F327988
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 216 | 153 | 215 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300047321|Ga0495676_0064727|Ga0495676_0064727_605_1498 |
| Length | 297 |
| Sequence | MPREEVLDFLQKYVTRYRGKGFRLKDFDPGDTCGLQIEKAEAADLLQAGTAWLAEEQDMLYAQDRWSLLLVFQAMDAAGKDGTINHVMSGVNPQGCQVFSFKQPSLEEIGHDFMWRYARRLPERGRIGIFNRSYYEEVLVVRVHPEFLQRQKLPQPLVTKRIWDERLADIAHFESYAARQGTKILKFFLYVSRKEQKKRFMERLEEPEKNWKFSPSDVKERKFWHEYMHAFEEAISATASKQAPWFIVPADNKWFSRLLVAAATVEALVSLDLAYPKVDAAKKKELAAARMALSRER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 101 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 102 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 104 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 106 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 112 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 117 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 118 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 119 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 129 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 130 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 131 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 132 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 133 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 134 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 135 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 145 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 146 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0 |
| Isolates | 0.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.39 |
| Nodule | 0 |
| Rhizoplane | 4.63 |
| Rhizosphere | 92.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10218421 | 3300005290 | Bacteria | 1049 |
| 2 | Ga0070666_10038891 | 3300005335 | Bacteria | 3167 |
| 3 | Ga0070680_100030065 | 3300005336 | Bacteria | 4363 |
| 4 | Ga0068868_100010638 | 3300005338 | Bacteria | 6668 |
| 5 | Ga0068868_100023482 | 3300005338 | Bacteria | 4668 |
| 6 | Ga0070687_100032576 | 3300005343 | Bacteria | 2565 |
| 7 | Ga0070669_100142904 | 3300005353 | Bacteria | 1846 |
| 8 | Ga0070671_100046589 | 3300005355 | Bacteria | 3606 |
| 9 | Ga0070673_100044919 | 3300005364 | Bacteria | 3423 |
| 10 | Ga0070709_10062717 | 3300005434 | Bacteria | 2371 |
| 11 | Ga0070709_10292744 | 3300005434 | Bacteria | 1187 |
| 12 | Ga0070714_100201996 | 3300005435 | Bacteria | 1819 |
| 13 | Ga0070713_100211975 | 3300005436 | Bacteria | 1754 |
| 14 | Ga0070713_100397992 | 3300005436 | Bacteria | 1286 |
| 15 | Ga0070710_10062148 | 3300005437 | Bacteria | 2129 |
| 16 | Ga0070708_100002514 | 3300005445 | Bacteria | 14148 |
| 17 | Ga0070708_100104104 | 3300005445 | Bacteria | 2602 |
| 18 | Ga0070678_100031668 | 3300005456 | Bacteria | 3652 |
| 19 | Ga0070678_100046888 | 3300005456 | Bacteria | 3102 |
| 20 | Ga0070662_100025884 | 3300005457 | Bacteria | 4056 |
| 21 | Ga0070681_10035570 | 3300005458 | Bacteria | 5004 |
| 22 | Ga0070681_10117316 | 3300005458 | Bacteria | 2598 |
| 23 | Ga0068867_100053071 | 3300005459 | Bacteria | 2993 |
| 24 | Ga0068867_100495492 | 3300005459 | Bacteria | 1049 |
| 25 | Ga0070679_100102818 | 3300005530 | Bacteria | 2843 |
| 26 | Ga0070686_100012324 | 3300005544 | Bacteria | 4866 |
| 27 | Ga0070693_100035201 | 3300005547 | Bacteria | 2775 |
| 28 | Ga0070665_100216715 | 3300005548 | Bacteria | 1915 |
| 29 | Ga0068855_100001626 | 3300005563 | Bacteria | 28175 |
| 30 | Ga0068854_100017931 | 3300005578 | Bacteria | 4745 |
| 31 | Ga0068856_100000407 | 3300005614 | Bacteria | 47326 |
| 32 | Ga0068856_100149503 | 3300005614 | Bacteria | 2344 |
| 33 | Ga0068856_100176099 | 3300005614 | Bacteria | 2151 |
| 34 | Ga0068852_100029113 | 3300005616 | Bacteria | 4531 |
| 35 | Ga0068852_100306348 | 3300005616 | Bacteria | 1539 |
| 36 | Ga0068864_100202070 | 3300005618 | Bacteria | 1826 |
| 37 | Ga0068861_100004502 | 3300005719 | Bacteria | 9356 |
| 38 | Ga0068861_100331776 | 3300005719 | Bacteria | 1328 |
