F328082

General Info

Members Datasets Scaffolds Average Seq Length
216 130 432 125

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0430521|Ga0501072_0430521_316_693
Length 125
Sequence VTLVLDAGALIALDRSDRAMWVRLRAALDSGSVPVTHGGVVGQVWRGGPRQARLAAALAGIDIRPIDAPLGRTAGELLRATGTADVIDAAVALIAGDGDDVVTSDVDDLEPLLAATGRHVQILRA

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
73 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
74 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
75 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
125 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
126 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
127 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
128 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.78
Nodule 0
Rhizoplane 0.46
Rhizosphere 94.91
Stem 0
Stem Tuber 0
Unclassified 34.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0430521 3300049588 Bacteria 1045
2 Ga0070676_10178012 3300005328 Unclassified 1380
3 Ga0070690_100368733 3300005330 Unclassified 1047
4 Ga0070677_10007264 3300005333 Unclassified 3693
5 Ga0068869_100093757 3300005334 Unclassified 2262
6 Ga0068869_100637408 3300005334 Bacteria 903
7 Ga0070666_10328559 3300005335 Unclassified 1092
8 Ga0068868_100672810 3300005338 Unclassified 923
9 Ga0070689_100390259 3300005340 Bacteria 1175
10 Ga0070669_100096237 3300005353 Unclassified 2227
11 Ga0070673_100114236 3300005364 Unclassified 2243
12 Ga0070688_100007305 3300005365 Bacteria 5951
13 Ga0070688_100072598 3300005365 Unclassified 2205
14 Ga0070688_100455733 3300005365 Unclassified 957
15 Ga0070667_100385408 3300005367 Bacteria 1274
16 Ga0070705_100461346 3300005440 Bacteria 955
17 Ga0070708_101370692 3300005445 Unclassified 660
18 Ga0070662_100196155 3300005457 Unclassified 1599
19 Ga0070698_100505550 3300005471 Bacteria 1146
20 Ga0070699_101065921 3300005518 Unclassified 741
21 Ga0070672_100158973 3300005543 Unclassified 1873
22 Ga0070665_100623543 3300005548 Unclassified 1091
23 Ga0070704_100422665 3300005549 Bacteria 1142
24 Ga0070664_100941870 3300005564 Unclassified 810
25 Ga0068857_100916672 3300005577 Unclassified 841
26 Ga0068859_100819627 3300005617 Unclassified 1017
27 Ga0068866_10218605 3300005718 Bacteria 1148
28 Ga0068861_100087490 3300005719 Bacteria 2452
29 Ga0068861_100527732 3300005719 Bacteria 1072
30 Ga0068861_101401414 3300005719 Unclassified 683
31 Ga0068870_10000879 3300005840 Bacteria 11748
32 Ga0068860_100193499 3300005843 Bacteria 1969
33 Ga0068862_101112871 3300005844 Bacteria 785
34 Ga0068862_101390184 3300005844 Unclassified 705
35 Ga0081539_10042170 3300005985 Bacteria 2660
36 Ga0075432_10186974 3300006058 Bacteria 813
37 Ga0075428_100125751 3300006844 Bacteria 2790
38 Ga0075428_100203105 3300006844 Bacteria 2142
39 Ga0075428_101188113 3300006844 Bacteria 804
40 Ga0075428_101517823 3300006844 Unclassified 702
41 Ga0075433_10003487 3300006852 Bacteria 12150
