F328215

General Info

Members Datasets Scaffolds Average Seq Length
216 151 194 212

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2945977869|2945978748
Length 246
Sequence QYKNVPGKFLLKRGPSIDIYAIIFHIYTFKSFHMPEPVIALHAVKKNYQDVPVLDIARLELPAGIYWLQGENGAGKTTCMKVMAGLIPFKGEILLQGKVSSREHPVQFRRLINYAEAEPLYPSFLTGRDLLELYLNTKGGNTGDIRAISEKLGVHIFVNNPVSSYSSGMLKKLSLLLAFTGNPALILLDEPLITIDTRALAVLYDLIREYSAKGVSFCITSHQPLDEEELTVTGTLKVAHKNITLS

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
8 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
9 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
10 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
11 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
12 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
13 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
14 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
15 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
16 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
17 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
18 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
19 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
20 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
103 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
132 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
133 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
138 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
139 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
140 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
145 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
149 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
150 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
151 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.81
Metatranscriptomes 0
Isolates 10.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.46
Nodule 0
Rhizoplane 0.46
Rhizosphere 57.87
Stem 0
Stem Tuber 0
Unclassified 16.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003472 3300001979 Bacteria 6927
2 JGI24739J22299_10002091 3300001989 Bacteria 7646
3 JGI24737J22298_10000924 3300001990 Bacteria 10440
4 JGI24735J21928_10000269 3300002067 Bacteria 18209
5 JGI25162J39368_1000011 3300002737 Bacteria 379156
6 JGI25154J39366_1000007 3300002738 Bacteria 335932
7 JGI25153J46596_10000790 3300003215 Bacteria 19378
8 rootH1_10026726 3300003316 Bacteria 8164
9 rootH2_10056147 3300003320 Bacteria 5717
10 rootH2_10232591 3300003320 Bacteria 1425
11 rootH2_10233421 3300003320 Bacteria 1148
12 rootH2_10256250 3300003320 Bacteria 1395
13 rootL2_10046112 3300003322 Unclassified 1373
14 rootL2_10066357 3300003322 Bacteria 3636
15 rootL2_10116239 3300003322 Bacteria 6455
16 rootH1_10127509 3300003323 Bacteria 5977
17 JGI25160J50197_1004210 3300003354 Bacteria 6251
18 Ga0055535_1003923 3300003761 Unclassified 3898
19 Ga0055542_1011467 3300003762 Unclassified 1571
20 Ga0055526_1050912 3300003771 Bacteria 946
21 Ga0055528_1000967 3300003790 Bacteria 19053
22 Ga0055530_10002107 3300003791 Bacteria 13256
23 Ga0055531_10026472 3300003794 Bacteria 2067
24 Ga0055543_1002622 3300004625 Bacteria 5799
