F328999

General Info

Members Datasets Scaffolds Average Seq Length
217 81 434 124

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0376615|Ga0395905_0376615_842_1213
Length 123
Sequence MSAGGALQTAIATALASVPDLTGVFDGPPARAAYPYAAIDATSETDWSHKNGGGREVLVGITLWDDQPVRLHQLADAAEASVESIDVAGWQLVNMRMIKRRIVRDVAGPWAAAIDFRARMLAA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
19 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
74 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.61
Rhizosphere 94.01
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0376615 3300037471 Bacteria 1313
2 Ga0070658_10148607 3300005327 Viruses 1961
3 Ga0070658_10385348 3300005327 Bacteria 1203
4 Ga0070676_11096416 3300005328 Bacteria 601
5 Ga0070670_100279021 3300005331 Bacteria 1459
6 Ga0070661_100374097 3300005344 Bacteria 1122
7 Ga0070669_100223705 3300005353 Bacteria 1489
8 Ga0070675_100251089 3300005354 Bacteria 1548
9 Ga0070659_100886920 3300005366 Unclassified 779
10 Ga0070667_100341155 3300005367 Bacteria 1355
11 Ga0070663_101745408 3300005455 Unclassified 557
12 Ga0070662_100743961 3300005457 Bacteria 831
13 Ga0070681_11293542 3300005458 Bacteria 652
14 Ga0070664_100620440 3300005564 Bacteria 1004
15 Ga0068856_101164746 3300005614 Bacteria 788
16 Ga0068852_100347037 3300005616 Bacteria 1448
17 Ga0075431_100061774 3300006847 Bacteria 3866
18 Ga0105248_12976052 3300009177 Unclassified 540
19 Ga0157375_10168214 3300013308 Bacteria 2338
20 Ga0206354_11224858 3300020081 Unclassified 514
21 Ga0213875_10000897 3300021388 Bacteria 21712
22 Ga0207647_10005513 3300025904 Bacteria 9267
23 Ga0207647_10339877 3300025904 Bacteria 851
24 Ga0207705_10093574 3300025909 Bacteria 2203
25 Ga0207705_10301418 3300025909 Bacteria 1229
26 Ga0207705_10426921 3300025909 Bacteria 1026
27 Ga0207705_10458782 3300025909 Bacteria 988
28 Ga0207705_10572082 3300025909 Bacteria 878
29 Ga0207695_10106490 3300025913 Bacteria 2790
30 Ga0207660_10722292 3300025917 Bacteria 813
31 Ga0207657_10009215 3300025919 Bacteria 9949
32 Ga0207657_10035542 3300025919 Bacteria 4467
33 Ga0207657_10077784 3300025919 Bacteria 2795
34 Ga0207657_10407219 3300025919 Bacteria 1069
35 Ga0207649_10075314 3300025920 Viruses 2168
36 Ga0207649_10129121 3300025920 Bacteria 1714
37 Ga0207652_10245805 3300025921 Bacteria 1613
38 Ga0207681_10200391 3300025923 Bacteria 1532
39 Ga0207659_10742784 3300025926 Bacteria 841
40 Ga0207690_10014198 3300025932 Bacteria 4806
41 Ga0207690_11052827 3300025932 Viruses 677
42 Ga0207690_11379411 3300025932 Bacteria 589
43 Ga0207706_10001226 3300025933 Bacteria 25940
44 Ga0207706_10163415 3300025933 Bacteria 1957
45 Ga0207706_10727091 3300025933 Bacteria 847
46 Ga0207709_10417272 3300025935 Bacteria 1030
47 Ga0207704_10898573 3300025938 Bacteria 745
48 Ga0207691_10123712 3300025940 Bacteria 2290
49 Ga0207661_10012008 3300025944 Bacteria 6293
50 Ga0207679_10035456 3300025945 Bacteria 3530
