F327988

General Info

Members Datasets Scaffolds Average Seq Length
216 153 215 296

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0064727|Ga0495676_0064727_605_1498
Length 297
Sequence MPREEVLDFLQKYVTRYRGKGFRLKDFDPGDTCGLQIEKAEAADLLQAGTAWLAEEQDMLYAQDRWSLLLVFQAMDAAGKDGTINHVMSGVNPQGCQVFSFKQPSLEEIGHDFMWRYARRLPERGRIGIFNRSYYEEVLVVRVHPEFLQRQKLPQPLVTKRIWDERLADIAHFESYAARQGTKILKFFLYVSRKEQKKRFMERLEEPEKNWKFSPSDVKERKFWHEYMHAFEEAISATASKQAPWFIVPADNKWFSRLLVAAATVEALVSLDLAYPKVDAAKKKELAAARMALSRER

Samples

Sample ID Description Type Environment
1 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 4.63
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10218421 3300005290 Bacteria 1049
2 Ga0070666_10038891 3300005335 Bacteria 3167
3 Ga0070680_100030065 3300005336 Bacteria 4363
4 Ga0068868_100010638 3300005338 Bacteria 6668
5 Ga0068868_100023482 3300005338 Bacteria 4668
6 Ga0070687_100032576 3300005343 Bacteria 2565
7 Ga0070669_100142904 3300005353 Bacteria 1846
8 Ga0070671_100046589 3300005355 Bacteria 3606
9 Ga0070673_100044919 3300005364 Bacteria 3423
10 Ga0070709_10062717 3300005434 Bacteria 2371
11 Ga0070709_10292744 3300005434 Bacteria 1187
12 Ga0070714_100201996 3300005435 Bacteria 1819
13 Ga0070713_100211975 3300005436 Bacteria 1754
14 Ga0070713_100397992 3300005436 Bacteria 1286
15 Ga0070710_10062148 3300005437 Bacteria 2129
16 Ga0070708_100002514 3300005445 Bacteria 14148
17 Ga0070708_100104104 3300005445 Bacteria 2602
18 Ga0070678_100031668 3300005456 Bacteria 3652
19 Ga0070678_100046888 3300005456 Bacteria 3102
20 Ga0070662_100025884 3300005457 Bacteria 4056
21 Ga0070681_10035570 3300005458 Bacteria 5004
22 Ga0070681_10117316 3300005458 Bacteria 2598
23 Ga0068867_100053071 3300005459 Bacteria 2993
24 Ga0068867_100495492 3300005459 Bacteria 1049
25 Ga0070679_100102818 3300005530 Bacteria 2843
26 Ga0070686_100012324 3300005544 Bacteria 4866
27 Ga0070693_100035201 3300005547 Bacteria 2775
28 Ga0070665_100216715 3300005548 Bacteria 1915
29 Ga0068855_100001626 3300005563 Bacteria 28175
30 Ga0068854_100017931 3300005578 Bacteria 4745
31 Ga0068856_100000407 3300005614 Bacteria 47326
32 Ga0068856_100149503 3300005614 Bacteria 2344
33 Ga0068856_100176099 3300005614 Bacteria 2151
34 Ga0068852_100029113 3300005616 Bacteria 4531
35 Ga0068852_100306348 3300005616 Bacteria 1539
36 Ga0068864_100202070 3300005618 Bacteria 1826
37 Ga0068861_100004502 3300005719 Bacteria 9356
38 Ga0068861_100331776 3300005719 Bacteria 1328
39 Ga0068858_100166380 3300005842 Bacteria 2078
40 Ga0068862_100091632 3300005844 Bacteria 2648
41 Ga0070717_10002721 3300006028 Bacteria 12481
42 Ga0075365_10147611 3300006038 Bacteria 1635
43 Ga0070716_100000623 3300006173 Bacteria 14996
44 Ga0070716_100040600 3300006173 Bacteria 2589
45 Ga0070712_100044796 3300006175 Bacteria 3052
46 Ga0097621_100004216 3300006237 Bacteria 9981
47 Ga0097621_100017628 3300006237 Bacteria 5428
48 Ga0097621_100109193 3300006237 Bacteria 2337
49 Ga0068871_100002036 3300006358 Bacteria 13700
50 Ga0068871_100005149 3300006358 Bacteria 9141
51 Ga0068871_100035951 3300006358 Bacteria 3940
52 Ga0068871_100041283 3300006358 Bacteria 3698
53 Ga0075428_100036923 3300006844 Bacteria 5380
