteria 866
154 Ga0495635_0000989 3300046663 Bacteria 18730
155 Ga0495657_0098247 3300046675 Bacteria 1868
156 Ga0495599_0025091 3300046678 Bacteria 3730
157 Ga0495623_0022358 3300046679 Bacteria 4085
158 Ga0495646_0087850 3300046680 Bacteria 1801
159 Ga0495624_0060127 3300046690 Bacteria 2383
160 Ga0495600_0023574 3300046809 Bacteria 3959
161 Ga0495604_0034342 3300047317 Bacteria 4012
162 Ga0495680_0010867 3300047322 Bacteria 8095
163 Ga0495675_0004052 3300047444 Bacteria 8879
164 Ga0495684_0001724 3300047471 Bacteria 17597
165 Ga0495593_0007534 3300047673 Bacteria 6364
166 Ga0496100_0052901 3300048903 Bacteria 2642
167 Ga0496101_0107639 3300048904 Bacteria 2095
168 Ga0496102_0016216 3300048905 Bacteria 6511
169 Ga0496104_0004974 3300048907 Bacteria 11607
170 Ga0496105_0007306 3300048908 Bacteria 8532
171 Ga0496107_0210647 3300048910 Bacteria 1445
172 Ga0496108_0003116 3300048911 Bacteria 13333
173 Ga0496109_0001443 3300048912 Bacteria 19754
174 Ga0496110_0018548 3300048913 Bacteria 5834
175 Ga0496111_0018919 3300048914 Bacteria 4775
176 Ga0496112_0001558 3300048915 Bacteria 17713
177 Ga0496113_0004634 3300048916 Bacteria 8477
178 Ga0496114_0283732 3300048917 Bacteria 1460
179 Ga0496115_0082761 3300048918 Bacteria 2615
180 Ga0496115_0605608 3300048918 Bacteria 871
181 Ga0496118_0027280 3300048921 Bacteria 4838
182 Ga0496118_0060260 3300048921 Bacteria 2819
183 Ga0496121_0171035 3300048924 Bacteria 1578
184 Ga0496126_0039557 3300048929 Bacteria 4375
185 Ga0501070_0391849 3300049586 Bacteria 1124
186 Ga0501080_0117496 3300049742 Bacteria 2465
187 Ga0501083_0009943 3300049744 Bacteria 6715
188 Ga0501044_0450843 3300049823 Bacteria 1193
189 nmdc:mga0sz30_103735_c1 3300050516 Bacteria 1243
190 Ga0495601_0028179 3300053077 Bacteria 3477
191 Ga0495612_0083584 3300053078 Bacteria 1344
192 Ga0500635_0002981 3300053080 Bacteria 4215
193 Ga0500635_0005186 3300053080 Bacteria 3399
194 Ga0495619_0019215 3300053085 Bacteria 4342
195 Ga0495619_0164589 3300053085 Bacteria 1532
196 Ga0500647_0201778 3300053091 Bacteria 901
197 Ga0500566_0000020 3300053094 Bacteria 83462
198 Ga0500640_000459 3300053095 Bacteria 9997
199 Ga0500572_000988 3300053111 Bacteria 8603
200 Ga0500591_017210 3300053115 Bacteria 3492
201 Ga0500595_001701 3300053119 Bacteria 11532
202 Ga0500608_091474 3300053122 Bacteria 1421
203 Ga0500614_000383 3300053123 Bacteria 11532
204 Ga0500559_0039157 3300053136 Bacteria 2061
205 Ga0500603_000219 3300053150 Bacteria 15061
206 Ga0500603_000793 3300053150 Bacteria 7570
207 Ga0500630_000308 3300053159 Bacteria 20300
208 Ga0500639_000066 3300053163 Bacteria 47938
209 Ga0500637_0014228 3300053178 Bacteria 4191
210 Ga0500645_011279 3300053730 Bacteria 2923
211 Ga0500596_000033 3300053735 Bacteria 18734
212 Ga0501084_0310739 3300054114 Bacteria 1331
213 Ga0501082_0338626 3300060353 Bacteria 1311
214 2509147628 2508501128 Bacteria 8613869
215 2513641224 2513237094 Bacteria 8789602
216 2513893377 2513237141 Bacteria 8496279
217 2885411779 2885409591 Bacteria 9235467
218 Ga0495651_0327893
219 rootL2_10041149
220 rootH1_10204794
221 rootH1_10340217
222 Ga0070703_10073494
223 Ga0070709_10077519
224 Ga0070714_100022515
225 Ga0070713_100005054
226 Ga0070713_100031799
227 Ga0070713_100042522
228 Ga0070710_10003703
229 Ga0070710_10067392
230 Ga0070711_100012211
231 Ga0070685_10183369
232 Ga0070706_100209348
233 Ga0070706_100336757
234 Ga0070698_100749475
235 Ga0070697_100431768
236 Ga0070665_100053083
237 Ga0070665_100123650
238 Ga0070665_100297414
239 Ga0068855_101125195
240 Ga0068856_100085675
241 Ga0068859_100231083
242 Ga0068861_100165496
243 Ga0068863_100418925
244 Ga0068858_100137346
245 Ga0068860_100005261
246 Ga0081540_1000717
247 Ga0081540_1057476
248 Ga0070717_10001690
249 Ga0070717_10007043
250 Ga0070717_10411626
251 Ga0070715_10000972
252 Ga0070716_100065414
253 Ga0070716_100077412
254 Ga0070716_100248655
255 Ga0070712_100025754
256 Ga0070712_100032486
257 Ga0070712_100158661
258 Ga0075369_10283964