51 Ga0207679_10648001 3300025945 Bacteria 955
52 Ga0207667_10010953 3300025949 Bacteria 10568
53 Ga0207667_10952388 3300025949 Bacteria 848
54 Ga0207712_10002285 3300025961 Bacteria 12445
55 Ga0207712_10629220 3300025961 Bacteria 931
56 Ga0207668_10469621 3300025972 Bacteria 1077
57 Ga0207668_11406975 3300025972 Unclassified 629
58 Ga0207658_11621097 3300025986 Bacteria 591
59 Ga0207703_10023806 3300026035 Bacteria 4817
60 Ga0207639_11096571 3300026041 Bacteria 746
61 Ga0207678_10263740 3300026067 Bacteria 1476
62 Ga0207674_10220414 3300026116 Bacteria 1845
63 Ga0207674_10225507 3300026116 Bacteria 1822
64 Ga0207674_10332855 3300026116 Bacteria 1468
65 Ga0207698_10069132 3300026142 Bacteria 2791
66 Ga0207698_10315595 3300026142 Bacteria 1462
67 Ga0268265_10308249 3300028380 Bacteria 1428
68 Ga0316180_1120154 3300030736 Unclassified 707
69 Ga0307408_100001579 3300031548 Bacteria 16814
70 Ga0307408_100008650 3300031548 Bacteria 6722
71 Ga0307408_100115375 3300031548 Bacteria 2071
72 Ga0307408_101497290 3300031548 Bacteria 638
73 Ga0307405_10000840 3300031731 Bacteria 12095
74 Ga0307405_10116165 3300031731 Bacteria 1822
75 Ga0307405_10389733 3300031731 Bacteria 1087
76 Ga0307405_10425258 3300031731 Bacteria 1046
77 Ga0307405_11063998 3300031731 Bacteria 693
78 Ga0307405_11994732 3300031731 Bacteria 519
79 Ga0307413_10000847 3300031824 Bacteria 10776
80 Ga0307413_10002154 3300031824 Bacteria 7911
81 Ga0307413_10006873 3300031824 Bacteria 5236
82 Ga0307413_10007113 3300031824 Bacteria 5168
83 Ga0307413_10171961 3300031824 Bacteria 1534
84 Ga0307413_10208924 3300031824 Viruses 1416
85 Ga0307413_10541068 3300031824 Bacteria 943
86 Ga0307413_11812066 3300031824 Unclassified 546
87 Ga0307410_10000320 3300031852 Bacteria 18645
88 Ga0307410_10004793 3300031852 Bacteria 7060
89 Ga0307410_10073344 3300031852 Bacteria 2380
90 Ga0307410_10073786 3300031852 Bacteria 2374
91 Ga0307410_10107570 3300031852 Bacteria 2012
92 Ga0307410_10210178 3300031852 Bacteria 1490
93 Ga0307410_10444535 3300031852 Bacteria 1056
94 Ga0307410_10592312 3300031852 Bacteria 924
95 Ga0307410_10713079 3300031852 Bacteria 847
96 Ga0307410_10774516 3300031852 Bacteria 814
97 Ga0307406_10001145 3300031901 Bacteria 14817
98 Ga0307406_10075643 3300031901 Bacteria 2222
99 Ga0307406_10267629 3300031901 Bacteria 1296
100 Ga0307406_11273149 3300031901 Bacteria 641
101 Ga0307407_10000701 3300031903 Bacteria 10890
102 Ga0307407_10001308 3300031903 Bacteria 8896
103 Ga0307407_10144002 3300031903 Bacteria 1541
104 Ga0307407_10821249 3300031903 Bacteria 708
105 Ga0307412_10002837 3300031911 Bacteria 9608
106 Ga0307412_10010292 3300031911 Bacteria 5387
107 Ga0307412_10106747 3300031911 Bacteria 1991
108 Ga0307412_10733320 3300031911 Bacteria 851
109 Ga0307412_11835236 3300031911 Viruses 558
110 Ga0307409_100000898 3300031995 Bacteria 13796
111 Ga0307409_100018362 3300031995 Bacteria 4699
