F328889

General Info

Members Datasets Scaffolds Average Seq Length
217 95 434 198

Family's Representative Sequence

Representative Sequence 3300028556|Ga0265337_1007985|Ga0265337_10079852
Length 224
Sequence VRLPGSNLCFPLSAFRFPFALPYASVSSSPLEKLQQQLKKLPGLGYRSAERIALHLLVEQPAQRGELVAALEEAGRSVHRCTRCGNLAGGELCAICSDPRRDQRLVCVVEHVPDVVALERSGAWRGVYHVLHGRLSPQHGVGPNDLNLAPLFGRIERGEVDELILSLANDVEGEATCHYVTEHLPSGHAVKVSRIGFGLPSGGGVLYADAVTLRSALDGRRNYG

Samples

Sample ID Description Type Environment
1 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
45 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
92 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
93 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 0
Rhizosphere 94.47
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265337_1007985 3300028556 Bacteria 3897
2 rootH2_10032765 3300003320 Bacteria 31514
3 rootL2_10083753 3300003322 Bacteria 5842
4 rootL2_10114460 3300003322 Bacteria 3142
5 rootL2_10251710 3300003322 Bacteria 1392
6 rootH1_10178067 3300003323 Bacteria 4810
7 rootH1_10198823 3300003323 Bacteria 1310
8 Ga0070658_10044950 3300005327 Bacteria 3570
9 Ga0070683_100002865 3300005329 Bacteria 13819
10 Ga0070683_100018154 3300005329 Bacteria 6226
11 Ga0068869_100181980 3300005334 Bacteria 1648
12 Ga0068868_100010879 3300005338 Bacteria 6604
13 Ga0068868_100809594 3300005338 Bacteria 846
14 Ga0070687_100294285 3300005343 Bacteria 1027
15 Ga0070678_100604638 3300005456 Bacteria 979
16 Ga0068867_100009466 3300005459 Bacteria 6870
17 Ga0070679_100003494 3300005530 Bacteria 14384
18 Ga0070684_100289620 3300005535 Bacteria 1501
19 Ga0070665_101265203 3300005548 Bacteria 748
20 Ga0068855_100425492 3300005563 Bacteria 1452
21 Ga0068857_100019799 3300005577 Bacteria 5912
22 Ga0068856_100001534 3300005614 Bacteria 24189
23 Ga0068866_10194174 3300005718 Bacteria 1208
24 Ga0070717_10000060 3300006028 Bacteria 92521
25 Ga0097621_100004939 3300006237 Bacteria 9351
26 Ga0097621_100109236 3300006237 Bacteria 2336
27 Ga0097621_100425563 3300006237 Unclassified 1192
28 Ga0068871_100041247 3300006358 Bacteria 3700
29 Ga0105240_10611796 3300009093 Bacteria 1198
30 Ga0105238_10388616 3300009551 Bacteria 1387
31 Ga0163163_10348815 3300014325 Bacteria 1536
32 Ga0163163_10427452 3300014325 Bacteria 1384
33 Ga0157379_10879612 3300014968 Unclassified 849
34 Ga0207642_10081275 3300025899 Bacteria 1574
35 Ga0207705_10034751 3300025909 Bacteria 3605
36 Ga0207695_10378049 3300025913 Bacteria 1302
37 Ga0207652_10022818 3300025921 Bacteria 5183
38 Ga0207704_10005153 3300025938 Bacteria 6018
39 Ga0207689_10000634 3300025942 Bacteria 33571
40 Ga0207661_10004822 3300025944 Bacteria 9450
41 Ga0207661_10561352 3300025944 Unclassified 1046
42 Ga0207677_10100608 3300026023 Bacteria 2126
43 Ga0207677_10232825 3300026023 Bacteria 1485
44 Ga0207702_10001475 3300026078 Bacteria 23342
45 Ga0207648_10014231 3300026089 Bacteria 7358
46 Ga0207676_10319813 3300026095 Bacteria 1424
