F327882

General Info

Members Datasets Scaffolds Average Seq Length
216 180 202 170

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0004835|Ga0466972_0004835_1242_1799
Length 185
Sequence MTYVMVDIEADGPIPGDYSMISFGAVIVEPVLHRTFHGQLRPISERWIPEALAVSGFSRDETLRFEEPSHVMLRFARWLGTNVAGQPMFISDNNGFDWQFINWYFHHFTGSNPFGHSSTNLGSLYKGVVKDTTRNFKHLRKTRHTHNPVDDAIGNAEALLYMMQAMELRTPKPRLSAGAEPPQGG

Samples

Sample ID Description Type Environment
1 2643221573 Lysobacter sp. Root604 Isolate Unclassified
2 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
3 2643221720 Lysobacter sp. Root916 Isolate Unclassified
4 2738541278 Niastella sp. CF465 Isolate Unclassified
5 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
6 2818991444 Filimonas endophytica 3197 Isolate Unclassified
7 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
8 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
9 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
10 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
11 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
12 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
13 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
14 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
115 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
116 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
117 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
147 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
148 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
149 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
154 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
155 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
156 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
159 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
174 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
175 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
176 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
179 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
180 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 0
Isolates 6.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.89
Nodule 0
Rhizoplane 1.39
Rhizosphere 70.37
Stem 0
Stem Tuber 0
Unclassified 14.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001271 3300003203 Bacteria 11837
2 rootH1_10108522 3300003316 Bacteria 2574
3 rootH1_10038274 3300003323 Bacteria 20153
4 rootH1_10253416 3300003323 Bacteria 1426
5 Ga0055535_1004148 3300003761 Bacteria 3676
6 Ga0055542_1004254 3300003762 Bacteria 3538
7 Ga0065165_1019342 3300005262 Unclassified 2435
8 Ga0070682_100233302 3300005337 Bacteria 1317
9 Ga0068868_100046807 3300005338 Bacteria 3386
10 Ga0070689_100104249 3300005340 Bacteria 2248
11 Ga0070668_100464629 3300005347 Bacteria 1090
12 Ga0070671_100202445 3300005355 Bacteria 1684
13 Ga0070674_100081939 3300005356 Unclassified 2307
14 Ga0070674_100219473 3300005356 Bacteria 1478
15 Ga0070673_100000252 3300005364 Bacteria 27220
16 Ga0070688_100002406 3300005365 Bacteria 9445
17 Ga0070667_100168538 3300005367 Bacteria 1932
18 Ga0070667_100359335 3300005367 Bacteria 1320
19 Ga0070667_100421168 3300005367 Bacteria 1217
20 Ga0070678_100234257 3300005456 Bacteria 1532
21 Ga0070662_100008578 3300005457 Bacteria 6664
22 Ga0070685_10011719 3300005466 Bacteria 4595