54 Ga0075430_100029381 3300006846 Bacteria 4665
55 Ga0075431_100101160 3300006847 Bacteria 2974
56 Ga0075434_100013927 3300006871 Bacteria 7673
57 Ga0068865_100210624 3300006881 Bacteria 1514
58 Ga0075436_100069624 3300006914 Bacteria 2431
59 Ga0075436_100100476 3300006914 Bacteria 2014
60 Ga0075436_100115138 3300006914 Bacteria 1878
61 Ga0105240_10006332 3300009093 Bacteria 17424
62 Ga0105240_10014979 3300009093 Bacteria 10564
63 Ga0105245_10018039 3300009098 Bacteria 6165
64 Ga0114129_10008840 3300009147 Bacteria 14374
65 Ga0105241_10003333 3300009174 Bacteria 11954
66 Ga0105241_10119242 3300009174 Bacteria 2122
67 Ga0105242_10036991 3300009176 Bacteria 3919
68 Ga0105242_10347761 3300009176 Bacteria 1368
69 Ga0105242_10432599 3300009176 Bacteria 1236
70 Ga0105237_10006623 3300009545 Bacteria 12800
71 Ga0105238_10266813 3300009551 Bacteria 1692
72 Ga0105239_10338055 3300010375 Bacteria 1699
73 Ga0105246_10120630 3300011119 Bacteria 1942
74 Ga0157373_10024946 3300013100 Bacteria 4329
75 Ga0157373_10031011 3300013100 Bacteria 3847
76 Ga0157371_10076858 3300013102 Bacteria 2364
77 Ga0157370_10041616 3300013104 Bacteria 4430
78 Ga0157369_10611688 3300013105 Bacteria 1124
79 Ga0157374_10000667 3300013296 Bacteria 30210
80 Ga0157374_10003607 3300013296 Bacteria 13033
81 Ga0157374_10049177 3300013296 Bacteria 3916
82 Ga0157378_10000320 3300013297 Bacteria 47177
83 Ga0157378_10173671 3300013297 Bacteria 2023
84 Ga0163162_10039081 3300013306 Bacteria 4739
85 Ga0157372_10002868 3300013307 Bacteria 18639
86 Ga0157372_10007412 3300013307 Bacteria 11668
87 Ga0157372_10022631 3300013307 Bacteria 6803
88 Ga0157372_10026648 3300013307 Bacteria 6290
89 Ga0157375_10093053 3300013308 Bacteria 3080
90 Ga0163163_10002237 3300014325 Bacteria 16294
91 Ga0163163_10002948 3300014325 Bacteria 14392
92 Ga0157376_10009071 3300014969 Bacteria 7206
93 Ga0157376_10262891 3300014969 Bacteria 1618
94 Ga0207692_10113025 3300025898 Bacteria 1509
95 Ga0207680_10043976 3300025903 Bacteria 2623
96 Ga0207699_10085660 3300025906 Bacteria 1966
97 Ga0207645_10004653 3300025907 Bacteria 10108
98 Ga0207654_10011663 3300025911 Bacteria 4486
99 Ga0207707_10055823 3300025912 Bacteria 3435
100 Ga0207707_10063646 3300025912 Bacteria 3210
101 Ga0207695_10007251 3300025913 Bacteria 14160
102 Ga0207695_10015998 3300025913 Bacteria 8806
103 Ga0207671_10040842 3300025914 Bacteria 3433
104 Ga0207693_10036793 3300025915 Bacteria 3859
105 Ga0207693_10059519 3300025915 Bacteria 2992
106 Ga0207663_10113538 3300025916 Bacteria 1842
107 Ga0207652_10080783 3300025921 Bacteria 2843
108 Ga0207681_10131106 3300025923 Bacteria 1853
109 Ga0207687_10005876 3300025927 Bacteria 8114
110 Ga0207687_10008360 3300025927 Bacteria 6771
111 Ga0207700_10190633 3300025928 Bacteria 1722
112 Ga0207700_10245887 3300025928 Bacteria 1526
113 Ga0207664_10100884 3300025929 Bacteria 2384
114 Ga0207706_10011295 3300025933 Bacteria 8140
115 Ga0207686_10038864 3300025934 Bacteria 2883
116 Ga0207670_10080807 3300025936 Bacteria 2273
117 Ga0207704_10209924 3300025938 Bacteria 1432
118 Ga0207704_10274577 3300025938 Bacteria 1278
119 Ga0207665_10000225 3300025939 Bacteria 38534