47 Ga0207674_10028270 3300026116 Bacteria 5919
48 Ga0207683_10370356 3300026121 Bacteria 1316
49 Ga0268266_10762427 3300028379 Bacteria 934
50 Ga0265337_1000458 3300028556 Bacteria 21657
51 Ga0265337_1015753 3300028556 Bacteria 2464
52 Ga0265337_1032040 3300028556 Bacteria 1557
53 Ga0265319_1000008 3300028563 Bacteria 215029
54 Ga0265319_1000865 3300028563 Bacteria 19248
55 Ga0265319_1001438 3300028563 Bacteria 14225
56 Ga0265319_1001501 3300028563 Bacteria 13865
57 Ga0265319_1001974 3300028563 Bacteria 11574
58 Ga0265319_1004867 3300028563 Bacteria 6569
59 Ga0265319_1013036 3300028563 Bacteria 3328
60 Ga0265319_1013171 3300028563 Bacteria 3304
61 Ga0265319_1013784 3300028563 Bacteria 3196
62 Ga0265319_1080753 3300028563 Bacteria 1033
63 Ga0265319_1082842 3300028563 Bacteria 1017
64 Ga0265334_10006555 3300028573 Bacteria 5010
65 Ga0265334_10036876 3300028573 Unclassified 1929
66 Ga0265334_10047637 3300028573 Bacteria 1653
67 Ga0265318_10000007 3300028577 Bacteria 280699
68 Ga0265318_10000129 3300028577 Bacteria 69613
69 Ga0265318_10002402 3300028577 Bacteria 10014
70 Ga0265318_10005410 3300028577 Bacteria 5995
71 Ga0265318_10006672 3300028577 Bacteria 5290
72 Ga0265318_10080955 3300028577 Bacteria 1199
73 Ga0265323_10000080 3300028653 Bacteria 54790
74 Ga0265323_10000502 3300028653 Bacteria 21976
75 Ga0265323_10036441 3300028653 Bacteria 1808
76 Ga0265323_10042673 3300028653 Unclassified 1640
77 Ga0265323_10117707 3300028653 Bacteria 867
78 Ga0265322_10000087 3300028654 Bacteria 43593
79 Ga0265322_10002387 3300028654 Bacteria 5806
80 Ga0265336_10068797 3300028666 Bacteria 1059
81 Ga0307515_10070703 3300028794 Bacteria 4745
82 Ga0265338_10000299 3300028800 Bacteria 89317
83 Ga0265338_10007936 3300028800 Bacteria 13003
84 Ga0265338_10395072 3300028800 Bacteria 987
85 Ga0265324_10010853 3300029957 Bacteria 3493
86 Ga0265324_10035947 3300029957 Bacteria 1723
87 Ga0265324_10041255 3300029957 Unclassified 1597
88 Ga0265324_10075995 3300029957 Bacteria 1143
89 Ga0265324_10135661 3300029957 Bacteria 836
90 Ga0265330_10025265 3300031235 Bacteria 2693
91 Ga0265330_10240878 3300031235 Bacteria 763
92 Ga0265332_10109770 3300031238 Bacteria 1162
93 Ga0265332_10109801 3300031238 Bacteria 1162
94 Ga0265320_10000008 3300031240 Bacteria 296209
95 Ga0265320_10000160 3300031240 Bacteria 56027
96 Ga0265320_10001089 3300031240 Bacteria 20022
97 Ga0265320_10002108 3300031240 Bacteria 13993
98 Ga0265320_10002373 3300031240 Bacteria 13172
99 Ga0265320_10003511 3300031240 Bacteria 10505
100 Ga0265320_10008096 3300031240 Bacteria 6464
101 Ga0265320_10016265 3300031240 Bacteria 4173
102 Ga0265320_10044410 3300031240 Bacteria 2189
103 Ga0265320_10048702 3300031240 Bacteria 2066
104 Ga0265320_10054870 3300031240 Bacteria 1921
105 Ga0265320_10077961 3300031240 Bacteria 1550
106 Ga0265320_10097586 3300031240 Bacteria 1355
107 Ga0265320_10111247 3300031240 Bacteria 1254
108 Ga0265320_10136688 3300031240 Bacteria 1111