25 Ga0065165_1000010 3300005262 Bacteria 323737
26 Ga0065165_1008066 3300005262 Bacteria 5025
27 Ga0065714_10002446 3300005288 Bacteria 33995
28 Ga0065714_10007373 3300005288 Bacteria 3571
29 Ga0065714_10064538 3300005288 Bacteria 39923
30 Ga0065704_10083837 3300005289 Bacteria 3411
31 Ga0070658_10073702 3300005327 Bacteria 2800
32 Ga0070658_10131066 3300005327 Bacteria 2090
33 Ga0070683_100443052 3300005329 Bacteria 1239
34 Ga0070680_100124236 3300005336 Bacteria 2156
35 Ga0070660_100007712 3300005339 Bacteria 7503
36 Ga0070659_100000383 3300005366 Bacteria 33558
37 Ga0068867_100396283 3300005459 Bacteria 1163
38 Ga0070679_100079517 3300005530 Bacteria 3268
39 Ga0068855_100007399 3300005563 Bacteria 13291
40 Ga0068855_100587379 3300005563 Bacteria 1202
41 Ga0068854_100123721 3300005578 Bacteria 1967
42 Ga0068863_100550277 3300005841 Bacteria 1139
43 Ga0075366_10003017 3300006195 Bacteria 8784
44 Ga0075366_10004216 3300006195 Bacteria 7708
45 Ga0075366_10004290 3300006195 Bacteria 7648
46 Ga0075366_10067458 3300006195 Bacteria 2129
47 Ga0105240_10060657 3300009093 Bacteria 4715
48 Ga0105240_10110551 3300009093 Bacteria 3326
49 Ga0105240_10243869 3300009093 Bacteria 2082
50 Ga0105240_10913561 3300009093 Bacteria 944
51 Ga0105241_10107872 3300009174 Bacteria 2225
52 Ga0105237_10009341 3300009545 Bacteria 10502
53 Ga0105237_10017748 3300009545 Bacteria 7377
54 Ga0105237_10017794 3300009545 Bacteria 7368
55 Ga0105237_10777842 3300009545 Bacteria 964
56 Ga0105238_10313563 3300009551 Bacteria 1554
57 Ga0105239_10000042 3300010375 Bacteria 199662
58 Ga0105239_10000691 3300010375 Bacteria 48085
59 Ga0105239_10053009 3300010375 Bacteria 4449
60 Ga0105239_10092931 3300010375 Bacteria 3330
61 Ga0157373_10000328 3300013100 Bacteria 38459
62 Ga0157371_10227629 3300013102 Bacteria 1340
63 Ga0157370_10003110 3300013104 Bacteria 19655
64 Ga0157369_10027679 3300013105 Bacteria 6281
65 Ga0157378_10462909 3300013297 Bacteria 1260
66 Ga0163162_10014190 3300013306 Bacteria 7786
67 Ga0157372_10007623 3300013307 Bacteria 11510
68 Ga0157372_10097873 3300013307 Unclassified 3347
69 Ga0157372_10131729 3300013307 Bacteria 2877
70 Ga0157375_10693469 3300013308 Bacteria 1172
71 Ga0182008_10000010 3300014497 Bacteria 301527
72 Ga0182008_10000166 3300014497 Bacteria 51443
73 Ga0182006_1003314 3300015261 Bacteria 8308
74 Ga0182005_1000215 3300015265 Bacteria 38214
75 Ga0163161_10005137 3300017792 Bacteria 9100
76 Ga0163161_10509547 3300017792 Bacteria 981
77 Ga0209436_100330 3300025208 Bacteria 21518
78 Ga0209436_101105 3300025208 Bacteria 10037
79 Ga0209437_100017 3300025233 Bacteria 694471
80 Ga0209258_100156 3300025242 Bacteria 156926
81 Ga0209646_1000002 3300025246 Bacteria 1425781
82 Ga0209026_1000361 3300025250 Bacteria 42722
83 Ga0209026_1000740 3300025250 Bacteria 18743
84 Ga0209148_1000427 3300025254 Bacteria 46722
85 Ga0209129_1011308 3300025258 Bacteria 2141
86 Ga0209455_1011314 3300025272 Unclassified 2204
87 Ga0209673_1000082 3300025273 Bacteria 219716
88 Ga0209130_1002295 3300025284 Bacteria 9817
89 Ga0209564_1005961 3300025295 Bacteria 6744
90 Ga0209564_1037317 3300025295 Bacteria 1371
91 Ga0209758_1001771 3300025297 Bacteria 23935