112 Ga0307409_100024024 3300031995 Bacteria 4240
113 Ga0307409_100034489 3300031995 Bacteria 3696
114 Ga0307409_100165918 3300031995 Bacteria 1938
115 Ga0307409_100179645 3300031995 Bacteria 1872
116 Ga0307409_100273276 3300031995 Bacteria 1557
117 Ga0307409_100378604 3300031995 Bacteria 1345
118 Ga0307409_100379305 3300031995 Bacteria 1344
119 Ga0307409_100481937 3300031995 Bacteria 1204
120 Ga0307409_101262974 3300031995 Bacteria 763
121 Ga0307409_101673267 3300031995 Unclassified 665
122 Ga0307416_100001975 3300032002 Bacteria 11499
123 Ga0307416_100029809 3300032002 Bacteria 4083
124 Ga0307416_100156587 3300032002 Bacteria 2098
125 Ga0307416_100196596 3300032002 Bacteria 1908
126 Ga0307416_100244124 3300032002 Bacteria 1743
127 Ga0307416_101005709 3300032002 Bacteria 937
128 Ga0307414_10002361 3300032004 Bacteria 9866
129 Ga0307414_10002972 3300032004 Bacteria 8971
130 Ga0307414_10018085 3300032004 Bacteria 4328
131 Ga0307414_10029585 3300032004 Bacteria 3566
132 Ga0307414_10035334 3300032004 Bacteria 3325
133 Ga0307414_10050249 3300032004 Bacteria 2887
134 Ga0307411_10000370 3300032005 Bacteria 15258
135 Ga0307411_10001660 3300032005 Bacteria 9300
136 Ga0307411_10004758 3300032005 Bacteria 6568
137 Ga0307411_10011257 3300032005 Bacteria 4817
138 Ga0307411_10073560 3300032005 Bacteria 2325
139 Ga0307411_10075056 3300032005 Bacteria 2307
140 Ga0307411_10358237 3300032005 Bacteria 1192
141 Ga0307411_10541656 3300032005 Bacteria 991
142 Ga0307411_10624747 3300032005 Viruses 929
143 Ga0307411_10723484 3300032005 Viruses 869
144 Ga0307411_11523095 3300032005 Unclassified 615
145 Ga0307415_100000453 3300032126 Bacteria 17622
146 Ga0307415_100010457 3300032126 Bacteria 5258
147 Ga0307415_100109979 3300032126 Bacteria 2043
148 Ga0307415_100161306 3300032126 Bacteria 1738
149 Ga0307415_100185263 3300032126 Bacteria 1637
150 Ga0307415_100217320 3300032126 Bacteria 1530
151 Ga0373959_0118561 3300034820 Unclassified 645
152 Ga0395899_0002954 3300037312 Bacteria 13606
153 Ga0395899_0003159 3300037312 Bacteria 13082
154 Ga0395899_0008103 3300037312 Bacteria 8092
155 Ga0395899_0127854 3300037312 Bacteria 1816
156 Ga0395899_0320880 3300037312 Bacteria 1043
157 Ga0395899_0594285 3300037312 Unclassified 706
158 Ga0395900_0003181 3300037418 Bacteria 17785
159 Ga0395900_0018029 3300037418 Bacteria 7207
160 Ga0395900_0022132 3300037418 Bacteria 6502
161 Ga0395900_0103107 3300037418 Bacteria 2930
162 Ga0395900_0109018 3300037418 Bacteria 2844
163 Ga0395900_0119730 3300037418 Bacteria 2702
164 Ga0395900_0223327 3300037418 Bacteria 1898
165 Ga0395900_0811190 3300037418 Bacteria 863
166 Ga0395900_0830622 3300037418 Bacteria 850
167 Ga0395898_0005914 3300037466 Bacteria 13147
168 Ga0395898_0103593 3300037466 Bacteria 2730
169 Ga0395898_0173780 3300037466 Bacteria 2059
170 Ga0395905_0007794 3300037471 Bacteria 10620
171 Ga0395905_0012178 3300037471 Bacteria 8282