23 Ga0070698_100002422 3300005471 Bacteria 20552
24 Ga0070672_100082879 3300005543 Bacteria 2573
25 Ga0070686_100120368 3300005544 Bacteria 1801
26 Ga0070665_101020567 3300005548 Unclassified 839
27 Ga0068855_100002116 3300005563 Bacteria 24571
28 Ga0068855_100310217 3300005563 Unclassified 1746
29 Ga0068857_100196093 3300005577 Bacteria 1840
30 Ga0068852_100280097 3300005616 Bacteria 1607
31 Ga0068852_100317065 3300005616 Bacteria 1513
32 Ga0068870_10190619 3300005840 Bacteria 1237
33 Ga0068863_100020121 3300005841 Bacteria 6385
34 Ga0068863_100502266 3300005841 Unclassified 1194
35 Ga0068860_100624602 3300005843 Bacteria 1084
36 Ga0081455_10415314 3300005937 Unclassified 929
37 Ga0081539_10001365 3300005985 Bacteria 42287
38 Ga0070717_10000033 3300006028 Bacteria 131514
39 Ga0075365_10080870 3300006038 Bacteria 2201
40 Ga0075367_10064267 3300006178 Bacteria 2195
41 Ga0068871_101112717 3300006358 Unclassified 739
42 Ga0075430_100158096 3300006846 Bacteria 1887
43 Ga0075431_100183871 3300006847 Bacteria 2144
44 Ga0075434_100137524 3300006871 Bacteria 2462
45 Ga0105251_10005088 3300009011 Bacteria 8704
46 Ga0105240_10025180 3300009093 Bacteria 7825
47 Ga0105240_10440819 3300009093 Bacteria 1459
48 Ga0105240_10952678 3300009093 Bacteria 920
49 Ga0111539_10233008 3300009094 Bacteria 2144
50 Ga0105245_10000037 3300009098 Bacteria 146480
51 Ga0114129_10534051 3300009147 Bacteria 1528
52 Ga0114129_11902879 3300009147 Unclassified 721
53 Ga0105243_10539636 3300009148 Unclassified 1112
54 Ga0105241_10016153 3300009174 Bacteria 5471
55 Ga0105241_10310110 3300009174 Bacteria 1357
56 Ga0105237_10225229 3300009545 Bacteria 1875
57 Ga0105237_10270644 3300009545 Bacteria 1702
58 Ga0105238_10000363 3300009551 Bacteria 48636
59 Ga0105249_10000066 3300009553 Bacteria 149801
60 Ga0105249_10004725 3300009553 Bacteria 11762
61 Ga0105249_10577237 3300009553 Bacteria 1177
62 Ga0105239_10000161 3300010375 Bacteria 97242
63 Ga0105239_10002922 3300010375 Bacteria 21332
64 Ga0105239_10030725 3300010375 Bacteria 5908
65 Ga0105239_10088529 3300010375 Unclassified 3414
66 Ga0105239_10424418 3300010375 Unclassified 1507
67 Ga0105246_10931477 3300011119 Bacteria 781
68 Ga0157374_11390096 3300013296 Unclassified 725
69 Ga0163162_10419637 3300013306 Bacteria 1470
70 Ga0157375_10195776 3300013308 Bacteria 2176
71 Ga0157380_10299899 3300014326 Bacteria 1480
72 Ga0182005_1000189 3300015265 Bacteria 42264
73 Ga0209436_105613 3300025208 Unclassified 2856
74 Ga0209258_100041 3300025242 Bacteria 381381
75 Ga0209646_1013315 3300025246 Bacteria 1252
76 Ga0209148_1000090 3300025254 Bacteria 250982
77 Ga0207426_1002071 3300025302 Bacteria 13913
78 Ga0207653_10135983 3300025885 Archaea 895
79 Ga0207643_10192869 3300025908 Bacteria 1237
80 Ga0207684_10050145 3300025910 Bacteria 3540
81 Ga0207654_10413405 3300025911 Bacteria 940
82 Ga0207695_10028190 3300025913 Bacteria 6234
83 Ga0207671_11127870 3300025914 Bacteria 615
84 Ga0207694_10000641 3300025924 Bacteria 31565
85 Ga0207650_10059238 3300025925 Bacteria 2854
86 Ga0207687_10000146 3300025927 Bacteria 47110
87 Ga0207644_10165837 3300025931 Bacteria 1721
88 Ga0207706_10000785 3300025933 Bacteria 32843
89 Ga0207670_10072353 3300025936 Bacteria 2386
90 Ga0207691_10005967 3300025940 Bacteria 11765
91 Ga0207667_10005132 3300025949 Bacteria 15992