92 Ga0209758_1006036 3300025297 Bacteria 8939
93 Ga0209050_1001435 3300025298 Bacteria 25640
94 Ga0209050_1008745 3300025298 Bacteria 5330
95 Ga0207426_1000850 3300025302 Bacteria 32126
96 Ga0207426_1001505 3300025302 Bacteria 19050
97 Ga0207426_1003428 3300025302 Bacteria 8639
98 Ga0207426_1004384 3300025302 Bacteria 6920
99 Ga0209257_1006541 3300025304 Bacteria 7442
100 Ga0207654_10084044 3300025911 Bacteria 1923
101 Ga0207654_10167902 3300025911 Bacteria 1422
102 Ga0207695_10163180 3300025913 Bacteria 2158
103 Ga0207695_10302160 3300025913 Bacteria 1491
104 Ga0207695_10318174 3300025913 Bacteria 1446
105 Ga0207695_10395261 3300025913 Bacteria 1267
106 Ga0207671_10009797 3300025914 Bacteria 7972
107 Ga0207671_10013998 3300025914 Bacteria 6363
108 Ga0207671_10024671 3300025914 Unclassified 4516
109 Ga0207660_10465387 3300025917 Bacteria 1023
110 Ga0207657_10119392 3300025919 Bacteria 2170
111 Ga0207652_11013790 3300025921 Bacteria 729
112 Ga0207690_10001605 3300025932 Bacteria 14082
113 Ga0207661_10046860 3300025944 Bacteria 3429
114 Ga0207667_10013716 3300025949 Bacteria 9262
115 Ga0207640_10100861 3300025981 Bacteria 2024
116 Ga0207641_10530132 3300026088 Bacteria 1146
117 Ga0307515_10000839 3300028794 Bacteria 70656
118 Ga0307515_10004603 3300028794 Bacteria 28374
119 Ga0307513_10175526 3300031456 Bacteria 2014
120 Ga0307414_10000021 3300032004 Bacteria 213521
121 Ga0307507_10007373 3300033179 Bacteria 16056
122 Ga0439439_0045338 3300041406 Unclassified 1146
123 Ga0439431_0003617 3300041997 Unclassified 3410
124 Ga0439445_0019327 3300042004 Bacteria 1697
125 Ga0466965_0045232 3300044683 Bacteria 2177
126 Ga0466959_0027938 3300045049 Bacteria 4184
127 Ga0495592_0151631 3300046454 Bacteria 1603
128 Ga0495638_0085540 3300046460 Bacteria 1907
129 Ga0495638_0391371 3300046460 Bacteria 723
130 Ga0495650_0000003 3300046471 Bacteria 900730
131 Ga0495650_0036952 3300046471 Bacteria 2131
132 Ga0495650_0080053 3300046471 Bacteria 1262
133 Ga0495605_0136717 3300046474 Bacteria 1102
134 Ga0495585_0000652 3300046492 Bacteria 31861
135 Ga0495585_0001978 3300046492 Bacteria 15240
136 Ga0495583_0019585 3300046506 Bacteria 3528
137 Ga0495606_0000143 3300046507 Bacteria 123231
138 Ga0495606_0019049 3300046507 Bacteria 5123
139 Ga0495606_0025315 3300046507 Bacteria 4253
140 Ga0495606_0133218 3300046507 Bacteria 1475
141 Ga0495606_0204275 3300046507 Bacteria 1124
142 Ga0495610_0001797 3300046512 Bacteria 18695
143 Ga0495610_0007182 3300046512 Bacteria 7489
144 Ga0495616_0003241 3300046513 Bacteria 10469
145 Ga0495616_0033282 3300046513 Bacteria 2687
146 Ga0495628_0235338 3300046516 Bacteria 1372
147 Ga0495648_0040371 3300046524 Bacteria 2959
148 Ga0495652_0317391 3300046529 Bacteria 1127
149 Ga0495609_0013396 3300046538 Bacteria 3873
150 Ga0495633_0000056 3300046558 Bacteria 149334
151 Ga0495668_0000003 3300046616 Bacteria 695023
152 Ga0495668_0080364 3300046616 Bacteria 1789
153 Ga0495625_0000005 3300046660 Bacteria 596135
154 Ga0495625_0001399 3300046660 Bacteria 29573
155 Ga0495625_0004452 3300046660 Bacteria 13241
156 Ga0495625_0026002 3300046660 Bacteria 4427
157 Ga0495625_0203946 3300046660 Bacteria 1303
158 Ga0495658_0040795 3300046683 Bacteria 2582