172 Ga0395905_0020663 3300037471 Bacteria 6233
173 Ga0395905_0192636 3300037471 Bacteria 1912
174 Ga0395905_0193981 3300037471 Bacteria 1904
175 Ga0395905_0779839 3300037471 Bacteria 859
176 Ga0395905_0961554 3300037471 Viruses 757
177 Ga0436364_0099964 3300037853 Bacteria 1299
178 Ga0436364_0267368 3300037853 Bacteria 35795
179 Ga0395901_0002622 3300038443 Bacteria 18181
180 Ga0395901_0006958 3300038443 Bacteria 11427
181 Ga0395901_0158048 3300038443 Bacteria 2380
182 Ga0395901_0201224 3300038443 Viruses 2087
183 Ga0395901_0517798 3300038443 Bacteria 1212
184 Ga0395901_0831091 3300038443 Bacteria 910
185 Ga0395901_1009907 3300038443 Viruses 807
186 Ga0395901_1065174 3300038443 Bacteria 781
187 Ga0466966_0070957 3300044684 Bacteria 2183
188 Ga0466961_0120444 3300044693 Bacteria 1648
189 Ga0466963_0138487 3300044694 Bacteria 1685
190 Ga0466963_0225722 3300044694 Bacteria 1312
191 Ga0466963_0241250 3300044694 Bacteria 1267
192 Ga0466963_0595823 3300044694 Bacteria 780
193 Ga0466957_0079864 3300044842 Bacteria 2036
194 Ga0466959_0394939 3300045049 Viruses 940
195 Ga0466958_0164455 3300045836 Bacteria 1403
196 Ga0466958_1028945 3300045836 Unclassified 537
197 Ga0466967_0075476 3300045976 Viruses 3030
198 Ga0466967_0136728 3300045976 Bacteria 2279
199 Ga0466967_0137440 3300045976 Bacteria 2273
200 Ga0466967_0241747 3300045976 Bacteria 1722
201 Ga0466967_0277109 3300045976 Bacteria 1609
202 Ga0466967_0459662 3300045976 Bacteria 1245
203 Ga0466967_0550446 3300045976 Bacteria 1136
204 Ga0466967_0943902 3300045976 Bacteria 858
205 Ga0466967_1379557 3300045976 Unclassified 702
206 Ga0495669_0043282 3300046684 Viruses 2004
207 Ga0496101_1171008 3300048904 Bacteria 603
208 Ga0496106_0574750 3300048909 Unclassified 904
209 Ga0496107_0298425 3300048910 Bacteria 1199
210 Ga0496107_0771671 3300048910 Unclassified 705
211 Ga0496109_0511963 3300048912 Bacteria 1133
212 Ga0496110_0168773 3300048913 Bacteria 1985
213 Ga0496111_0147734 3300048914 Bacteria 1743
214 Ga0496111_0157421 3300048914 Bacteria 1686
215 Ga0496114_0000092 3300048917 Bacteria 64974
216 Ga0496114_1270603 3300048917 Viruses 623
217 nmdc:mga06r32_55057_c1 3300050510 Bacteria 3815
218 Ga0395905_0376615
219 Ga0070658_10148607
220 Ga0070658_10385348
221 Ga0070676_11096416
222 Ga0070670_100279021
223 Ga0070661_100374097
224 Ga0070669_100223705
225 Ga0070675_100251089
226 Ga0070659_100886920
227 Ga0070667_100341155
228 Ga0070663_101745408
229 Ga0070662_100743961
230 Ga0070681_11293542
231 Ga0070664_100620440
232 Ga0068856_101164746
233 Ga0068852_100347037
234 Ga0075431_100061774
235 Ga0105248_12976052
236 Ga0157375_10168214
237 Ga0206354_11224858
238 Ga0213875_10000897
239 Ga0207647_10005513
240 Ga0207647_10339877
241 Ga0207705_10093574
242 Ga0207705_10301418
243 Ga0207705_10426921
244 Ga0207705_10458782
245 Ga0207705_10572082
246 Ga0207695_10106490
247 Ga0207660_10722292