| 39 | Ga0068858_100166380 | 3300005842 | Bacteria | 2078 |
| 40 | Ga0068862_100091632 | 3300005844 | Bacteria | 2648 |
| 41 | Ga0070717_10002721 | 3300006028 | Bacteria | 12481 |
| 42 | Ga0075365_10147611 | 3300006038 | Bacteria | 1635 |
| 43 | Ga0070716_100000623 | 3300006173 | Bacteria | 14996 |
| 44 | Ga0070716_100040600 | 3300006173 | Bacteria | 2589 |
| 45 | Ga0070712_100044796 | 3300006175 | Bacteria | 3052 |
| 46 | Ga0097621_100004216 | 3300006237 | Bacteria | 9981 |
| 47 | Ga0097621_100017628 | 3300006237 | Bacteria | 5428 |
| 48 | Ga0097621_100109193 | 3300006237 | Bacteria | 2337 |
| 49 | Ga0068871_100002036 | 3300006358 | Bacteria | 13700 |
| 50 | Ga0068871_100005149 | 3300006358 | Bacteria | 9141 |
| 51 | Ga0068871_100035951 | 3300006358 | Bacteria | 3940 |
| 52 | Ga0068871_100041283 | 3300006358 | Bacteria | 3698 |
| 53 | Ga0075428_100036923 | 3300006844 | Bacteria | 5380 |
| 54 | Ga0075430_100029381 | 3300006846 | Bacteria | 4665 |
| 55 | Ga0075431_100101160 | 3300006847 | Bacteria | 2974 |
| 56 | Ga0075434_100013927 | 3300006871 | Bacteria | 7673 |
| 57 | Ga0068865_100210624 | 3300006881 | Bacteria | 1514 |
| 58 | Ga0075436_100069624 | 3300006914 | Bacteria | 2431 |
| 59 | Ga0075436_100100476 | 3300006914 | Bacteria | 2014 |
| 60 | Ga0075436_100115138 | 3300006914 | Bacteria | 1878 |
| 61 | Ga0105240_10006332 | 3300009093 | Bacteria | 17424 |
| 62 | Ga0105240_10014979 | 3300009093 | Bacteria | 10564 |
| 63 | Ga0105245_10018039 | 3300009098 | Bacteria | 6165 |
| 64 | Ga0114129_10008840 | 3300009147 | Bacteria | 14374 |
| 65 | Ga0105241_10003333 | 3300009174 | Bacteria | 11954 |
| 66 | Ga0105241_10119242 | 3300009174 | Bacteria | 2122 |
| 67 | Ga0105242_10036991 | 3300009176 | Bacteria | 3919 |
| 68 | Ga0105242_10347761 | 3300009176 | Bacteria | 1368 |
| 69 | Ga0105242_10432599 | 3300009176 | Bacteria | 1236 |
| 70 | Ga0105237_10006623 | 3300009545 | Bacteria | 12800 |
| 71 | Ga0105238_10266813 | 3300009551 | Bacteria | 1692 |
| 72 | Ga0105239_10338055 | 3300010375 | Bacteria | 1699 |
| 73 | Ga0105246_10120630 | 3300011119 | Bacteria | 1942 |
| 74 | Ga0157373_10024946 | 3300013100 | Bacteria | 4329 |
| 75 | Ga0157373_10031011 | 3300013100 | Bacteria | 3847 |
| 76 | Ga0157371_10076858 | 3300013102 | Bacteria | 2364 |
| 77 | Ga0157370_10041616 | 3300013104 | Bacteria | 4430 |
| 78 | Ga0157369_10611688 | 3300013105 | Bacteria | 1124 |
| 79 | Ga0157374_10000667 | 3300013296 | Bacteria | 30210 |
| 80 | Ga0157374_10003607 | 3300013296 | Bacteria | 13033 |
| 81 | Ga0157374_10049177 | 3300013296 | Bacteria | 3916 |
| 82 | Ga0157378_10000320 | 3300013297 | Bacteria | 47177 |
| 83 | Ga0157378_10173671 | 3300013297 | Bacteria | 2023 |
| 84 | Ga0163162_10039081 | 3300013306 | Bacteria | 4739 |
| 85 | Ga0157372_10002868 | 3300013307 | Bacteria | 18639 |
| 86 | Ga0157372_10007412 | 3300013307 | Bacteria | 11668 |
| 87 | Ga0157372_10022631 | 3300013307 | Bacteria | 6803 |
| 88 | Ga0157372_10026648 | 3300013307 | Bacteria | 6290 |
| 89 | Ga0157375_10093053 | 3300013308 | Bacteria | 3080 |
| 90 | Ga0163163_10002237 | 3300014325 | Bacteria | 16294 |
| 91 | Ga0163163_10002948 | 3300014325 | Bacteria | 14392 |
| 92 | Ga0157376_10009071 | 3300014969 | Bacteria | 7206 |
| 93 | Ga0157376_10262891 | 3300014969 | Bacteria | 1618 |
| 94 | Ga0207692_10113025 | 3300025898 | Bacteria | 1509 |
| 95 | Ga0207680_10043976 | 3300025903 | Bacteria | 2623 |
| 96 | Ga0207699_10085660 | 3300025906 | Bacteria | 1966 |
| 97 | Ga0207645_10004653 | 3300025907 | Bacteria | 10108 |
| 98 | Ga0207654_10011663 | 3300025911 | Bacteria | 4486 |
| 99 | Ga0207707_10055823 | 3300025912 | Bacteria | 3435 |
| 100 | Ga0207707_10063646 | 3300025912 | Bacteria | 3210 |
| 101 | Ga0207695_10007251 | 3300025913 | Bacteria | 14160 |
| 102 | Ga0207695_10015998 | 3300025913 | Bacteria | 8806 |
| 103 | Ga0207671_10040842 | 3300025914 | Bacteria | 3433 |
| 104 | Ga0207693_10036793 | 3300025915 | Bacteria | 3859 |
| 105 | Ga0207693_10059519 | 3300025915 | Bacteria | 2992 |