42 Ga0075434_100148550 3300006871 Unclassified 2363
43 Ga0075429_100041860 3300006880 Bacteria 3988
44 Ga0075429_100059080 3300006880 Bacteria 3340
45 Ga0075429_100173474 3300006880 Bacteria 1889
46 Ga0075429_100841861 3300006880 Bacteria 803
47 Ga0075436_100023638 3300006914 Bacteria 4221
48 Ga0097620_100819619 3300006931 Unclassified 1017
49 Ga0075435_100070399 3300007076 Unclassified 2855
50 Ga0075435_100296932 3300007076 Unclassified 1381
51 Ga0111539_10479494 3300009094 Unclassified 1449
52 Ga0114129_10442378 3300009147 Bacteria 1706
53 Ga0114129_11259148 3300009147 Unclassified 919
54 Ga0105243_10819463 3300009148 Unclassified 919
55 Ga0105248_10216017 3300009177 Bacteria 2160
56 Ga0105248_10657932 3300009177 Bacteria 1182
57 Ga0105249_10003547 3300009553 Bacteria 13494
58 Ga0105249_10024106 3300009553 Bacteria 5466
59 Ga0105249_10116751 3300009553 Bacteria 2530
60 Ga0163162_10036255 3300013306 Bacteria 4914
61 Ga0163162_10177284 3300013306 Unclassified 2257
62 Ga0157375_10887595 3300013308 Unclassified 1036
63 Ga0157380_10052649 3300014326 Unclassified 3224
64 Ga0157377_10015701 3300014745 Bacteria 3881
65 Ga0157376_11502858 3300014969 Unclassified 706
66 Ga0207682_10009651 3300025893 Unclassified 3802
67 Ga0207642_10184683 3300025899 Bacteria 1139
68 Ga0207645_10179275 3300025907 Unclassified 1390
69 Ga0207643_10000875 3300025908 Bacteria 18156
70 Ga0207681_10019841 3300025923 Unclassified 4255
71 Ga0207706_10027459 3300025933 Bacteria 5088
72 Ga0207670_10262495 3300025936 Unclassified 1339
73 Ga0207691_10432992 3300025940 Unclassified 1120
74 Ga0207711_10035184 3300025941 Unclassified 4245
75 Ga0207689_10017539 3300025942 Bacteria 6053
76 Ga0207689_10583054 3300025942 Bacteria 940
77 Ga0207651_11349676 3300025960 Unclassified 641
78 Ga0207668_10214601 3300025972 Unclassified 1541
79 Ga0207668_10260093 3300025972 Bacteria 1414
80 Ga0207668_11106978 3300025972 Bacteria 710
81 Ga0207658_10339653 3300025986 Bacteria 1305
82 Ga0207648_10199230 3300026089 Unclassified 1776
83 Ga0207674_11475267 3300026116 Unclassified 649
84 Ga0207675_100148668 3300026118 Bacteria 2228
85 Ga0207428_10551241 3300027907 Bacteria 834
86 Ga0268265_10345942 3300028380 Bacteria 1356
87 Ga0268265_11011848 3300028380 Unclassified 821
88 Ga0268264_10049774 3300028381 Bacteria 3488
89 Ga0307517_10068955 3300028786 Unclassified 3212
90 Ga0265332_10008365 3300031238 Bacteria 4649
91 Ga0307508_10165449 3300031616 Unclassified 1815
92 Ga0307514_10072029 3300031649 Bacteria 2589
93 Ga0307516_10082910 3300031730 Bacteria 3048
94 Ga0373959_0065101 3300034820 Unclassified 814
95 Ga0373940_0014559 3300035088 Unclassified 1921
96 Ga0373952_0286212 3300035092 Unclassified 509
97 Ga0373939_0155377 3300035114 Unclassified 836
98 Ga0373954_0341802 3300035118 Unclassified 739
99 Ga0373943_0262741 3300035170 Bacteria 972
100 Ga0373961_0000040 3300035241 Bacteria 77856
101 Ga0373937_0744067 3300036401 Unclassified 928