159 Ga0495671_0115751 3300046692 Unclassified 1309
160 Ga0495649_0000003 3300046694 Bacteria 880817
161 Ga0495660_0036390 3300046810 Bacteria 2746
162 Ga0495687_000833 3300047443 Bacteria 32923
163 Ga0495686_0000160 3300047472 Bacteria 128437
164 Ga0495686_0044089 3300047472 Bacteria 2824
165 Ga0495686_0103102 3300047472 Bacteria 1719
166 Ga0495686_0146235 3300047472 Bacteria 1391
167 Ga0495686_0191415 3300047472 Bacteria 1179
168 Ga0496121_0000020 3300048924 Bacteria 498732
169 Ga0496122_0033495 3300048925 Bacteria 4224
170 Ga0496123_0219985 3300048926 Unclassified 958
171 Ga0495678_040461 3300049459 Bacteria 1874
172 Ga0501291_046200 3300049514 Unclassified 780
173 Ga0501300_003429 3300049523 Bacteria 2370
174 Ga0501034_0076722 3300049571 Bacteria 3348
175 Ga0501044_0054351 3300049823 Bacteria 4117
176 nmdc:mga0k408_1831_c1 3300050493 Bacteria 11408
177 nmdc:mga0k408_22483_c1 3300050493 Bacteria 3551
178 nmdc:mga0k408_5000_c1 3300050493 Bacteria 7025
179 nmdc:mga0k408_64658_c1 3300050493 Bacteria 2129
180 Ga0500644_0000017 3300053088 Bacteria 106518
181 Ga0500646_0068438 3300053090 Bacteria 1060
182 Ga0500651_0032859 3300053093 Bacteria 3272
183 Ga0500651_0381388 3300053093 Bacteria 795
184 Ga0500569_001268 3300053109 Bacteria 4708
185 Ga0500618_000003 3300053125 Bacteria 338706
186 Ga0500561_0027386 3300053137 Bacteria 1405
187 Ga0500568_0171616 3300053139 Bacteria 798
188 Ga0500577_0001494 3300053142 Bacteria 5963
189 Ga0500604_0143800 3300053151 Bacteria 807
190 Ga0500616_0118776 3300053153 Bacteria 1266
191 Ga0500622_0003133 3300053156 Bacteria 11350
192 Ga0500624_001687 3300053157 Bacteria 3287
193 Ga0500633_0006910 3300053160 Bacteria 2820
194 Ga0500636_0157992 3300053177 Bacteria 1239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10066357 rootL2_100663575 174
2 iso_pu_bacteria 2929239360 2929245538 197
3 3300046507 Ga0495606_0019049 Ga0495606_0019049_2541_3176 202
4 iso_pu_bacteria 2849281842 2849282720 203
5 iso_pu_bacteria 2919437846 2919441349 203
6 3300003323 rootH1_10127509 rootH1_101275097 205
7 3300025298 Ga0209050_1008745 Ga0209050_10087453 205
8 3300031456 Ga0307513_10175526 Ga0307513_101755262 205
9 3300032004 Ga0307414_10000021 Ga0307414_10000021129 206
10 iso_pu_bacteria 2738541283 2738754052 206
11 iso_pu_bacteria 2977232053 2977236166 206
12 3300005262 Ga0065165_1008066 Ga0065165_10080663 207
13 3300005288 Ga0065714_10007373 Ga0065714_100073732 207
14 3300015265 Ga0182005_1000215 Ga0182005_10002156 207
15 3300025208 Ga0209436_101105 Ga0209436_1011055 207
16 3300025302 Ga0207426_1004384 Ga0207426_10043842 207
17 3300046512 Ga0495610_0007182 Ga0495610_0007182_6541_7173 207
18 3300047472 Ga0495686_0146235 Ga0495686_0146235_639_1352 207
19 iso_pu_bacteria 2599185184 2599477942 207
20 iso_pu_bacteria 2738543023 2739301548 207
21 iso_pu_bacteria 2818991442 2819573771 207
22 iso_pu_bacteria 2821136567 2821137107 207
23 iso_pu_bacteria 2884791551 2884791851 207
24 iso_pu_bacteria 2904467357 2904468151 207
25 iso_pu_bacteria 2928078545 2928079902 207
26 iso_pu_bacteria 2928147474 2928147644 207
27 iso_pu_bacteria 2932082852 2932083688 207
28 3300003761 Ga0055535_1003923 Ga0055535_10039233 208