| 106 | Ga0207663_10113538 | 3300025916 | Bacteria | 1842 |
| 107 | Ga0207652_10080783 | 3300025921 | Bacteria | 2843 |
| 108 | Ga0207681_10131106 | 3300025923 | Bacteria | 1853 |
| 109 | Ga0207687_10005876 | 3300025927 | Bacteria | 8114 |
| 110 | Ga0207687_10008360 | 3300025927 | Bacteria | 6771 |
| 111 | Ga0207700_10190633 | 3300025928 | Bacteria | 1722 |
| 112 | Ga0207700_10245887 | 3300025928 | Bacteria | 1526 |
| 113 | Ga0207664_10100884 | 3300025929 | Bacteria | 2384 |
| 114 | Ga0207706_10011295 | 3300025933 | Bacteria | 8140 |
| 115 | Ga0207686_10038864 | 3300025934 | Bacteria | 2883 |
| 116 | Ga0207670_10080807 | 3300025936 | Bacteria | 2273 |
| 117 | Ga0207704_10209924 | 3300025938 | Bacteria | 1432 |
| 118 | Ga0207704_10274577 | 3300025938 | Bacteria | 1278 |
| 119 | Ga0207665_10000225 | 3300025939 | Bacteria | 38534 |
| 120 | Ga0207665_10524695 | 3300025939 | Bacteria | 917 |
| 121 | Ga0207711_10018187 | 3300025941 | Bacteria | 5843 |
| 122 | Ga0207711_10038196 | 3300025941 | Bacteria | 4081 |
| 123 | Ga0207711_10047913 | 3300025941 | Bacteria | 3655 |
| 124 | Ga0207667_10010262 | 3300025949 | Bacteria | 10961 |
| 125 | Ga0207667_10019886 | 3300025949 | Bacteria | 7481 |
| 126 | Ga0207667_10585706 | 3300025949 | Bacteria | 1126 |
| 127 | Ga0207712_10312784 | 3300025961 | Bacteria | 1293 |
| 128 | Ga0207668_10007298 | 3300025972 | Bacteria | 6565 |
| 129 | Ga0207640_10056162 | 3300025981 | Unclassified | 2582 |
| 130 | Ga0207677_10040348 | 3300026023 | Bacteria | 3077 |
| 131 | Ga0207677_10051591 | 3300026023 | Bacteria | 2790 |
| 132 | Ga0207677_10127726 | 3300026023 | Unclassified | 1924 |
| 133 | Ga0207703_10044548 | 3300026035 | Bacteria | 3567 |
| 134 | Ga0207703_10157779 | 3300026035 | Bacteria | 1985 |
| 135 | Ga0207702_10004430 | 3300026078 | Bacteria | 12479 |
| 136 | Ga0207702_10018888 | 3300026078 | Bacteria | 5702 |
| 137 | Ga0207641_10006333 | 3300026088 | Bacteria | 9998 |
| 138 | Ga0207641_10019056 | 3300026088 | Bacteria | 5628 |
| 139 | Ga0207648_10010610 | 3300026089 | Bacteria | 8711 |
| 140 | Ga0207648_10102464 | 3300026089 | Bacteria | 2509 |
| 141 | Ga0207676_10033544 | 3300026095 | Bacteria | 3880 |
| 142 | Ga0207676_10200897 | 3300026095 | Bacteria | 1761 |
| 143 | Ga0207676_10552145 | 3300026095 | Bacteria | 1100 |
| 144 | Ga0207674_10204567 | 3300026116 | Bacteria | 1923 |
| 145 | Ga0207675_100009200 | 3300026118 | Bacteria | 9265 |
| 146 | Ga0207675_100043462 | 3300026118 | Bacteria | 4196 |
| 147 | Ga0207683_10285623 | 3300026121 | Bacteria | 1508 |
| 148 | Ga0207683_10341449 | 3300026121 | Bacteria | 1373 |
| 149 | Ga0207698_10293164 | 3300026142 | Bacteria | 1511 |
| 150 | Ga0209971_1009886 | 3300027682 | Bacteria | 2257 |
| 151 | Ga0268265_10008686 | 3300028380 | Bacteria | 6868 |
| 152 | Ga0265319_1000240 | 3300028563 | Bacteria | 41199 |
| 153 | Ga0265318_10000200 | 3300028577 | Bacteria | 52170 |
| 154 | Ga0265338_10096721 | 3300028800 | Bacteria | 2421 |
| 155 | Ga0265325_10115856 | 3300031241 | Bacteria | 1297 |
| 156 | Ga0265329_10000171 | 3300031242 | Bacteria | 32652 |
| 157 | Ga0265340_10003289 | 3300031247 | Bacteria | 9156 |
| 158 | Ga0265339_10001025 | 3300031249 | Bacteria | 21308 |
| 159 | Ga0265339_10003746 | 3300031249 | Bacteria | 10603 |
| 160 | Ga0265331_10000021 | 3300031250 | Bacteria | 242632 |
| 161 | Ga0265316_10033699 | 3300031344 | Bacteria | 4168 |
| 162 | Ga0265316_10051806 | 3300031344 | Bacteria | 3223 |
| 163 | Ga0265313_10001348 | 3300031595 | Bacteria | 23135 |
| 164 | Ga0265342_10000332 | 3300031712 | Bacteria | 52842 |
| 165 | Ga0373954_0139372 | 3300035118 | Bacteria | 1183 |
| 166 | Ga0373931_0023727 | 3300035691 | Bacteria | 3099 |
| 167 | Ga0373927_0130156 | 3300035695 | Bacteria | 1644 |
| 168 | Ga0373937_0052092 | 3300036401 | Unclassified | 3752 |
| 169 | Ga0373937_0077673 | 3300036401 | Bacteria | 3068 |
| 170 | Ga0373937_0545423 | 3300036401 | Bacteria | 1101 |
| 171 | Ga0436365_1277623 | 3300039437 | Bacteria | 1706 |