120 Ga0207665_10524695 3300025939 Bacteria 917
121 Ga0207711_10018187 3300025941 Bacteria 5843
122 Ga0207711_10038196 3300025941 Bacteria 4081
123 Ga0207711_10047913 3300025941 Bacteria 3655
124 Ga0207667_10010262 3300025949 Bacteria 10961
125 Ga0207667_10019886 3300025949 Bacteria 7481
126 Ga0207667_10585706 3300025949 Bacteria 1126
127 Ga0207712_10312784 3300025961 Bacteria 1293
128 Ga0207668_10007298 3300025972 Bacteria 6565
129 Ga0207640_10056162 3300025981 Unclassified 2582
130 Ga0207677_10040348 3300026023 Bacteria 3077
131 Ga0207677_10051591 3300026023 Bacteria 2790
132 Ga0207677_10127726 3300026023 Unclassified 1924
133 Ga0207703_10044548 3300026035 Bacteria 3567
134 Ga0207703_10157779 3300026035 Bacteria 1985
135 Ga0207702_10004430 3300026078 Bacteria 12479
136 Ga0207702_10018888 3300026078 Bacteria 5702
137 Ga0207641_10006333 3300026088 Bacteria 9998
138 Ga0207641_10019056 3300026088 Bacteria 5628
139 Ga0207648_10010610 3300026089 Bacteria 8711
140 Ga0207648_10102464 3300026089 Bacteria 2509
141 Ga0207676_10033544 3300026095 Bacteria 3880
142 Ga0207676_10200897 3300026095 Bacteria 1761
143 Ga0207676_10552145 3300026095 Bacteria 1100
144 Ga0207674_10204567 3300026116 Bacteria 1923
145 Ga0207675_100009200 3300026118 Bacteria 9265
146 Ga0207675_100043462 3300026118 Bacteria 4196
147 Ga0207683_10285623 3300026121 Bacteria 1508
148 Ga0207683_10341449 3300026121 Bacteria 1373
149 Ga0207698_10293164 3300026142 Bacteria 1511
150 Ga0209971_1009886 3300027682 Bacteria 2257
151 Ga0268265_10008686 3300028380 Bacteria 6868
152 Ga0265319_1000240 3300028563 Bacteria 41199
153 Ga0265318_10000200 3300028577 Bacteria 52170
154 Ga0265338_10096721 3300028800 Bacteria 2421
155 Ga0265325_10115856 3300031241 Bacteria 1297
156 Ga0265329_10000171 3300031242 Bacteria 32652
157 Ga0265340_10003289 3300031247 Bacteria 9156
158 Ga0265339_10001025 3300031249 Bacteria 21308
159 Ga0265339_10003746 3300031249 Bacteria 10603
160 Ga0265331_10000021 3300031250 Bacteria 242632
161 Ga0265316_10033699 3300031344 Bacteria 4168
162 Ga0265316_10051806 3300031344 Bacteria 3223
163 Ga0265313_10001348 3300031595 Bacteria 23135
164 Ga0265342_10000332 3300031712 Bacteria 52842
165 Ga0373954_0139372 3300035118 Bacteria 1183
166 Ga0373931_0023727 3300035691 Bacteria 3099
167 Ga0373927_0130156 3300035695 Bacteria 1644
168 Ga0373937_0052092 3300036401 Unclassified 3752
169 Ga0373937_0077673 3300036401 Bacteria 3068
170 Ga0373937_0545423 3300036401 Bacteria 1101
171 Ga0436365_1277623 3300039437 Bacteria 1706
172 Ga0436365_1519987 3300039437 Bacteria 1842
173 Ga0439441_014984 3300042001 Bacteria 1366
174 Ga0453684_0420403 3300044712 Bacteria 1493
175 Ga0451576_0155330 3300045051 Unclassified 2387
176 Ga0495594_0006815 3300046499 Bacteria 5870
177 Ga0495608_0146696 3300046511 Bacteria 1505
178 Ga0495640_0102714 3300046533 Bacteria 1875
179 Ga0495586_0081707 3300046535 Bacteria 1776
180 Ga0495667_0021530 3300046559 Bacteria 4351
181 Ga0495669_0045455 3300046684 Unclassified 1958
182 Ga0495604_0126517 3300047317 Bacteria 1842
183 Ga0495672_0000569 3300047320 Bacteria 41729
184 Ga0495676_0064727 3300047321 Bacteria 2841
185 Ga0496103_0064646 3300048906 Bacteria 2281