92 Ga0207651_10000185 3300025960 Bacteria 27222
93 Ga0207712_10000252 3300025961 Bacteria 52327
94 Ga0207712_10005061 3300025961 Bacteria 8346
95 Ga0207712_10237702 3300025961 Bacteria 1466
96 Ga0207658_10163377 3300025986 Bacteria 1827
97 Ga0207677_10053385 3300026023 Bacteria 2751
98 Ga0207641_10001483 3300026088 Bacteria 23003
99 Ga0207648_11141765 3300026089 Bacteria 731
100 Ga0207674_10092500 3300026116 Bacteria 3014
101 Ga0207674_10135321 3300026116 Bacteria 2426
102 Ga0207674_10952585 3300026116 Unclassified 827
103 Ga0207675_100021475 3300026118 Bacteria 6013
104 Ga0207683_10237404 3300026121 Bacteria 1663
105 Ga0207698_10192360 3300026142 Bacteria 1819
106 Ga0207698_10290067 3300026142 Bacteria 1518
107 Ga0207428_10007316 3300027907 Bacteria 10081
108 Ga0307515_10003653 3300028794 Bacteria 32336
109 Ga0307511_10000369 3300030521 Bacteria 47860
110 Ga0265327_10000207 3300031251 Bacteria 123193
111 Ga0307513_10098768 3300031456 Bacteria 2950
112 Ga0307513_10232971 3300031456 Bacteria 1653
113 Ga0307509_10164683 3300031507 Bacteria 2108
114 Ga0307516_10254804 3300031730 Bacteria 1448
115 Ga0307405_10202409 3300031731 Bacteria 1443
116 Ga0307413_10075885 3300031824 Bacteria 2135
117 Ga0307410_10114221 3300031852 Bacteria 1959
118 Ga0307406_10396566 3300031901 Bacteria 1092
119 Ga0307407_10104378 3300031903 Bacteria 1766
120 Ga0307411_10054094 3300032005 Bacteria 2634
121 Ga0307415_100290407 3300032126 Bacteria 1349
122 Ga0307415_100374238 3300032126 Bacteria 1207
123 Ga0307510_10000825 3300033180 Bacteria 32314
124 Ga0395905_0295727 3300037471 Bacteria 1506
125 Ga0400483_044275 3300039062 Bacteria 2030
126 Ga0400483_191995 3300039062 Bacteria 9130
127 Ga0451802_0908955 3300041460 Bacteria 940
128 Ga0451841_0152817 3300041498 Bacteria 587
129 Ga0451851_0812729 3300041507 Bacteria 923
130 Ga0451843_1303506 3300041509 Bacteria 675
131 Ga0439449_0032501 3300042007 Bacteria 1945
132 Ga0439457_112923 3300042014 Bacteria 639
133 Ga0451577_0208095 3300042876 Bacteria 1767
134 Ga0451577_0489622 3300042876 Unclassified 1117
135 Ga0466972_0004835 3300044658 Bacteria 6758
136 Ga0466965_0388610 3300044683 Bacteria 769
137 Ga0466964_0087682 3300044706 Bacteria 1349
138 Ga0453684_0000460 3300044712 Bacteria 162976
139 Ga0453684_0001134 3300044712 Bacteria 83375
140 Ga0451576_0183293 3300045051 Bacteria 2186
141 Ga0495603_0059543 3300046455 Bacteria 2258
142 Ga0495638_0262017 3300046460 Bacteria 948
143 Ga0495651_0186537 3300046462 Bacteria 1463
144 Ga0495664_0282490 3300046477 Unclassified 1003
145 Ga0495585_0002023 3300046492 Bacteria 15008
146 Ga0495606_0317636 3300046507 Bacteria 838
147 Ga0495632_0094590 3300046519 Bacteria 1413
148 Ga0495648_0000390 3300046524 Bacteria 48133
149 Ga0495648_0049418 3300046524 Bacteria 2578
150 Ga0495652_0094337 3300046529 Bacteria 2441
151 Ga0495609_0006629 3300046538 Bacteria 5880
152 Ga0495668_0000044 3300046616 Bacteria 227585
153 Ga0495625_0000772 3300046660 Bacteria 44536
154 Ga0495660_0331033 3300046810 Bacteria 682
155 Ga0495686_0008076 3300047472 Bacteria 7789
156 Ga0495614_0069374 3300048089 Bacteria 1518
157 Ga0496114_0000332 3300048917 Bacteria 34319
158 Ga0496114_1037473 3300048917 Bacteria 704
159 Ga0496121_0000007 3300048924 Bacteria 942516
160 Ga0496121_0761841 3300048924 Unclassified 574