102 Ga0373937_1543283 3300036401 Unclassified 611
103 Ga0466968_0037384 3300044735 Bacteria 2036
104 Ga0451576_0089443 3300045051 Bacteria 3202
105 Ga0495603_0065809 3300046455 Bacteria 2136
106 Ga0495645_0448941 3300046543 Unclassified 814
107 Ga0495658_0133642 3300046683 Bacteria 1512
108 Ga0495674_1265752 3300047319 Unclassified 555
109 Ga0496112_0541058 3300048915 Bacteria 1099
110 Ga0501031_0024257 3300049568 Bacteria 3953
111 Ga0501032_0006109 3300049569 Bacteria 8872
112 Ga0501033_0000401 3300049570 Bacteria 41669
113 Ga0501033_0811692 3300049570 Bacteria 632
114 Ga0501034_0021679 3300049571 Bacteria 6544
115 Ga0501034_0202681 3300049571 Bacteria 1941
116 Ga0501034_0230667 3300049571 Bacteria 1800
117 Ga0501034_0323569 3300049571 Unclassified 1474
118 Ga0501036_0213393 3300049572 Bacteria 1621
119 Ga0501036_0359288 3300049572 Bacteria 1216
120 Ga0501037_0006372 3300049573 Bacteria 8630
121 Ga0501037_0131998 3300049573 Bacteria 1791
122 Ga0501037_0601309 3300049573 Bacteria 738
123 Ga0501038_0003303 3300049574 Bacteria 15038
124 Ga0501038_0183643 3300049574 Bacteria 1686
125 Ga0501039_0007842 3300049575 Bacteria 8139
126 Ga0501039_0020009 3300049575 Bacteria 5130
127 Ga0501040_0046058 3300049576 Bacteria 2977
128 Ga0501040_0998074 3300049576 Unclassified 607
129 Ga0501042_0115448 3300049578 Bacteria 1933
130 Ga0501042_0140017 3300049578 Bacteria 1744
131 Ga0501042_0582957 3300049578 Bacteria 813
132 Ga0501043_0020536 3300049579 Bacteria 5181
133 Ga0501043_0053451 3300049579 Unclassified 3172
134 Ga0501043_0359848 3300049579 Unclassified 1104
135 Ga0501046_0066285 3300049580 Bacteria 2814
136 Ga0501046_0072896 3300049580 Bacteria 2665
137 Ga0501046_0153649 3300049580 Bacteria 1735
138 Ga0501046_0596223 3300049580 Bacteria 784
139 Ga0501047_0029090 3300049581 Bacteria 5328
140 Ga0501047_0109386 3300049581 Bacteria 2646
141 Ga0501047_1187469 3300049581 Unclassified 576
142 Ga0501048_0007067 3300049582 Bacteria 8527
143 Ga0501048_0176799 3300049582 Bacteria 1513
144 Ga0501048_0208716 3300049582 Unclassified 1385
145 Ga0501067_0001820 3300049583 Bacteria 11721
146 Ga0501067_0013097 3300049583 Bacteria 4590
147 Ga0501067_0015544 3300049583 Bacteria 4213
148 Ga0501067_0026530 3300049583 Bacteria 3209
149 Ga0501067_0116281 3300049583 Bacteria 1487
150 Ga0501068_0010196 3300049584 Bacteria 5273
151 Ga0501068_0023541 3300049584 Bacteria 3610
152 Ga0501068_0161432 3300049584 Unclassified 1412
153 Ga0501069_0114705 3300049585 Bacteria 1536
154 Ga0501069_0305425 3300049585 Unclassified 933
155 Ga0501070_0009596 3300049586 Bacteria 8175
156 Ga0501070_0043824 3300049586 Bacteria 3723
157 Ga0501070_0482128 3300049586 Bacteria 997
158 Ga0501071_0020525 3300049587 Unclassified 4592
159 Ga0501071_0641599 3300049587 Bacteria 817
160 Ga0501072_0056859 3300049588 Bacteria 3082
161 Ga0501072_0115177 3300049588 Bacteria 2140
162 Ga0501072_0533143 3300049588 Bacteria 928
163 Ga0501072_0603000 3300049588 Unclassified 866