186 Ga0496104_0047882 3300048907 Bacteria 4030
187 Ga0496104_0096755 3300048907 Bacteria 2824
188 Ga0496105_0005780 3300048908 Bacteria 9432
189 Ga0496110_0024095 3300048913 Bacteria 5185
190 Ga0496111_0010239 3300048914 Bacteria 6281
191 Ga0496112_0066874 3300048915 Bacteria 3546
192 Ga0496112_0123607 3300048915 Unclassified 2559
193 Ga0496112_0145366 3300048915 Bacteria 2339
194 Ga0496113_0086663 3300048916 Bacteria 2406
195 Ga0501039_0197685 3300049575 Bacteria 1581
196 Ga0501074_0170985 3300049590 Bacteria 1551
197 Ga0501076_0003153 3300049592 Bacteria 11497
198 Ga0501077_0099224 3300049593 Bacteria 1846
199 Ga0501079_0116907 3300049741 Bacteria 2073
200 Ga0501080_0015118 3300049742 Bacteria 7113
201 Ga0501080_0105240 3300049742 Bacteria 2616
202 Ga0501081_0162231 3300049743 Bacteria 1611
203 Ga0501083_0062003 3300049744 Bacteria 2496
204 Ga0501045_0003463 3300049824 Bacteria 10802
205 nmdc:mga0yw44_207922_c1 3300050492 Bacteria 1294
206 nmdc:mga0k408_204422_c1 3300050493 Bacteria 1179
207 nmdc:mga05p37_4948_c2 3300050507 Bacteria 9042
208 nmdc:mga05p37_723921_c1 3300050507 Bacteria 1101
209 nmdc:mga06r32_101017_c1 3300050510 Bacteria 2830
210 nmdc:mga0n895_7542_c1 3300050512 Bacteria 9349
211 nmdc:mga0rr50_17662_c1 3300050513 Bacteria 4768
212 nmdc:mga08x19_83165_c1 3300050514 Bacteria 2104
213 Ga0501084_0060485 3300054114 Bacteria 3171
214 Ga0501082_0041140 3300060353 Bacteria 3985
215 Ga0530510_0014979 3300061734 Bacteria 5476

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10002237 Ga0163163_1000223713 268
2 3300048915 Ga0496112_0066874 Ga0496112_0066874_2340_3155 268
3 3300049575 Ga0501039_0197685 Ga0501039_0197685_321_1223 279
4 3300045051 Ga0451576_0155330 Ga0451576_0155330_1141_2115 283
5 iso_pu_bacteria 2929199973 2929201341 288
6 3300044712 Ga0453684_0420403 Ga0453684_0420403_313_1218 289
7 3300006038 Ga0075365_10147611 Ga0075365_101476112 290
8 3300025915 Ga0207693_10036793 Ga0207693_100367934 290
9 3300050492 nmdc:mga0yw44_207922_c1 nmdc:mga0yw44_207922_c1_154_1029 290
10 3300005435 Ga0070714_100201996 Ga0070714_1002019961 291
11 3300005459 Ga0068867_100495492 Ga0068867_1004954921 291
12 3300005544 Ga0070686_100012324 Ga0070686_1000123243 291
13 3300005842 Ga0068858_100166380 Ga0068858_1001663802 291
14 3300006237 Ga0097621_100017628 Ga0097621_1000176288 291
15 3300006358 Ga0068871_100041283 Ga0068871_1000412833 291
16 3300006914 Ga0075436_100115138 Ga0075436_1001151382 291
17 3300009098 Ga0105245_10018039 Ga0105245_100180395 291
18 3300009176 Ga0105242_10347761 Ga0105242_103477612 291
19 3300010375 Ga0105239_10338055 Ga0105239_103380553 291
20 3300011119 Ga0105246_10120630 Ga0105246_101206302 291
21 3300025927 Ga0207687_10005876 Ga0207687_100058767 291
22 3300025929 Ga0207664_10100884 Ga0207664_101008841 291
23 3300025939 Ga0207665_10524695 Ga0207665_105246951 291
24 3300025941 Ga0207711_10047913 Ga0207711_100479133 291
25 3300025949 Ga0207667_10585706 Ga0207667_105857062 291
26 3300026023 Ga0207677_10051591 Ga0207677_100515913 291
27 3300026035 Ga0207703_10157779 Ga0207703_101577792 291
28 3300026095 Ga0207676_10200897 Ga0207676_102008971 291
29 3300031344 Ga0265316_10051806 Ga0265316_100518063 291