| 172 | Ga0436365_1519987 | 3300039437 | Bacteria | 1842 |
| 173 | Ga0439441_014984 | 3300042001 | Bacteria | 1366 |
| 174 | Ga0453684_0420403 | 3300044712 | Bacteria | 1493 |
| 175 | Ga0451576_0155330 | 3300045051 | Unclassified | 2387 |
| 176 | Ga0495594_0006815 | 3300046499 | Bacteria | 5870 |
| 177 | Ga0495608_0146696 | 3300046511 | Bacteria | 1505 |
| 178 | Ga0495640_0102714 | 3300046533 | Bacteria | 1875 |
| 179 | Ga0495586_0081707 | 3300046535 | Bacteria | 1776 |
| 180 | Ga0495667_0021530 | 3300046559 | Bacteria | 4351 |
| 181 | Ga0495669_0045455 | 3300046684 | Unclassified | 1958 |
| 182 | Ga0495604_0126517 | 3300047317 | Bacteria | 1842 |
| 183 | Ga0495672_0000569 | 3300047320 | Bacteria | 41729 |
| 184 | Ga0495676_0064727 | 3300047321 | Bacteria | 2841 |
| 185 | Ga0496103_0064646 | 3300048906 | Bacteria | 2281 |
| 186 | Ga0496104_0047882 | 3300048907 | Bacteria | 4030 |
| 187 | Ga0496104_0096755 | 3300048907 | Bacteria | 2824 |
| 188 | Ga0496105_0005780 | 3300048908 | Bacteria | 9432 |
| 189 | Ga0496110_0024095 | 3300048913 | Bacteria | 5185 |
| 190 | Ga0496111_0010239 | 3300048914 | Bacteria | 6281 |
| 191 | Ga0496112_0066874 | 3300048915 | Bacteria | 3546 |
| 192 | Ga0496112_0123607 | 3300048915 | Unclassified | 2559 |
| 193 | Ga0496112_0145366 | 3300048915 | Bacteria | 2339 |
| 194 | Ga0496113_0086663 | 3300048916 | Bacteria | 2406 |
| 195 | Ga0501039_0197685 | 3300049575 | Bacteria | 1581 |
| 196 | Ga0501074_0170985 | 3300049590 | Bacteria | 1551 |
| 197 | Ga0501076_0003153 | 3300049592 | Bacteria | 11497 |
| 198 | Ga0501077_0099224 | 3300049593 | Bacteria | 1846 |
| 199 | Ga0501079_0116907 | 3300049741 | Bacteria | 2073 |
| 200 | Ga0501080_0015118 | 3300049742 | Bacteria | 7113 |
| 201 | Ga0501080_0105240 | 3300049742 | Bacteria | 2616 |
| 202 | Ga0501081_0162231 | 3300049743 | Bacteria | 1611 |
| 203 | Ga0501083_0062003 | 3300049744 | Bacteria | 2496 |
| 204 | Ga0501045_0003463 | 3300049824 | Bacteria | 10802 |
| 205 | nmdc:mga0yw44_207922_c1 | 3300050492 | Bacteria | 1294 |
| 206 | nmdc:mga0k408_204422_c1 | 3300050493 | Bacteria | 1179 |
| 207 | nmdc:mga05p37_4948_c2 | 3300050507 | Bacteria | 9042 |
| 208 | nmdc:mga05p37_723921_c1 | 3300050507 | Bacteria | 1101 |
| 209 | nmdc:mga06r32_101017_c1 | 3300050510 | Bacteria | 2830 |
| 210 | nmdc:mga0n895_7542_c1 | 3300050512 | Bacteria | 9349 |
| 211 | nmdc:mga0rr50_17662_c1 | 3300050513 | Bacteria | 4768 |
| 212 | nmdc:mga08x19_83165_c1 | 3300050514 | Bacteria | 2104 |
| 213 | Ga0501084_0060485 | 3300054114 | Bacteria | 3171 |
| 214 | Ga0501082_0041140 | 3300060353 | Bacteria | 3985 |
| 215 | Ga0530510_0014979 | 3300061734 | Bacteria | 5476 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014325 | Ga0163163_10002237 | Ga0163163_1000223713 | 268 |
| 2 | 3300048915 | Ga0496112_0066874 | Ga0496112_0066874_2340_3155 | 268 |
| 3 | 3300049575 | Ga0501039_0197685 | Ga0501039_0197685_321_1223 | 279 |
| 4 | 3300045051 | Ga0451576_0155330 | Ga0451576_0155330_1141_2115 | 283 |
| 5 | iso_pu_bacteria | 2929199973 | 2929201341 | 288 |
| 6 | 3300044712 | Ga0453684_0420403 | Ga0453684_0420403_313_1218 | 289 |
| 7 | 3300006038 | Ga0075365_10147611 | Ga0075365_101476112 | 290 |
| 8 | 3300025915 | Ga0207693_10036793 | Ga0207693_100367934 | 290 |
| 9 | 3300050492 | nmdc:mga0yw44_207922_c1 | nmdc:mga0yw44_207922_c1_154_1029 | 290 |
| 10 | 3300005435 | Ga0070714_100201996 | Ga0070714_1002019961 | 291 |
| 11 | 3300005459 | Ga0068867_100495492 | Ga0068867_1004954921 | 291 |
| 12 | 3300005544 | Ga0070686_100012324 | Ga0070686_1000123243 | 291 |
| 13 | 3300005842 | Ga0068858_100166380 | Ga0068858_1001663802 | 291 |
| 14 | 3300006237 | Ga0097621_100017628 | Ga0097621_1000176288 | 291 |
| 15 | 3300006358 | Ga0068871_100041283 | Ga0068871_1000412833 | 291 |
| 16 | 3300006914 | Ga0075436_100115138 | Ga0075436_1001151382 | 291 |
| 17 | 3300009098 | Ga0105245_10018039 | Ga0105245_100180395 | 291 |
| 18 | 3300009176 | Ga0105242_10347761 | Ga0105242_103477612 | 291 |
| 19 | 3300010375 | Ga0105239_10338055 | Ga0105239_103380553 | 291 |