29 3300003762 Ga0055542_1011467 Ga0055542_10114672 208
30 3300013307 Ga0157372_10131729 Ga0157372_101317293 208
31 3300017792 Ga0163161_10509547 Ga0163161_105095472 208
32 3300025242 Ga0209258_100156 Ga0209258_10015631 208
33 3300025254 Ga0209148_1000427 Ga0209148_100042718 208
34 3300041997 Ga0439431_0003617 Ga0439431_0003617_1699_2343 208
35 3300042004 Ga0439445_0019327 Ga0439445_0019327_382_1026 208
36 3300048924 Ga0496121_0000020 Ga0496121_0000020_322150_322794 208
37 3300053088 Ga0500644_0000017 Ga0500644_0000017_71317_71943 208
38 3300053160 Ga0500633_0006910 Ga0500633_0006910_328_954 208
39 3300053177 Ga0500636_0157992 Ga0500636_0157992_411_1037 208
40 iso_pu_bacteria 2929921140 2929923416 208
41 iso_pu_bacteria 8003151029 8003152820 208
42 3300003320 rootH2_10056147 rootH2_100561472 209
43 3300003320 rootH2_10233421 rootH2_102334212 209
44 3300005289 Ga0065704_10083837 Ga0065704_100838373 209
45 3300005327 Ga0070658_10131066 Ga0070658_101310662 209
46 3300005329 Ga0070683_100443052 Ga0070683_1004430522 209
47 3300005336 Ga0070680_100124236 Ga0070680_1001242362 209
48 3300005530 Ga0070679_100079517 Ga0070679_1000795173 209
49 3300013100 Ga0157373_10000328 Ga0157373_1000032823 209
50 3300013307 Ga0157372_10097873 Ga0157372_100978732 209
51 3300025208 Ga0209436_100330 Ga0209436_1003304 209
52 3300025284 Ga0209130_1002295 Ga0209130_10022954 209
53 3300025302 Ga0207426_1001505 Ga0207426_100150518 209
54 3300025917 Ga0207660_10465387 Ga0207660_104653872 209
55 3300025921 Ga0207652_11013790 Ga0207652_110137901 209
56 3300025944 Ga0207661_10046860 Ga0207661_100468603 209
57 3300045049 Ga0466959_0027938 Ga0466959_0027938_3182_3910 209
58 3300049571 Ga0501034_0076722 Ga0501034_0076722_1755_2459 209
59 iso_pu_bacteria 2818991460 2819680496 209
60 iso_pu_bacteria 2884791551 2884798123 209
61 iso_pu_bacteria 2896109856 2896112218 209
62 iso_pu_bacteria 2929177148 2929182793 209
63 iso_pu_bacteria 2945977869 2945978748 209
64 iso_pu_bacteria 2946013367 2946015385 209
65 3300003320 rootH2_10256250 rootH2_102562501 210
66 3300005288 Ga0065714_10002446 Ga0065714_1000244612 210
67 3300005288 Ga0065714_10064538 Ga0065714_1006453836 210
68 3300009545 Ga0105237_10009341 Ga0105237_100093416 210
69 3300013104 Ga0157370_10003110 Ga0157370_100031106 210
70 3300014497 Ga0182008_10000010 Ga0182008_10000010245 210
71 3300014497 Ga0182008_10000166 Ga0182008_1000016611 210
72 3300015261 Ga0182006_1003314 Ga0182006_10033144 210
73 3300017792 Ga0163161_10005137 Ga0163161_100051372 210
74 3300025914 Ga0207671_10024671 Ga0207671_100246714 210
75 3300048925 Ga0496122_0033495 Ga0496122_0033495_2532_3164 210
76 3300048926 Ga0496123_0219985 Ga0496123_0219985_259_891 210
77 3300001990 JGI24737J22298_10000924 JGI24737J22298_100009245 211
78 3300002067 JGI24735J21928_10000269 JGI24735J21928_1000026916 211
79 3300002737 JGI25162J39368_1000011 JGI25162J39368_100001114 211
80 3300003316 rootH1_10026726 rootH1_100267268 211
81 3300003322 rootL2_10046112 rootL2_100461122 211
82 3300003322 rootL2_10116239 rootL2_101162392 211
83 3300005327 Ga0070658_10073702 Ga0070658_100737022 211
84 3300005339 Ga0070660_100007712 Ga0070660_1000077128 211