109 Ga0265325_10088802 3300031241 Bacteria 1527
110 Ga0265325_10121238 3300031241 Unclassified 1260
111 Ga0265339_10083452 3300031249 Bacteria 1685
112 Ga0265331_10007312 3300031250 Bacteria 6398
113 Ga0265331_10014867 3300031250 Bacteria 4128
114 Ga0265331_10029679 3300031250 Bacteria 2727
115 Ga0265327_10000023 3300031251 Bacteria 382703
116 Ga0265327_10002085 3300031251 Bacteria 22281
117 Ga0265327_10014650 3300031251 Bacteria 5116
118 Ga0265316_10009884 3300031344 Bacteria 8743
119 Ga0265316_10023888 3300031344 Bacteria 5133
120 Ga0265316_10049192 3300031344 Bacteria 3322
121 Ga0307408_100000053 3300031548 Bacteria 147370
122 Ga0265313_10000425 3300031595 Bacteria 45128
123 Ga0265313_10000833 3300031595 Bacteria 31186
124 Ga0265313_10007854 3300031595 Bacteria 7196
125 Ga0265313_10007976 3300031595 Bacteria 7107
126 Ga0265313_10010895 3300031595 Bacteria 5703
127 Ga0265313_10036403 3300031595 Bacteria 2470
128 Ga0265313_10115694 3300031595 Bacteria 1174
129 Ga0265313_10173992 3300031595 Bacteria 908
130 Ga0307508_10000031 3300031616 Bacteria 163301
131 Ga0265314_10003753 3300031711 Bacteria 14541
132 Ga0265314_10027687 3300031711 Bacteria 4241
133 Ga0265314_10027830 3300031711 Bacteria 4225
134 Ga0265314_10101146 3300031711 Bacteria 1852
135 Ga0265314_10197652 3300031711 Unclassified 1191
136 Ga0265342_10006136 3300031712 Bacteria 8997
137 Ga0265342_10025077 3300031712 Bacteria 3755
138 Ga0265342_10054011 3300031712 Bacteria 2389
139 Ga0265342_10147663 3300031712 Bacteria 1308
140 Ga0307413_10142580 3300031824 Bacteria 1658
141 Ga0307410_10000049 3300031852 Bacteria 42188
142 Ga0307409_100000002 3300031995 Bacteria 93798
143 Ga0307416_100000110 3300032002 Bacteria 50434
144 Ga0395905_0000119 3300037471 Bacteria 131498
145 Ga0395905_0195675 3300037471 Unclassified 1896
146 Ga0439461_0030483 3300041410 Unclassified 1122
147 Ga0451577_0000024 3300042876 Bacteria 411758
148 Ga0451577_0004069 3300042876 Bacteria 15717
149 Ga0451577_0052620 3300042876 Bacteria 3636
150 Ga0451577_0154447 3300042876 Bacteria 2065
151 Ga0451577_0259419 3300042876 Bacteria 1574
152 Ga0451577_0348209 3300042876 Bacteria 1344
153 Ga0451577_0367946 3300042876 Bacteria 1304
154 Ga0451577_0449473 3300042876 Bacteria 1170
155 Ga0453683_0001578 3300044673 Bacteria 19309
156 Ga0453683_0052332 3300044673 Bacteria 2556
157 Ga0453683_0122846 3300044673 Bacteria 1635
158 Ga0453684_0000266 3300044712 Bacteria 225447
159 Ga0453684_0015438 3300044712 Bacteria 12079
160 Ga0453684_0017418 3300044712 Bacteria 11131
161 Ga0453684_0035568 3300044712 Bacteria 6881
162 Ga0453684_0102627 3300044712 Bacteria 3496
163 Ga0453684_0187642 3300044712 Bacteria 2421
164 Ga0453684_0212867 3300044712 Bacteria 2245
165 Ga0453684_0904078 3300044712 Bacteria 945
166 Ga0451576_0001196 3300045051 Bacteria 46432
167 Ga0451576_0001653 3300045051 Bacteria 37053
168 Ga0451576_0025086 3300045051 Bacteria 6428
169 Ga0451576_0154674 3300045051 Bacteria 2392