| 20 | 3300011119 | Ga0105246_10120630 | Ga0105246_101206302 | 291 |
| 21 | 3300025927 | Ga0207687_10005876 | Ga0207687_100058767 | 291 |
| 22 | 3300025929 | Ga0207664_10100884 | Ga0207664_101008841 | 291 |
| 23 | 3300025939 | Ga0207665_10524695 | Ga0207665_105246951 | 291 |
| 24 | 3300025941 | Ga0207711_10047913 | Ga0207711_100479133 | 291 |
| 25 | 3300025949 | Ga0207667_10585706 | Ga0207667_105857062 | 291 |
| 26 | 3300026023 | Ga0207677_10051591 | Ga0207677_100515913 | 291 |
| 27 | 3300026035 | Ga0207703_10157779 | Ga0207703_101577792 | 291 |
| 28 | 3300026095 | Ga0207676_10200897 | Ga0207676_102008971 | 291 |
| 29 | 3300031344 | Ga0265316_10051806 | Ga0265316_100518063 | 291 |
| 30 | 3300005434 | Ga0070709_10292744 | Ga0070709_102927441 | 292 |
| 31 | 3300005436 | Ga0070713_100397992 | Ga0070713_1003979921 | 292 |
| 32 | 3300005445 | Ga0070708_100104104 | Ga0070708_1001041042 | 292 |
| 33 | 3300009093 | Ga0105240_10014979 | Ga0105240_100149793 | 292 |
| 34 | 3300013307 | Ga0157372_10007412 | Ga0157372_100074123 | 292 |
| 35 | 3300025906 | Ga0207699_10085660 | Ga0207699_100856601 | 292 |
| 36 | 3300025913 | Ga0207695_10007251 | Ga0207695_1000725112 | 292 |
| 37 | 3300025928 | Ga0207700_10245887 | Ga0207700_102458872 | 292 |
| 38 | 3300028563 | Ga0265319_1000240 | Ga0265319_10002407 | 292 |
| 39 | 3300028577 | Ga0265318_10000200 | Ga0265318_100002002 | 292 |
| 40 | 3300028800 | Ga0265338_10096721 | Ga0265338_100967212 | 292 |
| 41 | 3300031241 | Ga0265325_10115856 | Ga0265325_101158561 | 292 |
| 42 | 3300031242 | Ga0265329_10000171 | Ga0265329_100001715 | 292 |
| 43 | 3300031247 | Ga0265340_10003289 | Ga0265340_100032895 | 292 |
| 44 | 3300031249 | Ga0265339_10003746 | Ga0265339_100037464 | 292 |
| 45 | 3300031250 | Ga0265331_10000021 | Ga0265331_1000002147 | 292 |
| 46 | 3300031344 | Ga0265316_10033699 | Ga0265316_100336992 | 292 |
| 47 | 3300031595 | Ga0265313_10001348 | Ga0265313_1000134810 | 292 |
| 48 | 3300031712 | Ga0265342_10000332 | Ga0265342_1000033250 | 292 |
| 49 | 3300036401 | Ga0373937_0052092 | Ga0373937_0052092_1473_2351 | 292 |
| 50 | 3300005338 | Ga0068868_100023482 | Ga0068868_1000234822 | 293 |
| 51 | 3300005343 | Ga0070687_100032576 | Ga0070687_1000325762 | 293 |
| 52 | 3300005355 | Ga0070671_100046589 | Ga0070671_1000465892 | 293 |
| 53 | 3300005364 | Ga0070673_100044919 | Ga0070673_1000449194 | 293 |
| 54 | 3300005434 | Ga0070709_10062717 | Ga0070709_100627172 | 293 |
| 55 | 3300005436 | Ga0070713_100211975 | Ga0070713_1002119751 | 293 |
| 56 | 3300005437 | Ga0070710_10062148 | Ga0070710_100621482 | 293 |
| 57 | 3300005445 | Ga0070708_100002514 | Ga0070708_10000251412 | 293 |
| 58 | 3300005456 | Ga0070678_100031668 | Ga0070678_1000316682 | 293 |
| 59 | 3300005458 | Ga0070681_10117316 | Ga0070681_101173163 | 293 |
| 60 | 3300005547 | Ga0070693_100035201 | Ga0070693_1000352012 | 293 |
| 61 | 3300005563 | Ga0068855_100001626 | Ga0068855_10000162625 | 293 |
| 62 | 3300005614 | Ga0068856_100000407 | Ga0068856_10000040745 | 293 |
| 63 | 3300005614 | Ga0068856_100176099 | Ga0068856_1001760992 | 293 |
| 64 | 3300005616 | Ga0068852_100306348 | Ga0068852_1003063482 | 293 |
| 65 | 3300005618 | Ga0068864_100202070 | Ga0068864_1002020701 | 293 |
| 66 | 3300006028 | Ga0070717_10002721 | Ga0070717_100027215 | 293 |
| 67 | 3300006173 | Ga0070716_100000623 | Ga0070716_10000062312 | 293 |
| 68 | 3300006175 | Ga0070712_100044796 | Ga0070712_1000447962 | 293 |
| 69 | 3300006237 | Ga0097621_100004216 | Ga0097621_1000042166 | 293 |
| 70 | 3300006237 | Ga0097621_100109193 | Ga0097621_1001091932 | 293 |
| 71 | 3300006358 | Ga0068871_100002036 | Ga0068871_1000020364 | 293 |
| 72 | 3300006358 | Ga0068871_100035951 | Ga0068871_1000359512 | 293 |
| 73 | 3300006914 | Ga0075436_100069624 | Ga0075436_1000696242 | 293 |
| 74 | 3300009174 | Ga0105241_10003333 | Ga0105241_100033339 | 293 |
| 75 | 3300009174 | Ga0105241_10119242 | Ga0105241_101192421 | 293 |
| 76 | 3300009545 | Ga0105237_10006623 | Ga0105237_100066238 | 293 |