30 3300005434 Ga0070709_10292744 Ga0070709_102927441 292
31 3300005436 Ga0070713_100397992 Ga0070713_1003979921 292
32 3300005445 Ga0070708_100104104 Ga0070708_1001041042 292
33 3300009093 Ga0105240_10014979 Ga0105240_100149793 292
34 3300013307 Ga0157372_10007412 Ga0157372_100074123 292
35 3300025906 Ga0207699_10085660 Ga0207699_100856601 292
36 3300025913 Ga0207695_10007251 Ga0207695_1000725112 292
37 3300025928 Ga0207700_10245887 Ga0207700_102458872 292
38 3300028563 Ga0265319_1000240 Ga0265319_10002407 292
39 3300028577 Ga0265318_10000200 Ga0265318_100002002 292
40 3300028800 Ga0265338_10096721 Ga0265338_100967212 292
41 3300031241 Ga0265325_10115856 Ga0265325_101158561 292
42 3300031242 Ga0265329_10000171 Ga0265329_100001715 292
43 3300031247 Ga0265340_10003289 Ga0265340_100032895 292
44 3300031249 Ga0265339_10003746 Ga0265339_100037464 292
45 3300031250 Ga0265331_10000021 Ga0265331_1000002147 292
46 3300031344 Ga0265316_10033699 Ga0265316_100336992 292
47 3300031595 Ga0265313_10001348 Ga0265313_1000134810 292
48 3300031712 Ga0265342_10000332 Ga0265342_1000033250 292
49 3300036401 Ga0373937_0052092 Ga0373937_0052092_1473_2351 292
50 3300005338 Ga0068868_100023482 Ga0068868_1000234822 293
51 3300005343 Ga0070687_100032576 Ga0070687_1000325762 293
52 3300005355 Ga0070671_100046589 Ga0070671_1000465892 293
53 3300005364 Ga0070673_100044919 Ga0070673_1000449194 293
54 3300005434 Ga0070709_10062717 Ga0070709_100627172 293
55 3300005436 Ga0070713_100211975 Ga0070713_1002119751 293
56 3300005437 Ga0070710_10062148 Ga0070710_100621482 293
57 3300005445 Ga0070708_100002514 Ga0070708_10000251412 293
58 3300005456 Ga0070678_100031668 Ga0070678_1000316682 293
59 3300005458 Ga0070681_10117316 Ga0070681_101173163 293
60 3300005547 Ga0070693_100035201 Ga0070693_1000352012 293
61 3300005563 Ga0068855_100001626 Ga0068855_10000162625 293
62 3300005614 Ga0068856_100000407 Ga0068856_10000040745 293
63 3300005614 Ga0068856_100176099 Ga0068856_1001760992 293
64 3300005616 Ga0068852_100306348 Ga0068852_1003063482 293
65 3300005618 Ga0068864_100202070 Ga0068864_1002020701 293
66 3300006028 Ga0070717_10002721 Ga0070717_100027215 293
67 3300006173 Ga0070716_100000623 Ga0070716_10000062312 293
68 3300006175 Ga0070712_100044796 Ga0070712_1000447962 293
69 3300006237 Ga0097621_100004216 Ga0097621_1000042166 293
70 3300006237 Ga0097621_100109193 Ga0097621_1001091932 293
71 3300006358 Ga0068871_100002036 Ga0068871_1000020364 293
72 3300006358 Ga0068871_100035951 Ga0068871_1000359512 293
73 3300006914 Ga0075436_100069624 Ga0075436_1000696242 293
74 3300009174 Ga0105241_10003333 Ga0105241_100033339 293
75 3300009174 Ga0105241_10119242 Ga0105241_101192421 293
76 3300009545 Ga0105237_10006623 Ga0105237_100066238 293
77 3300009551 Ga0105238_10266813 Ga0105238_102668132 293
78 3300013100 Ga0157373_10024946 Ga0157373_100249463 293
79 3300013100 Ga0157373_10031011 Ga0157373_100310111 293
80 3300013102 Ga0157371_10076858 Ga0157371_100768582 293
81 3300013104 Ga0157370_10041616 Ga0157370_100416162 293
82 3300013105 Ga0157369_10611688 Ga0157369_106116881 293
83 3300013296 Ga0157374_10000667 Ga0157374_1000066730 293
84 3300013296 Ga0157374_10049177 Ga0157374_100491772 293