85 3300005366 Ga0070659_100000383 Ga0070659_10000038327 211
86 3300005563 Ga0068855_100007399 Ga0068855_1000073992 211
87 3300005563 Ga0068855_100587379 Ga0068855_1005873792 211
88 3300005578 Ga0068854_100123721 Ga0068854_1001237211 211
89 3300006195 Ga0075366_10003017 Ga0075366_100030174 211
90 3300006195 Ga0075366_10004216 Ga0075366_100042165 211
91 3300006195 Ga0075366_10004290 Ga0075366_100042904 211
92 3300006195 Ga0075366_10067458 Ga0075366_100674582 211
93 3300009093 Ga0105240_10060657 Ga0105240_100606574 211
94 3300009093 Ga0105240_10110551 Ga0105240_101105512 211
95 3300009093 Ga0105240_10243869 Ga0105240_102438692 211
96 3300009093 Ga0105240_10913561 Ga0105240_109135612 211
97 3300009174 Ga0105241_10107872 Ga0105241_101078722 211
98 3300009545 Ga0105237_10017748 Ga0105237_100177483 211
99 3300009545 Ga0105237_10017794 Ga0105237_100177944 211
100 3300010375 Ga0105239_10000691 Ga0105239_1000069141 211
101 3300010375 Ga0105239_10053009 Ga0105239_100530093 211
102 3300010375 Ga0105239_10092931 Ga0105239_100929314 211
103 3300013102 Ga0157371_10227629 Ga0157371_102276292 211
104 3300013105 Ga0157369_10027679 Ga0157369_100276793 211
105 3300013297 Ga0157378_10462909 Ga0157378_104629091 211
106 3300013306 Ga0163162_10014190 Ga0163162_100141906 211
107 3300013307 Ga0157372_10007623 Ga0157372_100076232 211
108 3300025233 Ga0209437_100017 Ga0209437_100017178 211
109 3300025250 Ga0209026_1000361 Ga0209026_100036134 211
110 3300025258 Ga0209129_1011308 Ga0209129_10113082 211
111 3300025272 Ga0209455_1011314 Ga0209455_10113142 211
112 3300025911 Ga0207654_10084044 Ga0207654_100840441 211
113 3300025911 Ga0207654_10167902 Ga0207654_101679023 211
114 3300025913 Ga0207695_10163180 Ga0207695_101631801 211
115 3300025913 Ga0207695_10302160 Ga0207695_103021602 211
116 3300025913 Ga0207695_10318174 Ga0207695_103181742 211
117 3300025913 Ga0207695_10395261 Ga0207695_103952612 211
118 3300025914 Ga0207671_10009797 Ga0207671_100097977 211
119 3300025914 Ga0207671_10013998 Ga0207671_100139984 211
120 3300025919 Ga0207657_10119392 Ga0207657_101193922 211
121 3300025932 Ga0207690_10001605 Ga0207690_100016052 211
122 3300025949 Ga0207667_10013716 Ga0207667_100137162 211
123 3300025981 Ga0207640_10100861 Ga0207640_101008611 211
124 3300028794 Ga0307515_10000839 Ga0307515_100008399 211
125 3300028794 Ga0307515_10004603 Ga0307515_1000460311 211
126 3300033179 Ga0307507_10007373 Ga0307507_1000737310 211
127 3300041406 Ga0439439_0045338 Ga0439439_0045338_186_824 211
128 3300046454 Ga0495592_0151631 Ga0495592_0151631_121_756 211
129 3300046460 Ga0495638_0085540 Ga0495638_0085540_1024_1659 211
130 3300046460 Ga0495638_0391371 Ga0495638_0391371_33_668 211
131 3300046471 Ga0495650_0000003 Ga0495650_0000003_33947_34582 211
132 3300046471 Ga0495650_0036952 Ga0495650_0036952_487_1122 211
133 3300046471 Ga0495650_0080053 Ga0495650_0080053_293_928 211
134 3300046474 Ga0495605_0136717 Ga0495605_0136717_72_707 211
135 3300046492 Ga0495585_0000652 Ga0495585_0000652_29138_29773 211
136 3300046492 Ga0495585_0001978 Ga0495585_0001978_6669_7304 211
137 3300046506 Ga0495583_0019585 Ga0495583_0019585_1786_2421 211
138 3300046507 Ga0495606_0000143 Ga0495606_0000143_103840_104475 211