170 Ga0451576_0233216 3300045051 Bacteria 1922
171 Ga0451576_0768838 3300045051 Bacteria 1012
172 Ga0466967_0053189 3300045976 Bacteria 3558
173 Ga0501031_0007680 3300049568 Bacteria 7019
174 Ga0501032_0002656 3300049569 Bacteria 13954
175 Ga0501032_0006633 3300049569 Bacteria 8499
176 Ga0501033_0002875 3300049570 Bacteria 14424
177 Ga0501034_0054147 3300049571 Bacteria 4039
178 Ga0501034_0451565 3300049571 Bacteria 1203
179 Ga0501036_0036179 3300049572 Bacteria 4177
180 Ga0501037_0042663 3300049573 Bacteria 3334
181 Ga0501037_0089478 3300049573 Bacteria 2227
182 Ga0501038_0034654 3300049574 Bacteria 4437
183 Ga0501038_0665359 3300049574 Bacteria 783
184 Ga0501042_0164020 3300049578 Bacteria 1603
185 Ga0501043_0079098 3300049579 Bacteria 2583
186 Ga0501043_0159193 3300049579 Unclassified 1765
187 Ga0501046_0008224 3300049580 Bacteria 9109
188 Ga0501046_0017626 3300049580 Bacteria 5955
189 Ga0501046_0096595 3300049580 Bacteria 2269
190 Ga0501046_0162122 3300049580 Bacteria 1681
191 Ga0501047_0013623 3300049581 Bacteria 7714
192 Ga0501047_0053324 3300049581 Bacteria 3910
193 Ga0501047_0432764 3300049581 Bacteria 1146
194 Ga0501047_0561222 3300049581 Bacteria 965
195 Ga0501048_0030408 3300049582 Bacteria 3907
196 Ga0501070_0130169 3300049586 Bacteria 2079
197 Ga0501070_0450034 3300049586 Bacteria 1038
198 Ga0501070_0583086 3300049586 Unclassified 893
199 Ga0501243_000312 3300049675 Bacteria 6269
200 Ga0501080_0377527 3300049742 Bacteria 1277
201 Ga0501080_0445513 3300049742 Bacteria 1161
202 Ga0501080_0480548 3300049742 Bacteria 1111
203 Ga0501083_0017043 3300049744 Bacteria 5071
204 Ga0501083_0022930 3300049744 Bacteria 4331
205 Ga0501035_0007431 3300049822 Bacteria 10229
206 Ga0501035_0140145 3300049822 Bacteria 2103
207 Ga0501035_0176878 3300049822 Bacteria 1840
208 Ga0501044_0002784 3300049823 Bacteria 19918
209 Ga0501044_0034618 3300049823 Bacteria 5295
210 Ga0501044_0067210 3300049823 Bacteria 3652
211 Ga0501044_0171802 3300049823 Bacteria 2138
212 Ga0501044_0181752 3300049823 Bacteria 2069
213 Ga0500642_0118606 3300053130 Bacteria 1237
214 Ga0500568_0009428 3300053139 Bacteria 4640
215 Ga0500622_0088027 3300053156 Bacteria 1545
216 Ga0501082_0554363 3300060353 Unclassified 1005
217 2788436504 2786546940 Bacteria 6396474
218 Ga0265337_1007985
219 rootH2_10032765
220 rootL2_10083753
221 rootL2_10114460
222 rootL2_10251710
223 rootH1_10178067
224 rootH1_10198823
225 Ga0070658_10044950
226 Ga0070683_100002865
227 Ga0070683_100018154
228 Ga0068869_100181980
229 Ga0068868_100010879
230 Ga0068868_100809594
231 Ga0070687_100294285
232 Ga0070678_100604638
233 Ga0068867_100009466
234 Ga0070679_100003494
235 Ga0070684_100289620
236 Ga0070665_101265203
237 Ga0068855_100425492
238 Ga0068857_100019799
239 Ga0068856_100001534
240 Ga0068866_10194174
241 Ga0070717_10000060
242 Ga0097621_100004939
243 Ga0097621_100109236
244 Ga0097621_100425563
245 Ga0068871_100041247