161 Ga0496124_0008528 3300048927 Bacteria 10699
162 Ga0496126_0053623 3300048929 Bacteria 3657
163 Ga0495682_0042892 3300049460 Bacteria 1657
164 Ga0501292_000921 3300049515 Unclassified 3588
165 Ga0501296_048490 3300049519 Unclassified 616
166 Ga0501298_042072 3300049521 Unclassified 928
167 Ga0501034_0269697 3300049571 Bacteria 1643
168 Ga0501046_0011528 3300049580 Bacteria 7558
169 Ga0501047_0017025 3300049581 Bacteria 6950
170 Ga0501217_007711 3300049661 Bacteria 2312
171 Ga0501227_000104 3300049665 Bacteria 14114
172 Ga0501230_002372 3300049667 Bacteria 2398
173 Ga0501235_014512 3300049669 Unclassified 1736
174 Ga0501257_259045 3300049686 Bacteria 518
175 Ga0501221_059623 3300049704 Unclassified 879
176 Ga0501225_0033388 3300049705 Unclassified 1416
177 nmdc:mga0yw44_76099_c1 3300050492 Bacteria 2094
178 nmdc:mga0k408_502274_c1 3300050493 Bacteria 718
179 nmdc:mga06z11_218960_c1 3300050494 Bacteria 1112
180 nmdc:mga05p37_211516_c1 3300050507 Bacteria 2344
181 nmdc:mga0qj67_240162_c1 3300050509 Unclassified 1470
182 nmdc:mga06r32_62859_c1 3300050510 Bacteria 3577
183 nmdc:mga08y16_30192_c1 3300050511 Bacteria 5706
184 nmdc:mga0n895_71687_c1 3300050512 Bacteria 3436
185 Ga0500581_083167 3300053089 Bacteria 1595
186 Ga0500646_0005008 3300053090 Bacteria 3362
187 Ga0500646_0011866 3300053090 Unclassified 2244
188 Ga0500646_0066297 3300053090 Bacteria 1074
189 Ga0500646_0181991 3300053090 Bacteria 713
190 Ga0500583_0000035 3300053092 Bacteria 96248
191 Ga0500583_0000835 3300053092 Bacteria 8861
192 Ga0500650_0065300 3300053098 Bacteria 1700
193 Ga0500556_0001963 3300053104 Bacteria 7258
194 Ga0500556_0230739 3300053104 Bacteria 730
195 Ga0500562_001372 3300053108 Bacteria 6004
196 Ga0500626_022669 3300053128 Bacteria 2809
197 Ga0500642_0179767 3300053130 Bacteria 989
198 Ga0500589_003789 3300053147 Bacteria 5536
199 Ga0500616_0005442 3300053153 Bacteria 8639
200 Ga0500633_0029834 3300053160 Bacteria 1748
201 Ga0500634_0076327 3300053161 Bacteria 1740
202 Ga0500611_112581 3300053727 Bacteria 717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_11141765 Ga0207648_111417651 153
2 3300041498 Ga0451841_0152817 Ga0451841_0152817_101_562 153
3 3300042014 Ga0439457_112923 Ga0439457_112923_152_613 153
4 3300042876 Ga0451577_0489622 Ga0451577_0489622_14_475 153
5 3300049686 Ga0501257_259045 Ga0501257_259045_28_489 153
6 3300050493 nmdc:mga0k408_502274_c1 nmdc:mga0k408_502274_c1_24_485 153
7 3300005337 Ga0070682_100233302 Ga0070682_1002333022 157
8 3300005338 Ga0068868_100046807 Ga0068868_1000468074 157
9 3300005340 Ga0070689_100104249 Ga0070689_1001042492 157
10 3300005364 Ga0070673_100000252 Ga0070673_10000025220 157
11 3300005365 Ga0070688_100002406 Ga0070688_1000024062 157
12 3300005367 Ga0070667_100359335 Ga0070667_1003593352 157
13 3300005456 Ga0070678_100234257 Ga0070678_1002342572 157
14 3300005466 Ga0070685_10011719 Ga0070685_100117192 157
15 3300005543 Ga0070672_100082879 Ga0070672_1000828794 157
16 3300005544 Ga0070686_100120368 Ga0070686_1001203682 157
17 3300025931 Ga0207644_10165837 Ga0207644_101658371 157
18 3300025936 Ga0207670_10072353 Ga0207670_100723534 157
19 3300025940 Ga0207691_10005967 Ga0207691_1000596711 157
20 3300025960 Ga0207651_10000185 Ga0207651_1000018521 157
21 3300025986 Ga0207658_10163377 Ga0207658_101633772 157