259 Ga0075428_100032464
260 Ga0097620_100231077
261 Ga0099794_10001629
262 Ga0105240_10145747
263 Ga0111539_10428282
264 Ga0111539_10964828
265 Ga0114129_10072050
266 Ga0105238_10066805
267 Ga0157374_10088467
268 Ga0157378_11085063
269 Ga0157372_10543942
270 Ga0163163_10043634
271 Ga0213873_10002479
272 Ga0213874_10009527
273 Ga0213876_10002415
274 Ga0213876_10002421
275 Ga0213876_10162825
276 Ga0213875_10007887
277 Ga0213871_10027488
278 Ga0209677_100354
279 Ga0209148_1000447
280 Ga0209233_1025871
281 Ga0209455_1008135
282 Ga0209455_1008855
283 Ga0209455_1028380
284 Ga0207692_10001610
285 Ga0207685_10012061
286 Ga0207699_10227939
287 Ga0207684_10180164
288 Ga0207695_10680797
289 Ga0207695_10897063
290 Ga0207693_10050892
291 Ga0207663_10002302
292 Ga0207700_10007192
293 Ga0207700_10023271
294 Ga0207700_10062187
295 Ga0207664_10005855
296 Ga0207665_10000992
297 Ga0207665_10319106
298 Ga0207667_10410072
299 Ga0207641_10766548
300 Ga0207675_100124199
301 Ga0209588_1087786
302 Ga0268266_10000823
303 Ga0268266_10252309
304 Ga0268264_10000035
305 Ga0265334_10067098
306 Ga0265338_10083614
307 Ga0265324_10031569
308 Ga0265328_10040687
309 Ga0265328_10186705
310 Ga0265327_10003251
311 Ga0265316_10133006
312 Ga0307509_10228496
313 Ga0307509_10238076
314 Ga0307508_10034106
315 Ga0307508_10304814
316 Ga0265314_10024937
317 Ga0307516_10000729
318 Ga0307406_10082789
319 Ga0307409_100636133
320 Ga0307510_10006633
321 Ga0373934_0051665
322 Ga0373923_0088047
323 Ga0373936_0029380
324 Ga0373953_0007363
325 Ga0373954_0006887
326 Ga0373956_0008411
327 Ga0373957_0040418
328 Ga0373927_0159761
329 Ga0373933_0004866
330 Ga0373947_0487266
331 Ga0373937_0133874
332 Ga0373925_0362489
333 Ga0395899_0176454
334 Ga0395898_0025224
335 Ga0395898_0184327
336 Ga0395898_0483514
337 Ga0436364_1155091
338 Ga0436365_0118086
339 Ga0436365_1622498
340 Ga0436365_1717644
341 Ga0436361_0257023
342 Ga0436361_0288205
343 Ga0436361_1043816
344 Ga0436363_0614181
345 Ga0436363_1225739
346 Ga0436363_1278623
347 Ga0436362_0176561
348 Ga0436362_0956620
349 Ga0466972_0338246
350 Ga0466966_0143654
351 Ga0466966_0514425
352 Ga0466968_0341944
353 Ga0466959_0011519
354 Ga0495592_0001539
355 Ga0495603_0001784
356 Ga0495603_0046765
357 Ga0495629_0001699
358 Ga0495651_0076027
359 Ga0495653_0057312
360 Ga0495584_0132642
361 Ga0495608_0096737
362 Ga0495618_0154895
363 Ga0495628_0026035
364 Ga0495630_0166605
365 Ga0495652_0121995
366 Ga0495640_0032618
367 Ga0495587_0032679
368 Ga0495645_0046691
369 Ga0495667_0001807
370 Ga0495656_0268799
371 Ga0495635_0000989
372 Ga0495657_0098247
373 Ga0495599_0025091
374 Ga0495623_0022358
375 Ga0495646_0087850
376 Ga0495624_0060127
377 Ga0495600_0023574
378 Ga0495604_0034342
379 Ga0495680_0010867
380 Ga0495675_0004052
381 Ga0495684_0001724
382 Ga0495593_0007534
383 Ga0496100_0052901
384 Ga0496101_0107639
385 Ga0496102_0016216
386 Ga0496104_0004974
387 Ga0496105_0007306
388 Ga0496107_0210647
389 Ga0496108_0003116
390 Ga0496109_0001443
391 Ga0496110_0018548
392 Ga0496111_0018919
393 Ga0496112_0001558
394 Ga0496113_0004634
395 Ga0496114_0283732
396 Ga0496115_0082761
397 Ga0496115_0605608
398 Ga0496118_0027280
399 Ga0496118_0060260
400 Ga0496121_0171035
401 Ga0496126_0039557
402 Ga0501070_0391849
403 Ga0501080_0117496
404 Ga0501083_0009943
405 Ga0501044_0450843
406 nmdc:mga0sz30_103735_c1
407 Ga0495601_0028179
408 Ga0495612_0083584
409 Ga0500635_0002981
410 Ga0500635_0005186
411 Ga0495619_0019215
412 Ga0495619_0164589
413 Ga0500647_0201778
414 Ga0500566_0000020
415 Ga0500640_000459
416 Ga0500572_000988
417 Ga0500591_017210
418 Ga0500595_001701
419 Ga0500608_091474
420 Ga0500614_000383
421 Ga0500559_0039157
422 Ga0500603_000219
423 Ga0500603_000793
424 Ga0500630_000308
425 Ga0500639_000066
426 Ga0500637_0014228
427 Ga0500645_011279
428 Ga0500596_000033
429 Ga0501084_0310739
430 Ga0501082_0338626
431 2509147628
432 2513641224
433 2513893377
434 2885411779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