| 77 | 3300009551 | Ga0105238_10266813 | Ga0105238_102668132 | 293 |
| 78 | 3300013100 | Ga0157373_10024946 | Ga0157373_100249463 | 293 |
| 79 | 3300013100 | Ga0157373_10031011 | Ga0157373_100310111 | 293 |
| 80 | 3300013102 | Ga0157371_10076858 | Ga0157371_100768582 | 293 |
| 81 | 3300013104 | Ga0157370_10041616 | Ga0157370_100416162 | 293 |
| 82 | 3300013105 | Ga0157369_10611688 | Ga0157369_106116881 | 293 |
| 83 | 3300013296 | Ga0157374_10000667 | Ga0157374_1000066730 | 293 |
| 84 | 3300013296 | Ga0157374_10049177 | Ga0157374_100491772 | 293 |
| 85 | 3300013297 | Ga0157378_10000320 | Ga0157378_1000032045 | 293 |
| 86 | 3300013307 | Ga0157372_10002868 | Ga0157372_1000286810 | 293 |
| 87 | 3300013307 | Ga0157372_10022631 | Ga0157372_100226314 | 293 |
| 88 | 3300013307 | Ga0157372_10026648 | Ga0157372_100266483 | 293 |
| 89 | 3300014969 | Ga0157376_10262891 | Ga0157376_102628911 | 293 |
| 90 | 3300025898 | Ga0207692_10113025 | Ga0207692_101130252 | 293 |
| 91 | 3300025911 | Ga0207654_10011663 | Ga0207654_100116633 | 293 |
| 92 | 3300025912 | Ga0207707_10063646 | Ga0207707_100636463 | 293 |
| 93 | 3300025915 | Ga0207693_10059519 | Ga0207693_100595192 | 293 |
| 94 | 3300025916 | Ga0207663_10113538 | Ga0207663_101135382 | 293 |
| 95 | 3300025921 | Ga0207652_10080783 | Ga0207652_100807833 | 293 |
| 96 | 3300025928 | Ga0207700_10190633 | Ga0207700_101906332 | 293 |
| 97 | 3300025938 | Ga0207704_10274577 | Ga0207704_102745772 | 293 |
| 98 | 3300025939 | Ga0207665_10000225 | Ga0207665_1000022510 | 293 |
| 99 | 3300025941 | Ga0207711_10038196 | Ga0207711_100381963 | 293 |
| 100 | 3300025949 | Ga0207667_10019886 | Ga0207667_100198862 | 293 |
| 101 | 3300025981 | Ga0207640_10056162 | Ga0207640_100561623 | 293 |
| 102 | 3300026023 | Ga0207677_10040348 | Ga0207677_100403483 | 293 |
| 103 | 3300026023 | Ga0207677_10127726 | Ga0207677_101277262 | 293 |
| 104 | 3300026035 | Ga0207703_10044548 | Ga0207703_100445482 | 293 |
| 105 | 3300026078 | Ga0207702_10004430 | Ga0207702_100044304 | 293 |
| 106 | 3300026078 | Ga0207702_10018888 | Ga0207702_100188884 | 293 |
| 107 | 3300026088 | Ga0207641_10006333 | Ga0207641_100063332 | 293 |
| 108 | 3300026095 | Ga0207676_10552145 | Ga0207676_105521451 | 293 |
| 109 | 3300026121 | Ga0207683_10285623 | Ga0207683_102856231 | 293 |
| 110 | 3300026142 | Ga0207698_10293164 | Ga0207698_102931642 | 293 |
| 111 | 3300047317 | Ga0495604_0126517 | Ga0495604_0126517_911_1792 | 293 |
| 112 | 3300048915 | Ga0496112_0145366 | Ga0496112_0145366_347_1228 | 293 |
| 113 | 3300050514 | nmdc:mga08x19_83165_c1 | nmdc:mga08x19_83165_c1_169_1050 | 293 |
| 114 | 3300005335 | Ga0070666_10038891 | Ga0070666_100388912 | 294 |
| 115 | 3300005338 | Ga0068868_100010638 | Ga0068868_1000106385 | 294 |
| 116 | 3300005456 | Ga0070678_100046888 | Ga0070678_1000468883 | 294 |
| 117 | 3300005457 | Ga0070662_100025884 | Ga0070662_1000258844 | 294 |
| 118 | 3300005459 | Ga0068867_100053071 | Ga0068867_1000530712 | 294 |
| 119 | 3300005548 | Ga0070665_100216715 | Ga0070665_1002167152 | 294 |
| 120 | 3300005578 | Ga0068854_100017931 | Ga0068854_1000179313 | 294 |
| 121 | 3300005614 | Ga0068856_100149503 | Ga0068856_1001495032 | 294 |
| 122 | 3300005616 | Ga0068852_100029113 | Ga0068852_1000291134 | 294 |
| 123 | 3300005719 | Ga0068861_100331776 | Ga0068861_1003317762 | 294 |
| 124 | 3300005844 | Ga0068862_100091632 | Ga0068862_1000916322 | 294 |
| 125 | 3300006358 | Ga0068871_100005149 | Ga0068871_1000051495 | 294 |
| 126 | 3300006844 | Ga0075428_100036923 | Ga0075428_1000369233 | 294 |
| 127 | 3300006846 | Ga0075430_100029381 | Ga0075430_1000293814 | 294 |
| 128 | 3300006847 | Ga0075431_100101160 | Ga0075431_1001011602 | 294 |
| 129 | 3300006871 | Ga0075434_100013927 | Ga0075434_1000139272 | 294 |
| 130 | 3300006881 | Ga0068865_100210624 | Ga0068865_1002106242 | 294 |
| 131 | 3300009093 | Ga0105240_10006332 | Ga0105240_100063327 | 294 |
| 132 | 3300009147 | Ga0114129_10008840 | Ga0114129_100088402 | 294 |