22 3300026023 Ga0207677_10053385 Ga0207677_100533852 157
23 3300026121 Ga0207683_10237404 Ga0207683_102374043 157
24 3300005355 Ga0070671_100202445 Ga0070671_1002024452 161
25 iso_pu_bacteria 2643221573 2643879808 164
26 iso_pu_bacteria 2643221720 2644663258 164
27 iso_pu_bacteria 2818991444 2819585863 164
28 3300053128 Ga0500626_022669 Ga0500626_022669_2198_2713 166
29 3300006847 Ga0075431_100183871 Ga0075431_1001838713 167
30 3300009147 Ga0114129_10534051 Ga0114129_105340512 167
31 3300009147 Ga0114129_11902879 Ga0114129_119028791 167
32 3300009551 Ga0105238_10000363 Ga0105238_1000036326 167
33 3300027907 Ga0207428_10007316 Ga0207428_100073167 167
34 3300050507 nmdc:mga05p37_211516_c1 nmdc:mga05p37_211516_c1_1041_1544 167
35 3300050509 nmdc:mga0qj67_240162_c1 nmdc:mga0qj67_240162_c1_230_733 167
36 3300050510 nmdc:mga06r32_62859_c1 nmdc:mga06r32_62859_c1_1887_2390 167
37 3300050511 nmdc:mga08y16_30192_c1 nmdc:mga08y16_30192_c1_1681_2184 167
38 3300003323 rootH1_10253416 rootH1_102534161 168
39 3300005548 Ga0070665_101020567 Ga0070665_1010205672 168
40 3300005841 Ga0068863_100502266 Ga0068863_1005022661 168
41 3300009093 Ga0105240_10025180 Ga0105240_100251805 168
42 3300009174 Ga0105241_10016153 Ga0105241_100161533 168
43 3300009174 Ga0105241_10310110 Ga0105241_103101102 168
44 3300009545 Ga0105237_10270644 Ga0105237_102706443 168
45 3300010375 Ga0105239_10000161 Ga0105239_1000016111 168
46 3300010375 Ga0105239_10030725 Ga0105239_100307255 168
47 3300010375 Ga0105239_10424418 Ga0105239_104244182 168
48 3300013308 Ga0157375_10195776 Ga0157375_101957763 168
49 3300026116 Ga0207674_10092500 Ga0207674_100925002 168
50 3300028794 Ga0307515_10003653 Ga0307515_1000365325 168
51 3300037471 Ga0395905_0295727 Ga0395905_0295727_513_1019 168
52 3300041460 Ga0451802_0908955 Ga0451802_0908955_46_552 168
53 3300044712 Ga0453684_0000460 Ga0453684_0000460_115382_115891 168
54 3300044712 Ga0453684_0001134 Ga0453684_0001134_31865_32374 168
55 3300045051 Ga0451576_0183293 Ga0451576_0183293_886_1395 168
56 3300046507 Ga0495606_0317636 Ga0495606_0317636_174_680 168
57 3300048924 Ga0496121_0761841 Ga0496121_0761841_11_517 168
58 3300048927 Ga0496124_0008528 Ga0496124_0008528_129_638 168
59 3300048929 Ga0496126_0053623 Ga0496126_0053623_2435_2941 168
60 3300049571 Ga0501034_0269697 Ga0501034_0269697_142_651 168
61 3300049580 Ga0501046_0011528 Ga0501046_0011528_1921_2427 168
62 3300049581 Ga0501047_0017025 Ga0501047_0017025_3465_3971 168
63 iso_pu_bacteria 2643221665 2644364385 168
64 iso_pu_bacteria 2738541278 2738725163 168
65 iso_pu_bacteria 2818991442 2819575422 168
66 iso_pu_bacteria 2818991460 2819678432 168
67 iso_pu_bacteria 2821136567 2821137964 168
68 iso_pu_bacteria 2890804823 2890807113 168
69 iso_pu_bacteria 2904467357 2904468759 168
70 iso_pu_bacteria 2929154850 2929155572 168
71 iso_pu_bacteria 2929177148 2929180844 168
72 iso_pu_bacteria 2945977869 2945983243 168
73 iso_pu_bacteria 2946013367 2946017366 168
74 3300031901 Ga0307406_10396566 Ga0307406_103965662 169
75 3300032126 Ga0307415_100290407 Ga0307415_1002904072 169
76 3300047472 Ga0495686_0008076 Ga0495686_0008076_7212_7724 169
77 3300025885 Ga0207653_10135983 Ga0207653_101359832 170
78 3300053090 Ga0500646_0011866 Ga0500646_0011866_734_1246 170
79 3300005367 Ga0070667_100168538 Ga0070667_1001685382 171