85 3300013297 Ga0157378_10000320 Ga0157378_1000032045 293
86 3300013307 Ga0157372_10002868 Ga0157372_1000286810 293
87 3300013307 Ga0157372_10022631 Ga0157372_100226314 293
88 3300013307 Ga0157372_10026648 Ga0157372_100266483 293
89 3300014969 Ga0157376_10262891 Ga0157376_102628911 293
90 3300025898 Ga0207692_10113025 Ga0207692_101130252 293
91 3300025911 Ga0207654_10011663 Ga0207654_100116633 293
92 3300025912 Ga0207707_10063646 Ga0207707_100636463 293
93 3300025915 Ga0207693_10059519 Ga0207693_100595192 293
94 3300025916 Ga0207663_10113538 Ga0207663_101135382 293
95 3300025921 Ga0207652_10080783 Ga0207652_100807833 293
96 3300025928 Ga0207700_10190633 Ga0207700_101906332 293
97 3300025938 Ga0207704_10274577 Ga0207704_102745772 293
98 3300025939 Ga0207665_10000225 Ga0207665_1000022510 293
99 3300025941 Ga0207711_10038196 Ga0207711_100381963 293
100 3300025949 Ga0207667_10019886 Ga0207667_100198862 293
101 3300025981 Ga0207640_10056162 Ga0207640_100561623 293
102 3300026023 Ga0207677_10040348 Ga0207677_100403483 293
103 3300026023 Ga0207677_10127726 Ga0207677_101277262 293
104 3300026035 Ga0207703_10044548 Ga0207703_100445482 293
105 3300026078 Ga0207702_10004430 Ga0207702_100044304 293
106 3300026078 Ga0207702_10018888 Ga0207702_100188884 293
107 3300026088 Ga0207641_10006333 Ga0207641_100063332 293
108 3300026095 Ga0207676_10552145 Ga0207676_105521451 293
109 3300026121 Ga0207683_10285623 Ga0207683_102856231 293
110 3300026142 Ga0207698_10293164 Ga0207698_102931642 293
111 3300047317 Ga0495604_0126517 Ga0495604_0126517_911_1792 293
112 3300048915 Ga0496112_0145366 Ga0496112_0145366_347_1228 293
113 3300050514 nmdc:mga08x19_83165_c1 nmdc:mga08x19_83165_c1_169_1050 293
114 3300005335 Ga0070666_10038891 Ga0070666_100388912 294
115 3300005338 Ga0068868_100010638 Ga0068868_1000106385 294
116 3300005456 Ga0070678_100046888 Ga0070678_1000468883 294
117 3300005457 Ga0070662_100025884 Ga0070662_1000258844 294
118 3300005459 Ga0068867_100053071 Ga0068867_1000530712 294
119 3300005548 Ga0070665_100216715 Ga0070665_1002167152 294
120 3300005578 Ga0068854_100017931 Ga0068854_1000179313 294
121 3300005614 Ga0068856_100149503 Ga0068856_1001495032 294
122 3300005616 Ga0068852_100029113 Ga0068852_1000291134 294
123 3300005719 Ga0068861_100331776 Ga0068861_1003317762 294
124 3300005844 Ga0068862_100091632 Ga0068862_1000916322 294
125 3300006358 Ga0068871_100005149 Ga0068871_1000051495 294
126 3300006844 Ga0075428_100036923 Ga0075428_1000369233 294
127 3300006846 Ga0075430_100029381 Ga0075430_1000293814 294
128 3300006847 Ga0075431_100101160 Ga0075431_1001011602 294
129 3300006871 Ga0075434_100013927 Ga0075434_1000139272 294
130 3300006881 Ga0068865_100210624 Ga0068865_1002106242 294
131 3300009093 Ga0105240_10006332 Ga0105240_100063327 294
132 3300009147 Ga0114129_10008840 Ga0114129_100088402 294
133 3300009176 Ga0105242_10036991 Ga0105242_100369913 294
134 3300013296 Ga0157374_10003607 Ga0157374_100036074 294
135 3300013297 Ga0157378_10173671 Ga0157378_101736712 294
136 3300013306 Ga0163162_10039081 Ga0163162_100390812 294
137 3300013308 Ga0157375_10093053 Ga0157375_100930533 294
138 3300014969 Ga0157376_10009071 Ga0157376_100090715 294