2

75

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

11

76

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

6

81

0.91

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

111

202

0.85

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

129

207

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a5k-assembly4.cif.gz_D atgstf2 from arabidopsis thaliana in complex with camalexin 0.9158 4 208
5a4u-assembly1.cif.gz_A atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde 0.9145 2 208
5a5k-assembly3.cif.gz_O atgstf2 from arabidopsis thaliana in complex with camalexin 0.9018 4 208
6f05-assembly2.cif.gz_A arabidopsis thaliana gstf9, gso3 bound 0.9002 4 207
6f05-assembly2.cif.gz_B arabidopsis thaliana gstf9, gso3 bound 0.8999 4 207
ID Description Score Start End Superfamily
af_A0A0B5EC52_24_99_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9605 7 79 3.40.30.10
af_Q5ZCX6_5_69_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9582 6 65 3.40.30.10
af_Q7JVZ8_6_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9574 6 77 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9531 7 78 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9521 4 80 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3S0ED57-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.988 1 219 GO:0004364
GO:0005737
GO:0043295
AF-A0A537QUM8-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9746 1 208 GO:0004364
GO:0005737
GO:0043295
AF-A0A369TAA3-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9741 1 208 GO:0004364
GO:0005737
GO:0043295
AF-A0A150RKZ4-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9707 1 182 GO:0004364
GO:0005737
GO:0043295
AF-A0A0N0JTA3-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9684 1 216 GO:0004364
GO:0005737
GO:0043295

Map