248 Ga0207657_10009215
249 Ga0207657_10035542
250 Ga0207657_10077784
251 Ga0207657_10407219
252 Ga0207649_10075314
253 Ga0207649_10129121
254 Ga0207652_10245805
255 Ga0207681_10200391
256 Ga0207659_10742784
257 Ga0207690_10014198
258 Ga0207690_11052827
259 Ga0207690_11379411
260 Ga0207706_10001226
261 Ga0207706_10163415
262 Ga0207706_10727091
263 Ga0207709_10417272
264 Ga0207704_10898573
265 Ga0207691_10123712
266 Ga0207661_10012008
267 Ga0207679_10035456
268 Ga0207679_10648001
269 Ga0207667_10010953
270 Ga0207667_10952388
271 Ga0207712_10002285
272 Ga0207712_10629220
273 Ga0207668_10469621
274 Ga0207668_11406975
275 Ga0207658_11621097
276 Ga0207703_10023806
277 Ga0207639_11096571
278 Ga0207678_10263740
279 Ga0207674_10220414
280 Ga0207674_10225507
281 Ga0207674_10332855
282 Ga0207698_10069132
283 Ga0207698_10315595
284 Ga0268265_10308249
285 Ga0316180_1120154
286 Ga0307408_100001579
287 Ga0307408_100008650
288 Ga0307408_100115375
289 Ga0307408_101497290
290 Ga0307405_10000840
291 Ga0307405_10116165
292 Ga0307405_10389733
293 Ga0307405_10425258
294 Ga0307405_11063998
295 Ga0307405_11994732
296 Ga0307413_10000847
297 Ga0307413_10002154
298 Ga0307413_10006873
299 Ga0307413_10007113
300 Ga0307413_10171961
301 Ga0307413_10208924
302 Ga0307413_10541068
303 Ga0307413_11812066
304 Ga0307410_10000320
305 Ga0307410_10004793
306 Ga0307410_10073344
307 Ga0307410_10073786
308 Ga0307410_10107570
309 Ga0307410_10210178
310 Ga0307410_10444535
311 Ga0307410_10592312
312 Ga0307410_10713079
313 Ga0307410_10774516
314 Ga0307406_10001145
315 Ga0307406_10075643
316 Ga0307406_10267629
317 Ga0307406_11273149
318 Ga0307407_10000701
319 Ga0307407_10001308
320 Ga0307407_10144002
321 Ga0307407_10821249
322 Ga0307412_10002837
323 Ga0307412_10010292
324 Ga0307412_10106747
325 Ga0307412_10733320
326 Ga0307412_11835236
327 Ga0307409_100000898
328 Ga0307409_100018362
329 Ga0307409_100024024
330 Ga0307409_100034489
331 Ga0307409_100165918
332 Ga0307409_100179645
333 Ga0307409_100273276
334 Ga0307409_100378604
335 Ga0307409_100379305
336 Ga0307409_100481937
337 Ga0307409_101262974
338 Ga0307409_101673267
339 Ga0307416_100001975
340 Ga0307416_100029809
341 Ga0307416_100156587
342 Ga0307416_100196596
343 Ga0307416_100244124
344 Ga0307416_101005709
345 Ga0307414_10002361
346 Ga0307414_10002972
347 Ga0307414_10018085
348 Ga0307414_10029585
349 Ga0307414_10035334
350 Ga0307414_10050249
351 Ga0307411_10000370
352 Ga0307411_10001660
353 Ga0307411_10004758
354 Ga0307411_10011257
355 Ga0307411_10073560
356 Ga0307411_10075056
357 Ga0307411_10358237
358 Ga0307411_10541656
359 Ga0307411_10624747
360 Ga0307411_10723484
361 Ga0307411_11523095
362 Ga0307415_100000453
363 Ga0307415_100010457
364 Ga0307415_100109979
365 Ga0307415_100161306
366 Ga0307415_100185263
367 Ga0307415_100217320
368 Ga0373959_0118561
369 Ga0395899_0002954
370 Ga0395899_0003159
371 Ga0395899_0008103