139 3300025903 Ga0207680_10043976 Ga0207680_100439762 294
140 3300025907 Ga0207645_10004653 Ga0207645_100046536 294
141 3300025913 Ga0207695_10015998 Ga0207695_100159986 294
142 3300025914 Ga0207671_10040842 Ga0207671_100408423 294
143 3300025927 Ga0207687_10008360 Ga0207687_100083604 294
144 3300025933 Ga0207706_10011295 Ga0207706_100112957 294
145 3300025934 Ga0207686_10038864 Ga0207686_100388642 294
146 3300025936 Ga0207670_10080807 Ga0207670_100808072 294
147 3300025938 Ga0207704_10209924 Ga0207704_102099242 294
148 3300025941 Ga0207711_10018187 Ga0207711_100181873 294
149 3300025949 Ga0207667_10010262 Ga0207667_100102622 294
150 3300025972 Ga0207668_10007298 Ga0207668_100072982 294
151 3300026088 Ga0207641_10019056 Ga0207641_100190565 294
152 3300026089 Ga0207648_10010610 Ga0207648_100106101 294
153 3300026095 Ga0207676_10033544 Ga0207676_100335441 294
154 3300026118 Ga0207675_100043462 Ga0207675_1000434621 294
155 3300027682 Ga0209971_1009886 Ga0209971_10098863 294
156 3300031249 Ga0265339_10001025 Ga0265339_100010252 294
157 3300035691 Ga0373931_0023727 Ga0373931_0023727_1648_2535 294
158 3300047320 Ga0495672_0000569 Ga0495672_0000569_7487_8389 294
159 3300047321 Ga0495676_0064727 Ga0495676_0064727_605_1498 294
160 3300048906 Ga0496103_0064646 Ga0496103_0064646_140_1027 294
161 3300050507 nmdc:mga05p37_4948_c2 nmdc:mga05p37_4948_c2_403_1287 294
162 3300050507 nmdc:mga05p37_723921_c1 nmdc:mga05p37_723921_c1_87_1025 294
163 3300050512 nmdc:mga0n895_7542_c1 nmdc:mga0n895_7542_c1_7797_8681 294
164 3300050513 nmdc:mga0rr50_17662_c1 nmdc:mga0rr50_17662_c1_1849_2733 294
165 3300005353 Ga0070669_100142904 Ga0070669_1001429042 296
166 3300005719 Ga0068861_100004502 Ga0068861_1000045024 296
167 3300014325 Ga0163163_10002948 Ga0163163_100029483 296
168 3300025923 Ga0207681_10131106 Ga0207681_101311062 296
169 3300025961 Ga0207712_10312784 Ga0207712_103127841 296
170 3300026089 Ga0207648_10102464 Ga0207648_101024644 296
171 3300026118 Ga0207675_100009200 Ga0207675_1000092003 296
172 3300028380 Ga0268265_10008686 Ga0268265_100086865 296
173 3300036401 Ga0373937_0545423 Ga0373937_0545423_94_993 296
174 3300046499 Ga0495594_0006815 Ga0495594_0006815_4247_5179 296
175 3300046511 Ga0495608_0146696 Ga0495608_0146696_571_1470 296
176 3300046533 Ga0495640_0102714 Ga0495640_0102714_566_1465 296
177 3300046535 Ga0495586_0081707 Ga0495586_0081707_492_1391 296
178 3300046559 Ga0495667_0021530 Ga0495667_0021530_1303_2202 296
179 3300046684 Ga0495669_0045455 Ga0495669_0045455_217_1149 296
180 3300048915 Ga0496112_0123607 Ga0496112_0123607_758_1690 296
181 3300049590 Ga0501074_0170985 Ga0501074_0170985_627_1526 296
182 3300049742 Ga0501080_0105240 Ga0501080_0105240_1313_2212 296
183 3300050510 nmdc:mga06r32_101017_c1 nmdc:mga06r32_101017_c1_12_902 296
184 3300006173 Ga0070716_100040600 Ga0070716_1000406003 297
185 3300006914 Ga0075436_100100476 Ga0075436_1001004762 297
186 3300009176 Ga0105242_10432599 Ga0105242_104325991 297
187 3300035118 Ga0373954_0139372 Ga0373954_0139372_18_920 297
188 3300035695 Ga0373927_0130156 Ga0373927_0130156_32_1006 297
189 3300036401 Ga0373937_0077673 Ga0373937_0077673_368_1387 297