139 3300046507 Ga0495606_0025315 Ga0495606_0025315_2028_2663 211
140 3300046507 Ga0495606_0133218 Ga0495606_0133218_280_915 211
141 3300046507 Ga0495606_0204275 Ga0495606_0204275_55_690 211
142 3300046512 Ga0495610_0001797 Ga0495610_0001797_6912_7547 211
143 3300046513 Ga0495616_0003241 Ga0495616_0003241_8759_9394 211
144 3300046513 Ga0495616_0033282 Ga0495616_0033282_843_1478 211
145 3300046516 Ga0495628_0235338 Ga0495628_0235338_715_1350 211
146 3300046524 Ga0495648_0040371 Ga0495648_0040371_710_1345 211
147 3300046529 Ga0495652_0317391 Ga0495652_0317391_100_735 211
148 3300046538 Ga0495609_0013396 Ga0495609_0013396_735_1370 211
149 3300046558 Ga0495633_0000056 Ga0495633_0000056_143211_143846 211
150 3300046616 Ga0495668_0000003 Ga0495668_0000003_166799_167434 211
151 3300046616 Ga0495668_0080364 Ga0495668_0080364_14_649 211
152 3300046660 Ga0495625_0000005 Ga0495625_0000005_151147_151782 211
153 3300046660 Ga0495625_0001399 Ga0495625_0001399_27696_28331 211
154 3300046660 Ga0495625_0004452 Ga0495625_0004452_10642_11277 211
155 3300046660 Ga0495625_0026002 Ga0495625_0026002_892_1527 211
156 3300046660 Ga0495625_0203946 Ga0495625_0203946_61_696 211
157 3300046683 Ga0495658_0040795 Ga0495658_0040795_1832_2467 211
158 3300046692 Ga0495671_0115751 Ga0495671_0115751_542_1177 211
159 3300046694 Ga0495649_0000003 Ga0495649_0000003_151168_151803 211
160 3300046810 Ga0495660_0036390 Ga0495660_0036390_476_1111 211
161 3300047443 Ga0495687_000833 Ga0495687_000833_6042_6677 211
162 3300047472 Ga0495686_0000160 Ga0495686_0000160_118921_119556 211
163 3300047472 Ga0495686_0103102 Ga0495686_0103102_546_1181 211
164 3300047472 Ga0495686_0191415 Ga0495686_0191415_64_699 211
165 3300049459 Ga0495678_040461 Ga0495678_040461_387_1022 211
166 3300049514 Ga0501291_046200 Ga0501291_046200_116_751 211
167 3300049523 Ga0501300_003429 Ga0501300_003429_243_878 211
168 3300050493 nmdc:mga0k408_1831_c1 nmdc:mga0k408_1831_c1_5741_6376 211
169 3300050493 nmdc:mga0k408_22483_c1 nmdc:mga0k408_22483_c1_1442_2077 211
170 3300050493 nmdc:mga0k408_5000_c1 nmdc:mga0k408_5000_c1_865_1500 211
171 3300050493 nmdc:mga0k408_64658_c1 nmdc:mga0k408_64658_c1_1340_1975 211
172 3300053090 Ga0500646_0068438 Ga0500646_0068438_85_720 211
173 3300053093 Ga0500651_0032859 Ga0500651_0032859_215_850 211
174 3300053093 Ga0500651_0381388 Ga0500651_0381388_69_704 211
175 3300053109 Ga0500569_001268 Ga0500569_001268_3744_4379 211
176 3300053125 Ga0500618_000003 Ga0500618_000003_60810_61445 211
177 3300053137 Ga0500561_0027386 Ga0500561_0027386_83_718 211
178 3300053142 Ga0500577_0001494 Ga0500577_0001494_2839_3474 211
179 3300053151 Ga0500604_0143800 Ga0500604_0143800_145_780 211
180 3300053153 Ga0500616_0118776 Ga0500616_0118776_85_720 211
181 3300053157 Ga0500624_001687 Ga0500624_001687_682_1317 211
182 3300001979 JGI24740J21852_10003472 JGI24740J21852_100034724 212
183 3300001989 JGI24739J22299_10002091 JGI24739J22299_100020915 212
184 3300002738 JGI25154J39366_1000007 JGI25154J39366_100000782 212
185 3300003215 JGI25153J46596_10000790 JGI25153J46596_1000079015 212
186 3300003320 rootH2_10232591 rootH2_102325911 212