80 3300005367 Ga0070667_100421168 Ga0070667_1004211682 171
81 3300005471 Ga0070698_100002422 Ga0070698_1000024228 171
82 3300006358 Ga0068871_101112717 Ga0068871_1011127171 171
83 3300006846 Ga0075430_100158096 Ga0075430_1001580963 171
84 3300006871 Ga0075434_100137524 Ga0075434_1001375241 171
85 3300009094 Ga0111539_10233008 Ga0111539_102330081 171
86 3300009098 Ga0105245_10000037 Ga0105245_1000003759 171
87 3300011119 Ga0105246_10931477 Ga0105246_109314772 171
88 3300013296 Ga0157374_11390096 Ga0157374_113900961 171
89 3300025910 Ga0207684_10050145 Ga0207684_100501453 171
90 3300025914 Ga0207671_11127870 Ga0207671_111278701 171
91 3300025924 Ga0207694_10000641 Ga0207694_1000064120 171
92 3300025927 Ga0207687_10000146 Ga0207687_100001469 171
93 3300031251 Ga0265327_10000207 Ga0265327_1000020772 171
94 3300031507 Ga0307509_10164683 Ga0307509_101646833 171
95 3300039062 Ga0400483_044275 Ga0400483_044275_257_787 171
96 3300039062 Ga0400483_191995 Ga0400483_191995_166_696 171
97 3300046455 Ga0495603_0059543 Ga0495603_0059543_1420_1935 171
98 3300046477 Ga0495664_0282490 Ga0495664_0282490_326_844 171
99 3300049515 Ga0501292_000921 Ga0501292_000921_342_866 171
100 3300049519 Ga0501296_048490 Ga0501296_048490_62_586 171
101 3300049521 Ga0501298_042072 Ga0501298_042072_253_777 171
102 3300049661 Ga0501217_007711 Ga0501217_007711_733_1257 171
103 3300049665 Ga0501227_000104 Ga0501227_000104_6516_7040 171
104 3300049667 Ga0501230_002372 Ga0501230_002372_1795_2319 171
105 3300049669 Ga0501235_014512 Ga0501235_014512_226_750 171
106 3300049704 Ga0501221_059623 Ga0501221_059623_253_777 171
107 3300049705 Ga0501225_0033388 Ga0501225_0033388_181_705 171
108 3300050512 nmdc:mga0n895_71687_c1 nmdc:mga0n895_71687_c1_1045_1560 171
109 3300053090 Ga0500646_0181991 Ga0500646_0181991_64_579 171
110 3300053108 Ga0500562_001372 Ga0500562_001372_609_1124 171
111 3300053727 Ga0500611_112581 Ga0500611_112581_168_683 171
112 3300003203 JGI25406J46586_10001271 JGI25406J46586_100012712 172
113 3300003316 rootH1_10108522 rootH1_101085221 172
114 3300003323 rootH1_10038274 rootH1_1003827416 172
115 3300003761 Ga0055535_1004148 Ga0055535_10041483 172
116 3300003762 Ga0055542_1004254 Ga0055542_10042544 172
117 3300005262 Ga0065165_1019342 Ga0065165_10193422 172
118 3300005347 Ga0070668_100464629 Ga0070668_1004646292 172
119 3300005356 Ga0070674_100081939 Ga0070674_1000819392 172
120 3300005356 Ga0070674_100219473 Ga0070674_1002194733 172
121 3300005457 Ga0070662_100008578 Ga0070662_1000085782 172
122 3300005563 Ga0068855_100002116 Ga0068855_10000211619 172
123 3300005563 Ga0068855_100310217 Ga0068855_1003102173 172
124 3300005577 Ga0068857_100196093 Ga0068857_1001960932 172
125 3300005616 Ga0068852_100280097 Ga0068852_1002800971 172
126 3300005616 Ga0068852_100317065 Ga0068852_1003170654 172
127 3300005840 Ga0068870_10190619 Ga0068870_101906192 172
128 3300005841 Ga0068863_100020121 Ga0068863_1000201216 172
129 3300005843 Ga0068860_100624602 Ga0068860_1006246022 172
130 3300005937 Ga0081455_10415314 Ga0081455_104153142 172
131 3300005985 Ga0081539_10001365 Ga0081539_100013656 172
132 3300006028 Ga0070717_10000033 Ga0070717_1000003378 172
133 3300006038 Ga0075365_10080870 Ga0075365_100808702 172
134 3300006178 Ga0075367_10064267 Ga0075367_100642673 172
135 3300009011 Ga0105251_10005088 Ga0105251_100050882 172