164 Ga0501072_0636435 3300049588 Unclassified 840
165 Ga0501072_1592681 3300049588 Bacteria 503
166 Ga0501073_0000317 3300049589 Bacteria 32076
167 Ga0501073_0000380 3300049589 Bacteria 29988
168 Ga0501073_0020240 3300049589 Unclassified 4800
169 Ga0501073_0040280 3300049589 Bacteria 3307
170 Ga0501073_0728732 3300049589 Bacteria 684
171 Ga0501074_0018924 3300049590 Bacteria 5002
172 Ga0501074_0076147 3300049590 Bacteria 2408
173 Ga0501075_0246967 3300049591 Bacteria 1360
174 Ga0501076_0905183 3300049592 Bacteria 727
175 Ga0501076_1075986 3300049592 Unclassified 662
176 Ga0501221_014335 3300049704 Bacteria 1472
177 Ga0501079_0629316 3300049741 Bacteria 845
178 Ga0501079_1217629 3300049741 Unclassified 593
179 Ga0501080_0011229 3300049742 Bacteria 8198
180 Ga0501080_0069669 3300049742 Bacteria 3271
181 Ga0501080_0333574 3300049742 Bacteria 1371
182 Ga0501080_0907556 3300049742 Bacteria 768
183 Ga0501080_1069201 3300049742 Unclassified 697
184 Ga0501081_0177887 3300049743 Bacteria 1538
185 Ga0501081_0293027 3300049743 Bacteria 1193
186 Ga0501083_0003908 3300049744 Bacteria 10465
187 Ga0501083_0005279 3300049744 Bacteria 9137
188 Ga0501083_0654106 3300049744 Bacteria 683
189 Ga0501035_0546384 3300049822 Bacteria 949
190 Ga0501044_0011254 3300049823 Bacteria 9699
191 Ga0501044_0116713 3300049823 Bacteria 2674
192 Ga0501045_0033459 3300049824 Bacteria 3727
193 Ga0501045_0457566 3300049824 Bacteria 948
194 Ga0501045_0781439 3300049824 Unclassified 703
195 nmdc:mga09592_106666_c1 3300050508 Unclassified 2402
196 nmdc:mga09592_1256352_c1 3300050508 Bacteria 610
197 nmdc:mga09592_190949_c1 3300050508 Bacteria 1773
198 nmdc:mga09592_38122_c1 3300050508 Bacteria 4033
199 nmdc:mga08y16_48498_c1 3300050511 Unclassified 4445
200 nmdc:mga0n895_43595_c1 3300050512 Bacteria 4372
201 nmdc:mga0rr50_124634_c1 3300050513 Unclassified 2055
202 nmdc:mga0rr50_29305_c1 3300050513 Bacteria 3880
203 nmdc:mga08x19_26245_c1 3300050514 Bacteria 3634
204 nmdc:mga08x19_808681_c1 3300050514 Bacteria 666
205 nmdc:mga0a205_11554_c1 3300050515 Bacteria 8135
206 Ga0500635_0012387 3300053080 Bacteria 2448
207 Ga0500578_0065862 3300053086 Bacteria 2311
208 Ga0500578_0568145 3300053086 Bacteria 628
209 Ga0500646_0061142 3300053090 Bacteria 1109
210 Ga0500566_0004911 3300053094 Bacteria 7966
211 Ga0500603_001758 3300053150 Bacteria 4870
212 Ga0501084_0106359 3300054114 Bacteria 2357
213 Ga0501082_0031276 3300060353 Bacteria 4588
214 Ga0501082_0045495 3300060353 Bacteria 3785
215 Ga0501082_0251620 3300060353 Unclassified 1537
216 Ga0501082_0502977 3300060353 Bacteria 1059
217 Ga0501072_0430521
218 Ga0070676_10178012
219 Ga0070690_100368733
220 Ga0070677_10007264
221 Ga0068869_100093757
222 Ga0068869_100637408
223 Ga0070666_10328559
224 Ga0068868_100672810
225 Ga0070689_100390259
226 Ga0070669_100096237
227 Ga0070673_100114236
228 Ga0070688_100007305
229 Ga0070688_100072598
230 Ga0070688_100455733
231 Ga0070667_100385408