187 3300003354 JGI25160J50197_1004210 JGI25160J50197_10042103 212
188 3300003771 Ga0055526_1050912 Ga0055526_10509121 212
189 3300003790 Ga0055528_1000967 Ga0055528_10009673 212
190 3300003791 Ga0055530_10002107 Ga0055530_100021075 212
191 3300003794 Ga0055531_10026472 Ga0055531_100264722 212
192 3300004625 Ga0055543_1002622 Ga0055543_10026224 212
193 3300005262 Ga0065165_1000010 Ga0065165_1000010174 212
194 3300005459 Ga0068867_100396283 Ga0068867_1003962832 212
195 3300005841 Ga0068863_100550277 Ga0068863_1005502772 212
196 3300009545 Ga0105237_10777842 Ga0105237_107778421 212
197 3300009551 Ga0105238_10313563 Ga0105238_103135632 212
198 3300010375 Ga0105239_10000042 Ga0105239_1000004281 212
199 3300013308 Ga0157375_10693469 Ga0157375_106934692 212
200 3300025246 Ga0209646_1000002 Ga0209646_1000002686 212
201 3300025250 Ga0209026_1000740 Ga0209026_10007408 212
202 3300025273 Ga0209673_1000082 Ga0209673_1000082148 212
203 3300025295 Ga0209564_1005961 Ga0209564_10059616 212
204 3300025295 Ga0209564_1037317 Ga0209564_10373172 212
205 3300025297 Ga0209758_1001771 Ga0209758_100177113 212
206 3300025297 Ga0209758_1006036 Ga0209758_10060367 212
207 3300025298 Ga0209050_1001435 Ga0209050_100143517 212
208 3300025302 Ga0207426_1000850 Ga0207426_100085018 212
209 3300025302 Ga0207426_1003428 Ga0207426_10034284 212
210 3300025304 Ga0209257_1006541 Ga0209257_10065413 212
211 3300026088 Ga0207641_10530132 Ga0207641_105301322 212
212 3300044683 Ga0466965_0045232 Ga0466965_0045232_390_1031 212
213 3300047472 Ga0495686_0044089 Ga0495686_0044089_319_963 212
214 3300049823 Ga0501044_0054351 Ga0501044_0054351_2438_3076 212
215 3300053139 Ga0500568_0171616 Ga0500568_0171616_85_723 212
216 3300053156 Ga0500622_0003133 Ga0500622_0003133_9457_10104 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

54

193

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ee6-assembly1.cif.gz_A cryo-em structure of human abca7 in pe/ch nanodiscs 0.8764 2 211
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.8676 2 211
8ee6-assembly1.cif.gz_A cryo-em structure of human abca7 in pe/ch nanodiscs 0.865 2 211
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.8643 2 207
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8627 2 211
ID Description Score Start End Superfamily
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8947 2 211 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8828 2 211 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8828 2 211 3.40.50.300
af_P16679_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8697 1 202 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8675 2 211 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I4YGB3-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9821 2 210 GO:0005524
GO:0016887
AF-A0A841LED8-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9785 1 212 GO:0005524
GO:0016887
AF-A0A848GGD4-F1-model_v4 ABC transporter ATP-binding protein 0.9784 2 210 GO:0005524
GO:0016887
AF-L0G1B6-F1-model_v4 ABC-type multidrug transport system, ATPase component 0.9783 1 212 GO:0005524
GO:0016887
AF-A0A2T7BCD5-F1-model_v4 ABC transporter 0.9773 1 210 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map