136 3300009093 Ga0105240_10440819 Ga0105240_104408191 172
137 3300009093 Ga0105240_10952678 Ga0105240_109526781 172
138 3300009148 Ga0105243_10539636 Ga0105243_105396362 172
139 3300009545 Ga0105237_10225229 Ga0105237_102252293 172
140 3300009553 Ga0105249_10000066 Ga0105249_1000006671 172
141 3300009553 Ga0105249_10004725 Ga0105249_100047253 172
142 3300009553 Ga0105249_10577237 Ga0105249_105772372 172
143 3300010375 Ga0105239_10002922 Ga0105239_100029225 172
144 3300010375 Ga0105239_10088529 Ga0105239_100885294 172
145 3300013306 Ga0163162_10419637 Ga0163162_104196372 172
146 3300014326 Ga0157380_10299899 Ga0157380_102998992 172
147 3300015265 Ga0182005_1000189 Ga0182005_10001892 172
148 3300025208 Ga0209436_105613 Ga0209436_1056132 172
149 3300025242 Ga0209258_100041 Ga0209258_1000419 172
150 3300025246 Ga0209646_1013315 Ga0209646_10133152 172
151 3300025254 Ga0209148_1000090 Ga0209148_1000090226 172
152 3300025302 Ga0207426_1002071 Ga0207426_10020716 172
153 3300025908 Ga0207643_10192869 Ga0207643_101928692 172
154 3300025911 Ga0207654_10413405 Ga0207654_104134052 172
155 3300025913 Ga0207695_10028190 Ga0207695_100281903 172
156 3300025925 Ga0207650_10059238 Ga0207650_100592384 172
157 3300025933 Ga0207706_10000785 Ga0207706_1000078528 172
158 3300025949 Ga0207667_10005132 Ga0207667_100051328 172
159 3300025961 Ga0207712_10000252 Ga0207712_1000025223 172
160 3300025961 Ga0207712_10005061 Ga0207712_100050616 172
161 3300025961 Ga0207712_10237702 Ga0207712_102377021 172
162 3300026088 Ga0207641_10001483 Ga0207641_100014833 172
163 3300026116 Ga0207674_10135321 Ga0207674_101353212 172
164 3300026116 Ga0207674_10952585 Ga0207674_109525852 172
165 3300026118 Ga0207675_100021475 Ga0207675_1000214754 172
166 3300026142 Ga0207698_10192360 Ga0207698_101923604 172
167 3300026142 Ga0207698_10290067 Ga0207698_102900671 172
168 3300030521 Ga0307511_10000369 Ga0307511_1000036929 172
169 3300031456 Ga0307513_10098768 Ga0307513_100987684 172
170 3300031456 Ga0307513_10232971 Ga0307513_102329712 172
171 3300031730 Ga0307516_10254804 Ga0307516_102548043 172
172 3300031731 Ga0307405_10202409 Ga0307405_102024092 172
173 3300031824 Ga0307413_10075885 Ga0307413_100758853 172
174 3300031852 Ga0307410_10114221 Ga0307410_101142211 172
175 3300031903 Ga0307407_10104378 Ga0307407_101043783 172
176 3300032005 Ga0307411_10054094 Ga0307411_100540943 172
177 3300032126 Ga0307415_100374238 Ga0307415_1003742382 172
178 3300033180 Ga0307510_10000825 Ga0307510_1000082514 172
179 3300041507 Ga0451851_0812729 Ga0451851_0812729_264_782 172
180 3300041509 Ga0451843_1303506 Ga0451843_1303506_53_571 172
181 3300042007 Ga0439449_0032501 Ga0439449_0032501_692_1210 172
182 3300042876 Ga0451577_0208095 Ga0451577_0208095_165_686 172
183 3300044658 Ga0466972_0004835 Ga0466972_0004835_1242_1799 172
184 3300044683 Ga0466965_0388610 Ga0466965_0388610_205_747 172
185 3300044706 Ga0466964_0087682 Ga0466964_0087682_724_1281 172
186 3300046460 Ga0495638_0262017 Ga0495638_0262017_346_864 172
187 3300046462 Ga0495651_0186537 Ga0495651_0186537_923_1441 172
188 3300046492 Ga0495585_0002023 Ga0495585_0002023_11362_11880 172
189 3300046519 Ga0495632_0094590 Ga0495632_0094590_226_765 172
190 3300046524 Ga0495648_0000390 Ga0495648_0000390_42628_43146 172
191 3300046524 Ga0495648_0049418 Ga0495648_0049418_2031_2549 172