246 Ga0105240_10611796
247 Ga0105238_10388616
248 Ga0163163_10348815
249 Ga0163163_10427452
250 Ga0157379_10879612
251 Ga0207642_10081275
252 Ga0207705_10034751
253 Ga0207695_10378049
254 Ga0207652_10022818
255 Ga0207704_10005153
256 Ga0207689_10000634
257 Ga0207661_10004822
258 Ga0207661_10561352
259 Ga0207677_10100608
260 Ga0207677_10232825
261 Ga0207702_10001475
262 Ga0207648_10014231
263 Ga0207676_10319813
264 Ga0207674_10028270
265 Ga0207683_10370356
266 Ga0268266_10762427
267 Ga0265337_1000458
268 Ga0265337_1015753
269 Ga0265337_1032040
270 Ga0265319_1000008
271 Ga0265319_1000865
272 Ga0265319_1001438
273 Ga0265319_1001501
274 Ga0265319_1001974
275 Ga0265319_1004867
276 Ga0265319_1013036
277 Ga0265319_1013171
278 Ga0265319_1013784
279 Ga0265319_1080753
280 Ga0265319_1082842
281 Ga0265334_10006555
282 Ga0265334_10036876
283 Ga0265334_10047637
284 Ga0265318_10000007
285 Ga0265318_10000129
286 Ga0265318_10002402
287 Ga0265318_10005410
288 Ga0265318_10006672
289 Ga0265318_10080955
290 Ga0265323_10000080
291 Ga0265323_10000502
292 Ga0265323_10036441
293 Ga0265323_10042673
294 Ga0265323_10117707
295 Ga0265322_10000087
296 Ga0265322_10002387
297 Ga0265336_10068797
298 Ga0307515_10070703
299 Ga0265338_10000299
300 Ga0265338_10007936
301 Ga0265338_10395072
302 Ga0265324_10010853
303 Ga0265324_10035947
304 Ga0265324_10041255
305 Ga0265324_10075995
306 Ga0265324_10135661
307 Ga0265330_10025265
308 Ga0265330_10240878
309 Ga0265332_10109770
310 Ga0265332_10109801
311 Ga0265320_10000008
312 Ga0265320_10000160
313 Ga0265320_10001089
314 Ga0265320_10002108
315 Ga0265320_10002373
316 Ga0265320_10003511
317 Ga0265320_10008096
318 Ga0265320_10016265
319 Ga0265320_10044410
320 Ga0265320_10048702
321 Ga0265320_10054870
322 Ga0265320_10077961
323 Ga0265320_10097586
324 Ga0265320_10111247
325 Ga0265320_10136688
326 Ga0265325_10088802
327 Ga0265325_10121238
328 Ga0265339_10083452
329 Ga0265331_10007312
330 Ga0265331_10014867
331 Ga0265331_10029679
332 Ga0265327_10000023
333 Ga0265327_10002085
334 Ga0265327_10014650
335 Ga0265316_10009884
336 Ga0265316_10023888
337 Ga0265316_10049192
338 Ga0307408_100000053
339 Ga0265313_10000425
340 Ga0265313_10000833
341 Ga0265313_10007854
342 Ga0265313_10007976
343 Ga0265313_10010895
344 Ga0265313_10036403
345 Ga0265313_10115694
346 Ga0265313_10173992
347 Ga0307508_10000031
348 Ga0265314_10003753
349 Ga0265314_10027687
350 Ga0265314_10027830
351 Ga0265314_10101146
352 Ga0265314_10197652
353 Ga0265342_10006136
354 Ga0265342_10025077
355 Ga0265342_10054011
356 Ga0265342_10147663
357 Ga0307413_10142580
358 Ga0307410_10000049
359 Ga0307409_100000002
360 Ga0307416_100000110
361 Ga0395905_0000119
362 Ga0395905_0195675
363 Ga0439461_0030483
364 Ga0451577_0000024
365 Ga0451577_0004069
366 Ga0451577_0052620
367 Ga0451577_0154447
368 Ga0451577_0259419
369 Ga0451577_0348209
370 Ga0451577_0367946
371 Ga0451577_0449473
372 Ga0453683_0001578
373 Ga0453683_0052332
374 Ga0453683_0122846