190 3300042001 Ga0439441_014984 Ga0439441_014984_260_1162 297
191 3300048907 Ga0496104_0096755 Ga0496104_0096755_738_1640 297
192 3300048908 Ga0496105_0005780 Ga0496105_0005780_2963_3865 297
193 3300048913 Ga0496110_0024095 Ga0496110_0024095_3492_4394 297
194 3300048914 Ga0496111_0010239 Ga0496111_0010239_3038_3940 297
195 3300048916 Ga0496113_0086663 Ga0496113_0086663_895_1797 297
196 3300026121 Ga0207683_10341449 Ga0207683_103414492 298
197 3300039437 Ga0436365_1277623 Ga0436365_1277623_64_972 298
198 3300039437 Ga0436365_1519987 Ga0436365_1519987_339_1247 298
199 3300049592 Ga0501076_0003153 Ga0501076_0003153_9868_10773 298
200 3300049593 Ga0501077_0099224 Ga0501077_0099224_219_1124 298
201 3300049741 Ga0501079_0116907 Ga0501079_0116907_960_1865 298
202 3300049742 Ga0501080_0015118 Ga0501080_0015118_4867_5772 298
203 3300049743 Ga0501081_0162231 Ga0501081_0162231_44_949 298
204 3300049744 Ga0501083_0062003 Ga0501083_0062003_272_1177 298
205 3300049824 Ga0501045_0003463 Ga0501045_0003463_1712_2617 298
206 3300054114 Ga0501084_0060485 Ga0501084_0060485_2244_3149 298
207 3300060353 Ga0501082_0041140 Ga0501082_0041140_2243_3148 298
208 3300061734 Ga0530510_0014979 Ga0530510_0014979_1712_2617 298
209 3300005290 Ga0065712_10218421 Ga0065712_102184211 299
210 3300005336 Ga0070680_100030065 Ga0070680_1000300653 299
211 3300005458 Ga0070681_10035570 Ga0070681_100355704 299
212 3300005530 Ga0070679_100102818 Ga0070679_1001028182 299
213 3300025912 Ga0207707_10055823 Ga0207707_100558232 299
214 3300026116 Ga0207674_10204567 Ga0207674_102045671 299
215 3300048907 Ga0496104_0047882 Ga0496104_0047882_716_1660 299
216 3300050493 nmdc:mga0k408_204422_c1 nmdc:mga0k408_204422_c1_52_951 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

36

275

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9629 13 280
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9593 15 278
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9569 14 278
5o6m-assembly1.cif.gz_C structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9546 16 279
5o6k-assembly1.cif.gz_D structure of polyphosphate kinase from meiothermus ruber n121d 0.9517 16 280
ID Description Score Start End Superfamily
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9599 13 280 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9495 24 281 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9404 7 297 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9209 13 280 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9191 7 297 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7D5EAK9-F1-model_v4 Polyphosphate kinase 2 family protein 0.9846 6 296 GO:0006797
GO:0008976
AF-A0A7V2ZH84-F1-model_v4 Polyphosphate kinase 2 family protein 0.9827 13 298 GO:0006797
GO:0008976
AF-M1QDU0-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.9824 4 298 GO:0006797
GO:0016020
GO:0016776
AF-A0A7Y2GT93-F1-model_v4 Polyphosphate kinase 2 family protein 0.9809 13 298 GO:0006797
GO:0008976
AF-A0A3N5N2N2-F1-model_v4 Polyphosphate kinase 2 family protein 0.9781 9 299 GO:0006797
GO:0008976

Feature Viewer

pLDDT pTM Quality
88.08 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map