192 3300046529 Ga0495652_0094337 Ga0495652_0094337_852_1370 172
193 3300046538 Ga0495609_0006629 Ga0495609_0006629_3982_4500 172
194 3300046616 Ga0495668_0000044 Ga0495668_0000044_218103_218621 172
195 3300046660 Ga0495625_0000772 Ga0495625_0000772_1545_2063 172
196 3300046810 Ga0495660_0331033 Ga0495660_0331033_136_654 172
197 3300048089 Ga0495614_0069374 Ga0495614_0069374_161_679 172
198 3300048917 Ga0496114_0000332 Ga0496114_0000332_31113_31631 172
199 3300048917 Ga0496114_1037473 Ga0496114_1037473_115_636 172
200 3300048924 Ga0496121_0000007 Ga0496121_0000007_345234_345755 172
201 3300049460 Ga0495682_0042892 Ga0495682_0042892_509_1027 172
202 3300050492 nmdc:mga0yw44_76099_c1 nmdc:mga0yw44_76099_c1_795_1313 172
203 3300050494 nmdc:mga06z11_218960_c1 nmdc:mga06z11_218960_c1_382_900 172
204 3300053089 Ga0500581_083167 Ga0500581_083167_535_1053 172
205 3300053090 Ga0500646_0005008 Ga0500646_0005008_574_1092 172
206 3300053090 Ga0500646_0066297 Ga0500646_0066297_385_903 172
207 3300053092 Ga0500583_0000035 Ga0500583_0000035_27159_27677 172
208 3300053092 Ga0500583_0000835 Ga0500583_0000835_4902_5420 172
209 3300053098 Ga0500650_0065300 Ga0500650_0065300_1073_1591 172
210 3300053104 Ga0500556_0001963 Ga0500556_0001963_776_1294 172
211 3300053104 Ga0500556_0230739 Ga0500556_0230739_54_572 172
212 3300053130 Ga0500642_0179767 Ga0500642_0179767_216_734 172
213 3300053147 Ga0500589_003789 Ga0500589_003789_2668_3186 172
214 3300053153 Ga0500616_0005442 Ga0500616_0005442_3909_4427 172
215 3300053160 Ga0500633_0029834 Ga0500633_0029834_677_1195 172
216 3300053161 Ga0500634_0076327 Ga0500634_0076327_331_849 172

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t2s-assembly1.cif.gz_A-2 structure of e. coli upec-117 cap18 3'-5' exonuclease 0.9014 2 163
7t2s-assembly1.cif.gz_A-2 structure of e. coli upec-117 cap18 3'-5' exonuclease 0.8473 2 163
4js4-assembly3.cif.gz_B crystal structure of e. coli exonuclease i in complex with a da16 oligonucleotide 0.7912 2 164
1zbu-assembly4.cif.gz_D crystal structure of full-length 3'-exonuclease 0.7857 2 165
3cm6-assembly1.cif.gz_B crystal structure of cell-death related nuclease 4 (crn-4) bound with er 0.7855 2 167
ID Description Score Start End Superfamily
af_Q2G1Z8_409_554_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8585 2 130 3.30.420.10
af_Q682U6_109_294_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8392 1 171 3.30.420.10
af_Q9VQJ7_18_335_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8331 1 130 3.30.420.10
af_Q682U6_109_294_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8303 1 171 3.30.420.10
af_Q2FY88_1_175_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8089 3 165 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A098LD25-F1-model_v4 Exonuclease domain-containing protein 0.9991 1 110 GO:0003676
AF-A0A847LH36-F1-model_v4 Exonuclease 0.9952 1 170 GO:0003676
GO:0004527
GO:0006259
AF-A0A518DLU7-F1-model_v4 Exonuclease domain-containing protein 0.9945 1 91 GO:0003676
AF-A0A518HC93-F1-model_v4 Exonuclease domain-containing protein 0.9942 1 172 GO:0003676
GO:0004527
GO:0006259
AF-A0A098LD25-F1-model_v4 Exonuclease domain-containing protein 0.9901 1 110 GO:0003676

Feature Viewer

pLDDT pTM Quality
96.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map