232 Ga0070705_100461346
233 Ga0070708_101370692
234 Ga0070662_100196155
235 Ga0070698_100505550
236 Ga0070699_101065921
237 Ga0070672_100158973
238 Ga0070665_100623543
239 Ga0070704_100422665
240 Ga0070664_100941870
241 Ga0068857_100916672
242 Ga0068859_100819627
243 Ga0068866_10218605
244 Ga0068861_100087490
245 Ga0068861_100527732
246 Ga0068861_101401414
247 Ga0068870_10000879
248 Ga0068860_100193499
249 Ga0068862_101112871
250 Ga0068862_101390184
251 Ga0081539_10042170
252 Ga0075432_10186974
253 Ga0075428_100125751
254 Ga0075428_100203105
255 Ga0075428_101188113
256 Ga0075428_101517823
257 Ga0075433_10003487
258 Ga0075434_100148550
259 Ga0075429_100041860
260 Ga0075429_100059080
261 Ga0075429_100173474
262 Ga0075429_100841861
263 Ga0075436_100023638
264 Ga0097620_100819619
265 Ga0075435_100070399
266 Ga0075435_100296932
267 Ga0111539_10479494
268 Ga0114129_10442378
269 Ga0114129_11259148
270 Ga0105243_10819463
271 Ga0105248_10216017
272 Ga0105248_10657932
273 Ga0105249_10003547
274 Ga0105249_10024106
275 Ga0105249_10116751
276 Ga0163162_10036255
277 Ga0163162_10177284
278 Ga0157375_10887595
279 Ga0157380_10052649
280 Ga0157377_10015701
281 Ga0157376_11502858
282 Ga0207682_10009651
283 Ga0207642_10184683
284 Ga0207645_10179275
285 Ga0207643_10000875
286 Ga0207681_10019841
287 Ga0207706_10027459
288 Ga0207670_10262495
289 Ga0207691_10432992
290 Ga0207711_10035184
291 Ga0207689_10017539
292 Ga0207689_10583054
293 Ga0207651_11349676
294 Ga0207668_10214601
295 Ga0207668_10260093
296 Ga0207668_11106978
297 Ga0207658_10339653
298 Ga0207648_10199230
299 Ga0207674_11475267
300 Ga0207675_100148668
301 Ga0207428_10551241
302 Ga0268265_10345942
303 Ga0268265_11011848
304 Ga0268264_10049774
305 Ga0307517_10068955
306 Ga0265332_10008365
307 Ga0307508_10165449
308 Ga0307514_10072029
309 Ga0307516_10082910
310 Ga0373959_0065101
311 Ga0373940_0014559
312 Ga0373952_0286212
313 Ga0373939_0155377
314 Ga0373954_0341802
315 Ga0373943_0262741
316 Ga0373961_0000040
317 Ga0373937_0744067
318 Ga0373937_1543283
319 Ga0466968_0037384
320 Ga0451576_0089443
321 Ga0495603_0065809
322 Ga0495645_0448941
323 Ga0495658_0133642
324 Ga0495674_1265752
325 Ga0496112_0541058
326 Ga0501031_0024257
327 Ga0501032_0006109
328 Ga0501033_0000401
329 Ga0501033_0811692
330 Ga0501034_0021679
331 Ga0501034_0202681
332 Ga0501034_0230667
333 Ga0501034_0323569
334 Ga0501036_0213393
335 Ga0501036_0359288
336 Ga0501037_0006372
337 Ga0501037_0131998
338 Ga0501037_0601309
339 Ga0501038_0003303
340 Ga0501038_0183643
341 Ga0501039_0007842
342 Ga0501039_0020009
343 Ga0501040_0046058
344 Ga0501040_0998074
345 Ga0501042_0115448
346 Ga0501042_0140017
347 Ga0501042_0582957
348 Ga0501043_0020536
349 Ga0501043_0053451
350 Ga0501043_0359848
351 Ga0501046_0066285
352 Ga0501046_0072896
353 Ga0501046_0153649
354 Ga0501046_0596223
355 Ga0501047_0029090
356 Ga0501047_0109386
357 Ga0501047_1187469
358 Ga0501048_0007067
359 Ga0501048_0176799