| 133 | 3300009176 | Ga0105242_10036991 | Ga0105242_100369913 | 294 |
| 134 | 3300013296 | Ga0157374_10003607 | Ga0157374_100036074 | 294 |
| 135 | 3300013297 | Ga0157378_10173671 | Ga0157378_101736712 | 294 |
| 136 | 3300013306 | Ga0163162_10039081 | Ga0163162_100390812 | 294 |
| 137 | 3300013308 | Ga0157375_10093053 | Ga0157375_100930533 | 294 |
| 138 | 3300014969 | Ga0157376_10009071 | Ga0157376_100090715 | 294 |
| 139 | 3300025903 | Ga0207680_10043976 | Ga0207680_100439762 | 294 |
| 140 | 3300025907 | Ga0207645_10004653 | Ga0207645_100046536 | 294 |
| 141 | 3300025913 | Ga0207695_10015998 | Ga0207695_100159986 | 294 |
| 142 | 3300025914 | Ga0207671_10040842 | Ga0207671_100408423 | 294 |
| 143 | 3300025927 | Ga0207687_10008360 | Ga0207687_100083604 | 294 |
| 144 | 3300025933 | Ga0207706_10011295 | Ga0207706_100112957 | 294 |
| 145 | 3300025934 | Ga0207686_10038864 | Ga0207686_100388642 | 294 |
| 146 | 3300025936 | Ga0207670_10080807 | Ga0207670_100808072 | 294 |
| 147 | 3300025938 | Ga0207704_10209924 | Ga0207704_102099242 | 294 |
| 148 | 3300025941 | Ga0207711_10018187 | Ga0207711_100181873 | 294 |
| 149 | 3300025949 | Ga0207667_10010262 | Ga0207667_100102622 | 294 |
| 150 | 3300025972 | Ga0207668_10007298 | Ga0207668_100072982 | 294 |
| 151 | 3300026088 | Ga0207641_10019056 | Ga0207641_100190565 | 294 |
| 152 | 3300026089 | Ga0207648_10010610 | Ga0207648_100106101 | 294 |
| 153 | 3300026095 | Ga0207676_10033544 | Ga0207676_100335441 | 294 |
| 154 | 3300026118 | Ga0207675_100043462 | Ga0207675_1000434621 | 294 |
| 155 | 3300027682 | Ga0209971_1009886 | Ga0209971_10098863 | 294 |
| 156 | 3300031249 | Ga0265339_10001025 | Ga0265339_100010252 | 294 |
| 157 | 3300035691 | Ga0373931_0023727 | Ga0373931_0023727_1648_2535 | 294 |
| 158 | 3300047320 | Ga0495672_0000569 | Ga0495672_0000569_7487_8389 | 294 |
| 159 | 3300047321 | Ga0495676_0064727 | Ga0495676_0064727_605_1498 | 294 |
| 160 | 3300048906 | Ga0496103_0064646 | Ga0496103_0064646_140_1027 | 294 |
| 161 | 3300050507 | nmdc:mga05p37_4948_c2 | nmdc:mga05p37_4948_c2_403_1287 | 294 |
| 162 | 3300050507 | nmdc:mga05p37_723921_c1 | nmdc:mga05p37_723921_c1_87_1025 | 294 |
| 163 | 3300050512 | nmdc:mga0n895_7542_c1 | nmdc:mga0n895_7542_c1_7797_8681 | 294 |
| 164 | 3300050513 | nmdc:mga0rr50_17662_c1 | nmdc:mga0rr50_17662_c1_1849_2733 | 294 |
| 165 | 3300005353 | Ga0070669_100142904 | Ga0070669_1001429042 | 296 |
| 166 | 3300005719 | Ga0068861_100004502 | Ga0068861_1000045024 | 296 |
| 167 | 3300014325 | Ga0163163_10002948 | Ga0163163_100029483 | 296 |
| 168 | 3300025923 | Ga0207681_10131106 | Ga0207681_101311062 | 296 |
| 169 | 3300025961 | Ga0207712_10312784 | Ga0207712_103127841 | 296 |
| 170 | 3300026089 | Ga0207648_10102464 | Ga0207648_101024644 | 296 |
| 171 | 3300026118 | Ga0207675_100009200 | Ga0207675_1000092003 | 296 |
| 172 | 3300028380 | Ga0268265_10008686 | Ga0268265_100086865 | 296 |
| 173 | 3300036401 | Ga0373937_0545423 | Ga0373937_0545423_94_993 | 296 |
| 174 | 3300046499 | Ga0495594_0006815 | Ga0495594_0006815_4247_5179 | 296 |
| 175 | 3300046511 | Ga0495608_0146696 | Ga0495608_0146696_571_1470 | 296 |
| 176 | 3300046533 | Ga0495640_0102714 | Ga0495640_0102714_566_1465 | 296 |
| 177 | 3300046535 | Ga0495586_0081707 | Ga0495586_0081707_492_1391 | 296 |
| 178 | 3300046559 | Ga0495667_0021530 | Ga0495667_0021530_1303_2202 | 296 |
| 179 | 3300046684 | Ga0495669_0045455 | Ga0495669_0045455_217_1149 | 296 |
| 180 | 3300048915 | Ga0496112_0123607 | Ga0496112_0123607_758_1690 | 296 |
| 181 | 3300049590 | Ga0501074_0170985 | Ga0501074_0170985_627_1526 | 296 |
| 182 | 3300049742 | Ga0501080_0105240 | Ga0501080_0105240_1313_2212 | 296 |
| 183 | 3300050510 | nmdc:mga06r32_101017_c1 | nmdc:mga06r32_101017_c1_12_902 | 296 |
| 184 | 3300006173 | Ga0070716_100040600 | Ga0070716_1000406003 | 297 |
| 185 | 3300006914 | Ga0075436_100100476 | Ga0075436_1001004762 | 297 |
| 186 | 3300009176 | Ga0105242_10432599 | Ga0105242_104325991 | 297 |
| 187 | 3300035118 | Ga0373954_0139372 | Ga0373954_0139372_18_920 | 297 |