372 Ga0395899_0127854
373 Ga0395899_0320880
374 Ga0395899_0594285
375 Ga0395900_0003181
376 Ga0395900_0018029
377 Ga0395900_0022132
378 Ga0395900_0103107
379 Ga0395900_0109018
380 Ga0395900_0119730
381 Ga0395900_0223327
382 Ga0395900_0811190
383 Ga0395900_0830622
384 Ga0395898_0005914
385 Ga0395898_0103593
386 Ga0395898_0173780
387 Ga0395905_0007794
388 Ga0395905_0012178
389 Ga0395905_0020663
390 Ga0395905_0192636
391 Ga0395905_0193981
392 Ga0395905_0779839
393 Ga0395905_0961554
394 Ga0436364_0099964
395 Ga0436364_0267368
396 Ga0395901_0002622
397 Ga0395901_0006958
398 Ga0395901_0158048
399 Ga0395901_0201224
400 Ga0395901_0517798
401 Ga0395901_0831091
402 Ga0395901_1009907
403 Ga0395901_1065174
404 Ga0466966_0070957
405 Ga0466961_0120444
406 Ga0466963_0138487
407 Ga0466963_0225722
408 Ga0466963_0241250
409 Ga0466963_0595823
410 Ga0466957_0079864
411 Ga0466959_0394939
412 Ga0466958_0164455
413 Ga0466958_1028945
414 Ga0466967_0075476
415 Ga0466967_0136728
416 Ga0466967_0137440
417 Ga0466967_0241747
418 Ga0466967_0277109
419 Ga0466967_0459662
420 Ga0466967_0550446
421 Ga0466967_0943902
422 Ga0466967_1379557
423 Ga0495669_0043282
424 Ga0496101_1171008
425 Ga0496106_0574750
426 Ga0496107_0298425
427 Ga0496107_0771671
428 Ga0496109_0511963
429 Ga0496110_0168773
430 Ga0496111_0147734
431 Ga0496111_0157421
432 Ga0496114_0000092
433 Ga0496114_1270603
434 nmdc:mga06r32_55057_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11367

DUF3168

Protein of unknown function (DUF3168)

9

121

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4acv-assembly1.cif.gz_A listeria monocytogenes antigen b 0.8002 1 123
4acv-assembly1.cif.gz_A listeria monocytogenes antigen b 0.7825 1 123
4acv-assembly1.cif.gz_B listeria monocytogenes antigen b 0.7803 1 121
3fzb-assembly2.cif.gz_C crystal structure of the tail terminator protein from phage lambda (gpu-wt) 0.7776 1 121
3fz2-assembly3.cif.gz_E crystal structure of the tail terminator protein from phage lambda (gpu-d74a) 0.7704 1 121
ID Description Score Start End Superfamily
4acvA00 Alpha Beta;2-Layer Sandwich;STM4215-like; 0.8002 1 123 3.30.2000.30
4acvA00 Alpha Beta;2-Layer Sandwich;STM4215-like; 0.7825 1 123 3.30.2000.30
2gjvF00 Alpha Beta;2-Layer Sandwich;STM4215-like;Phage tail protein-like 0.7484 1 123 3.30.2000.10
2gjvF00 Alpha Beta;2-Layer Sandwich;STM4215-like;Phage tail protein-like 0.7431 1 123 3.30.2000.10
af_Q2FX61_1_127_3.30.2000.30 Alpha Beta;2-Layer Sandwich;STM4215-like; 0.7176 1 120 3.30.2000.30
ID Description Score Start End GO Terms
AF-A0A537MEK0-F1-model_v4 DUF3168 domain-containing protein 0.9326 1 123
AF-A0A537MEK0-F1-model_v4 DUF3168 domain-containing protein 0.9254 1 123
AF-A0A1I6L3H1-F1-model_v4 DUF3168 domain-containing protein 0.9185 1 123
AF-A0A2U2J0J8-F1-model_v4 DUF3168 domain-containing protein 0.9179 1 123
AF-A0A1I6L3H1-F1-model_v4 DUF3168 domain-containing protein 0.9115 1 123

Map