360 Ga0501048_0208716
361 Ga0501067_0001820
362 Ga0501067_0013097
363 Ga0501067_0015544
364 Ga0501067_0026530
365 Ga0501067_0116281
366 Ga0501068_0010196
367 Ga0501068_0023541
368 Ga0501068_0161432
369 Ga0501069_0114705
370 Ga0501069_0305425
371 Ga0501070_0009596
372 Ga0501070_0043824
373 Ga0501070_0482128
374 Ga0501071_0020525
375 Ga0501071_0641599
376 Ga0501072_0056859
377 Ga0501072_0115177
378 Ga0501072_0533143
379 Ga0501072_0603000
380 Ga0501072_0636435
381 Ga0501072_1592681
382 Ga0501073_0000317
383 Ga0501073_0000380
384 Ga0501073_0020240
385 Ga0501073_0040280
386 Ga0501073_0728732
387 Ga0501074_0018924
388 Ga0501074_0076147
389 Ga0501075_0246967
390 Ga0501076_0905183
391 Ga0501076_1075986
392 Ga0501221_014335
393 Ga0501079_0629316
394 Ga0501079_1217629
395 Ga0501080_0011229
396 Ga0501080_0069669
397 Ga0501080_0333574
398 Ga0501080_0907556
399 Ga0501080_1069201
400 Ga0501081_0177887
401 Ga0501081_0293027
402 Ga0501083_0003908
403 Ga0501083_0005279
404 Ga0501083_0654106
405 Ga0501035_0546384
406 Ga0501044_0011254
407 Ga0501044_0116713
408 Ga0501045_0033459
409 Ga0501045_0457566
410 Ga0501045_0781439
411 nmdc:mga09592_106666_c1
412 nmdc:mga09592_1256352_c1
413 nmdc:mga09592_190949_c1
414 nmdc:mga09592_38122_c1
415 nmdc:mga08y16_48498_c1
416 nmdc:mga0n895_43595_c1
417 nmdc:mga0rr50_124634_c1
418 nmdc:mga0rr50_29305_c1
419 nmdc:mga08x19_26245_c1
420 nmdc:mga08x19_808681_c1
421 nmdc:mga0a205_11554_c1
422 Ga0500635_0012387
423 Ga0500578_0065862
424 Ga0500578_0568145
425 Ga0500646_0061142
426 Ga0500566_0004911
427 Ga0500603_001758
428 Ga0501084_0106359
429 Ga0501082_0031276
430 Ga0501082_0045495
431 Ga0501082_0251620
432 Ga0501082_0502977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v96-assembly1.cif.gz_A crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii ot3 0.7226 2 125
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.7173 1 123
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.7165 1 123
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.7157 1 123
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.7111 1 123
ID Description Score Start End Superfamily
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.789 1 111 3.40.50.1010
af_O50411_2_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7436 1 118 3.40.50.1010
af_Q58521_1_93_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7326 1 96 3.40.50.1010
af_P95007_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7284 3 122 3.40.50.1010
af_P9WF89_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7272 1 95 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7V9V799-F1-model_v4 Twitching motility protein PilT 0.9806 1 126
AF-A0A7K2B1K7-F1-model_v4 Twitching motility protein PilT 0.9795 1 126
AF-A0A838I2K7-F1-model_v4 Twitching motility protein PilT 0.9768 1 126
AF-A0A7W0LR36-F1-model_v4 PIN domain nuclease 0.9764 1 126
AF-A0A7V9V799-F1-model_v4 Twitching motility protein PilT 0.9729 1 126

Map