375 Ga0453684_0000266
376 Ga0453684_0015438
377 Ga0453684_0017418
378 Ga0453684_0035568
379 Ga0453684_0102627
380 Ga0453684_0187642
381 Ga0453684_0212867
382 Ga0453684_0904078
383 Ga0451576_0001196
384 Ga0451576_0001653
385 Ga0451576_0025086
386 Ga0451576_0154674
387 Ga0451576_0233216
388 Ga0451576_0768838
389 Ga0466967_0053189
390 Ga0501031_0007680
391 Ga0501032_0002656
392 Ga0501032_0006633
393 Ga0501033_0002875
394 Ga0501034_0054147
395 Ga0501034_0451565
396 Ga0501036_0036179
397 Ga0501037_0042663
398 Ga0501037_0089478
399 Ga0501038_0034654
400 Ga0501038_0665359
401 Ga0501042_0164020
402 Ga0501043_0079098
403 Ga0501043_0159193
404 Ga0501046_0008224
405 Ga0501046_0017626
406 Ga0501046_0096595
407 Ga0501046_0162122
408 Ga0501047_0013623
409 Ga0501047_0053324
410 Ga0501047_0432764
411 Ga0501047_0561222
412 Ga0501048_0030408
413 Ga0501070_0130169
414 Ga0501070_0450034
415 Ga0501070_0583086
416 Ga0501243_000312
417 Ga0501080_0377527
418 Ga0501080_0445513
419 Ga0501080_0480548
420 Ga0501083_0017043
421 Ga0501083_0022930
422 Ga0501035_0007431
423 Ga0501035_0140145
424 Ga0501035_0176878
425 Ga0501044_0002784
426 Ga0501044_0034618
427 Ga0501044_0067210
428 Ga0501044_0171802
429 Ga0501044_0181752
430 Ga0500642_0118606
431 Ga0500568_0009428
432 Ga0500622_0088027
433 Ga0501082_0554363
434 2788436504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

198

221

0.99

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

78

98

0.98

PF21176

RecR_HhH

RecR, helix-hairpin-helix

31

75

0.97

PF13662

Toprim_4

Toprim domain

104

196

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9046 78 167
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.8769 78 167
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8491 16 196
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8447 16 196
4o6o-assembly1.cif.gz_B structural and functional studies the characterization of cys4 zinc-finger motif in the recombination mediator protein recr 0.7511 2 196
ID Description Score Start End Superfamily
af_P9WHI3_76_174_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9461 75 168 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9222 74 168 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9132 74 168 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9089 75 196 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9018 75 196 3.40.1360.10
ID Description Score Start End GO Terms
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9467 69 171 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9294 69 171 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A3D0TKE5-F1-model_v4 Recombination protein RecR 0.918 50 171 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-W1XYN8-F1-model_v4 Recombination protein RecR 0.906 38 150 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A3D0TKE5-F1-model_v4 Recombination protein RecR 0.8907 50 171 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Map