| 188 | 3300035695 | Ga0373927_0130156 | Ga0373927_0130156_32_1006 | 297 |
| 189 | 3300036401 | Ga0373937_0077673 | Ga0373937_0077673_368_1387 | 297 |
| 190 | 3300042001 | Ga0439441_014984 | Ga0439441_014984_260_1162 | 297 |
| 191 | 3300048907 | Ga0496104_0096755 | Ga0496104_0096755_738_1640 | 297 |
| 192 | 3300048908 | Ga0496105_0005780 | Ga0496105_0005780_2963_3865 | 297 |
| 193 | 3300048913 | Ga0496110_0024095 | Ga0496110_0024095_3492_4394 | 297 |
| 194 | 3300048914 | Ga0496111_0010239 | Ga0496111_0010239_3038_3940 | 297 |
| 195 | 3300048916 | Ga0496113_0086663 | Ga0496113_0086663_895_1797 | 297 |
| 196 | 3300026121 | Ga0207683_10341449 | Ga0207683_103414492 | 298 |
| 197 | 3300039437 | Ga0436365_1277623 | Ga0436365_1277623_64_972 | 298 |
| 198 | 3300039437 | Ga0436365_1519987 | Ga0436365_1519987_339_1247 | 298 |
| 199 | 3300049592 | Ga0501076_0003153 | Ga0501076_0003153_9868_10773 | 298 |
| 200 | 3300049593 | Ga0501077_0099224 | Ga0501077_0099224_219_1124 | 298 |
| 201 | 3300049741 | Ga0501079_0116907 | Ga0501079_0116907_960_1865 | 298 |
| 202 | 3300049742 | Ga0501080_0015118 | Ga0501080_0015118_4867_5772 | 298 |
| 203 | 3300049743 | Ga0501081_0162231 | Ga0501081_0162231_44_949 | 298 |
| 204 | 3300049744 | Ga0501083_0062003 | Ga0501083_0062003_272_1177 | 298 |
| 205 | 3300049824 | Ga0501045_0003463 | Ga0501045_0003463_1712_2617 | 298 |
| 206 | 3300054114 | Ga0501084_0060485 | Ga0501084_0060485_2244_3149 | 298 |
| 207 | 3300060353 | Ga0501082_0041140 | Ga0501082_0041140_2243_3148 | 298 |
| 208 | 3300061734 | Ga0530510_0014979 | Ga0530510_0014979_1712_2617 | 298 |
| 209 | 3300005290 | Ga0065712_10218421 | Ga0065712_102184211 | 299 |
| 210 | 3300005336 | Ga0070680_100030065 | Ga0070680_1000300653 | 299 |
| 211 | 3300005458 | Ga0070681_10035570 | Ga0070681_100355704 | 299 |
| 212 | 3300005530 | Ga0070679_100102818 | Ga0070679_1001028182 | 299 |
| 213 | 3300025912 | Ga0207707_10055823 | Ga0207707_100558232 | 299 |
| 214 | 3300026116 | Ga0207674_10204567 | Ga0207674_102045671 | 299 |
| 215 | 3300048907 | Ga0496104_0047882 | Ga0496104_0047882_716_1660 | 299 |
| 216 | 3300050493 | nmdc:mga0k408_204422_c1 | nmdc:mga0k408_204422_c1_52_951 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bmm-assembly2.cif.gz_C | crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form | 0.9629 | 13 | 280 |
| 5o6m-assembly1.cif.gz_A | structure of polyphosphate kinase from meiothermus ruber n121d bound to atp | 0.9593 | 15 | 278 |
| 5lcd-assembly1.cif.gz_A | structure of polyphosphate kinase from meiothermus ruber bound to amp | 0.9569 | 14 | 278 |
| 5o6m-assembly1.cif.gz_C | structure of polyphosphate kinase from meiothermus ruber n121d bound to atp | 0.9546 | 16 | 279 |
| 5o6k-assembly1.cif.gz_D | structure of polyphosphate kinase from meiothermus ruber n121d | 0.9517 | 16 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6aqeA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9599 | 13 | 280 | 3.40.50.300 |
| 5ldbC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9495 | 24 | 281 | 3.40.50.300 |
| 6angA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9404 | 7 | 297 | 3.40.50.300 |
| 6aqeA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9209 | 13 | 280 | 3.40.50.300 |
| 6angA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9191 | 7 | 297 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D5EAK9-F1-model_v4 | Polyphosphate kinase 2 family protein | 0.9846 | 6 | 296 |
GO:0006797
GO:0008976 |
| AF-A0A7V2ZH84-F1-model_v4 | Polyphosphate kinase 2 family protein | 0.9827 | 13 | 298 |
GO:0006797
GO:0008976 |
| AF-M1QDU0-F1-model_v4 | Polyphosphate kinase-2-related domain-containing protein | 0.9824 | 4 | 298 |
GO:0006797
GO:0016020 GO:0016776 |
| AF-A0A7Y2GT93-F1-model_v4 | Polyphosphate kinase 2 family protein | 0.9809 | 13 | 298 |
GO:0006797
GO:0008976 |
| AF-A0A3N5N2N2-F1-model_v4 | Polyphosphate kinase 2 family protein | 0.9781 | 9 | 299 |
GO:0006797
GO:0008976 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar