F327831

General Info

Members Datasets Scaffolds Average Seq Length
216 138 432 209

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0389970|Ga0436365_0389970_18449_19207
Length 252
Sequence MEYHILCGNAVATLWLGGNSRPAYSRNSNTRMAHGESRHHPHQSAEAKVPILHQMQVSGNCYKVRLAAHQLGIPLTLLEYELLAGDTRKPAFLCKNANGRVPLLELDDGRCLAESDAILWYLSEGTPLQPDDNWSRAQALSWMFFEQYSHEPYIAVARYWLKYAPKERLEKKRHLVQEWHESGNAALKVMDTHLAAHDWFAGERYSIADIALYGYTHCADEGGFELAESPAVLAWLDRVKAQPGHIPLAFSW

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
136 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 0.93
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0389970 3300039437 Bacteria 46503
2 Ga0070683_100215649 3300005329 Bacteria 1824
3 Ga0070666_10000928 3300005335 Bacteria 17790
4 Ga0070660_100304791 3300005339 Bacteria 1306
5 Ga0070689_100058253 3300005340 Bacteria 3000
6 Ga0070661_100001673 3300005344 Bacteria 15360
7 Ga0070661_100161296 3300005344 Bacteria 1698
8 Ga0070671_100145715 3300005355 Bacteria 1999
9 Ga0070667_100082183 3300005367 Bacteria 2757
10 Ga0070709_10013933 3300005434 Bacteria 4534
11 Ga0070714_100217096 3300005435 Bacteria 1756
12 Ga0070714_100399262 3300005435 Bacteria 1299
13 Ga0070713_100103061 3300005436 Bacteria 2476
14 Ga0070713_100456419 3300005436 Bacteria 1201
15 Ga0070710_10122802 3300005437 Bacteria 1574
16 Ga0070710_10212485 3300005437 Unclassified 1227
17 Ga0070711_100022785 3300005439 Bacteria 4064
18 Ga0070711_100095702 3300005439 Bacteria 2149
19 Ga0070681_10009074 3300005458 Bacteria 9774
20 Ga0068867_100439376 3300005459 Bacteria 1109
21 Ga0070699_100182088 3300005518 Bacteria 1865
22 Ga0068853_100015650 3300005539 Bacteria 6230
23 Ga0068853_100204339 3300005539 Bacteria 1798
24 Ga0070695_100025423 3300005545 Bacteria 3656
25 Ga0070696_100164189 3300005546 Bacteria 1638
26 Ga0070693_100077641 3300005547 Bacteria 1971
27 Ga0068855_100547724 3300005563 Bacteria 1253
28 Ga0068857_100078143 3300005577 Bacteria 2953
29 Ga0068854_100685028 3300005578 Bacteria 883
30 Ga0068852_100019792 3300005616 Bacteria 5337
31 Ga0068858_100024934 3300005842 Bacteria 5566
32 Ga0068860_100171152 3300005843 Bacteria 2098
33 Ga0081540_1001643 3300005983 Bacteria 19035
34 Ga0070712_100001801 3300006175 Bacteria 13093
35 Ga0097621_100305702 3300006237 Bacteria 1406
36 Ga0068871_100804263 3300006358 Bacteria 867
37 Ga0105240_10432300 3300009093 Bacteria 1477
38 Ga0111539_11150818 3300009094 Bacteria 901
39 Ga0105245_10204758 3300009098 Bacteria 1896
40 Ga0105241_10291553 3300009174 Bacteria 1397
41 Ga0105241_10513578 3300009174 Bacteria 1070
42 Ga0105248_10650281 3300009177 Bacteria 1190
43 Ga0105238_10094530 3300009551 Bacteria 2977
44 Ga0105238_10118495 3300009551 Bacteria 2627
45 Ga0099796_10031690 3300010159 Bacteria 1726
46 Ga0105239_10002511 3300010375 Bacteria 23340
47 Ga0105239_10007373 3300010375 Bacteria 12635
48 Ga0105246_10125590 3300011119 Bacteria 1908
49 Ga0157369_10670489 3300013105 Bacteria 1069
50 Ga0157374_10556581 3300013296 Bacteria 1155
51 Ga0157372_10200637 3300013307 Bacteria 2310
52 Ga0157372_10220425 3300013307 Bacteria 2199
53 Ga0157372_10622120 3300013307 Bacteria 1258
54 Ga0157380_10478759 3300014326 Bacteria 1203
55 Ga0157379_10004622 3300014968 Bacteria 11811
56 Ga0157379_10007146 3300014968 Bacteria 9655
57 Ga0157376_10856261 3300014969 Bacteria 924
58 Ga0213876_10000719 3300021384 Bacteria 23133
59 Ga0209051_1007311 3300025303 Bacteria 6059
60 Ga0207692_10224532 3300025898 Bacteria 1115
61 Ga0207680_10000745 3300025903 Bacteria 15334
62 Ga0207680_10001130 3300025903 Bacteria 12611
63 Ga0207680_10602671 3300025903 Bacteria 786
64 Ga0207647_10000694 3300025904 Bacteria 26349
65 Ga0207699_10653770 3300025906 Bacteria 768
66 Ga0207654_10026324 3300025911 Bacteria 3149
67 Ga0207707_10037208 3300025912 Bacteria 4252
68 Ga0207695_10000003 3300025913 Bacteria 1368691
69 Ga0207695_10021403 3300025913 Bacteria 7377
70 Ga0207695_10067757 3300025913 Bacteria 3660
71 Ga0207695_10251736 3300025913 Bacteria 1665
72 Ga0207695_10396906 3300025913 Bacteria 1264
73 Ga0207657_10032885 3300025919 Bacteria 4680
74 Ga0207649_10000497 3300025920 Bacteria 27895
75 Ga0207694_10000016 3300025924 Bacteria 349087
76 Ga0207659_10632634 3300025926 Bacteria 914
77 Ga0207700_10105025 3300025928 Bacteria 2261
78 Ga0207706_10265068 3300025933 Bacteria 1499
79 Ga0207711_10000003 3300025941 Bacteria 1042791
80 Ga0207711_10000005 3300025941 Bacteria 822972
81 Ga0207711_10000009 3300025941 Bacteria 580864
82 Ga0207711_10000015 3300025941 Bacteria 494097
83 Ga0207711_10526527 3300025941 Bacteria 1102
84 Ga0207667_10000021 3300025949 Bacteria 370524
85 Ga0207667_10045764 3300025949 Bacteria 4633
86 Ga0207667_10285724 3300025949 Bacteria 1686
87 Ga0207667_10398268 3300025949 Bacteria 1402
88 Ga0207667_10694960 3300025949 Bacteria 1020
89 Ga0207651_10359782 3300025960 Bacteria 1228
90 Ga0207703_10012152 3300026035 Bacteria 6710
91 Ga0207639_10008280 3300026041 Bacteria 7123
92 Ga0207639_10057008 3300026041 Bacteria 2997
93 Ga0207639_10098635 3300026041 Bacteria 2355
94 Ga0207639_10126155 3300026041 Bacteria 2111
95 Ga0207674_10011332 3300026116 Bacteria 10019
96 Ga0207674_10100776 3300026116 Bacteria 2869
97 Ga0207674_10102387 3300026116 Bacteria 2844
98 Ga0207675_100224270 3300026118 Bacteria 1811
99 Ga0207698_10100400 3300026142 Bacteria 2397
100 Ga0265338_10189158 3300028800 Bacteria 1562
101 Ga0265330_10178276 3300031235 Bacteria 900
102 Ga0265320_10000179 3300031240 Bacteria 53742
103 Ga0265325_10050793 3300031241 Bacteria 2134
104 Ga0265340_10000080 3300031247 Bacteria 46799
105 Ga0265340_10005944 3300031247 Bacteria 6743
106 Ga0265340_10066914 3300031247 Bacteria 1708
107 Ga0265339_10032481 3300031249 Bacteria 2943
108 Ga0265331_10000080 3300031250 Bacteria 137743
109 Ga0265331_10001287 3300031250 Bacteria 18686
110 Ga0265327_10000095 3300031251 Bacteria 194803
111 Ga0265316_10031713 3300031344 Bacteria 4318
112 Ga0265316_10380218 3300031344 Bacteria 1019
113 Ga0265313_10026191 3300031595 Bacteria 3077
114 Ga0265313_10083338 3300031595 Bacteria 1448
115 Ga0265313_10275914 3300031595 Bacteria 680
116 Ga0307508_10034894 3300031616 Bacteria 4533
117 Ga0265314_10000522 3300031711 Bacteria 49570
118 Ga0265314_10043363 3300031711 Bacteria 3199
119 Ga0265314_10054310 3300031711 Bacteria 2773
120 Ga0265342_10007308 3300031712 Bacteria 8108
121 Ga0265342_10022010 3300031712 Bacteria 4061
122 Ga0316576_10029660 3300031727 Bacteria 3869
123 Ga0316578_10025285 3300031728 Bacteria 3337
124 Ga0307410_10207615 3300031852 Bacteria 1499
125 Ga0307409_100161770 3300031995 Bacteria 1959
126 Ga0307416_101461515 3300032002 Bacteria 789
127 Ga0307416_101478717 3300032002 Bacteria 785
128 Ga0373936_0028940 3300035113 Bacteria 2180
129 Ga0373945_0039974 3300035116 Bacteria 1692
130 Ga0373954_0156103 3300035118 Bacteria 1116
131 Ga0373943_0003679 3300035170 Bacteria 6971
132 Ga0316574_0002023 3300035398 Bacteria 9987
133 Ga0373935_0022744 3300035692 Bacteria 3848
134 Ga0373927_0056211 3300035695 Bacteria 2544
135 Ga0373947_0002202 3300035725 Bacteria 11807
136 Ga0373947_0173166 3300035725 Bacteria 1402
137 Ga0373947_0308965 3300035725 Bacteria 1056
138 Ga0373937_0015860 3300036401 Bacteria 6679
139 Ga0373937_0017255 3300036401 Bacteria 6427
140 Ga0373925_0003131 3300037068 Bacteria 12991
141 Ga0373925_0166323 3300037068 Bacteria 1739
142 Ga0373925_0182699 3300037068 Bacteria 1661
143 Ga0436365_0148693 3300039437 Bacteria 883
144 Ga0436365_1004240 3300039437 Bacteria 80154
145 Ga0436361_0011589 3300039447 Bacteria 3819
146 Ga0436363_1540603 3300039450 Bacteria 3774
147 Ga0451577_0122552 3300042876 Bacteria 2329
148 Ga0495641_0229505 3300046461 Bacteria 833
149 Ga0495580_0263861 3300046472 Bacteria 1177
150 Ga0495582_0074512 3300046473 Bacteria 1879
151 Ga0495652_0060713 3300046529 Bacteria 3194
152 Ga0495652_0521216 3300046529 Bacteria 821
153 Ga0495665_0036473 3300046531 Bacteria 2625
154 Ga0495665_0203787 3300046531 Bacteria 1025
155 Ga0495586_0153145 3300046535 Bacteria 1298
156 Ga0495586_0284879 3300046535 Bacteria 946
157 Ga0495645_0028954 3300046543 Bacteria 4025
158 Ga0495645_0236796 3300046543 Bacteria 1220
159 Ga0495599_0597473 3300046678 Bacteria 643
160 Ga0495658_0002905 3300046683 Bacteria 8603
161 Ga0495658_0209919 3300046683 Bacteria 1216
162 Ga0495600_0271830 3300046809 Bacteria 1075
163 Ga0495674_0182584 3300047319 Bacteria 1746
164 Ga0495680_0300521 3300047322 Bacteria 1127
165 Ga0495677_0150048 3300047445 Bacteria 897
166 Ga0496106_0307451 3300048909 Bacteria 1272
167 Ga0496111_0403635 3300048914 Bacteria 1010
168 Ga0501032_0056277 3300049569 Bacteria 2644
169 Ga0501034_0012246 3300049571 Bacteria 8864
170 Ga0501034_0294584 3300049571 Bacteria 1560
171 Ga0501036_0076353 3300049572 Bacteria 2834
172 Ga0501036_0210364 3300049572 Bacteria 1634
173 Ga0501038_0113425 3300049574 Bacteria 2243
174 Ga0501038_0188151 3300049574 Bacteria 1662
175 Ga0501039_0142787 3300049575 Bacteria 1881
176 Ga0501046_0113455 3300049580 Bacteria 2068
177 Ga0501047_0012081 3300049581 Bacteria 8174
178 Ga0501047_0122671 3300049581 Bacteria 2479
179 Ga0501047_0232299 3300049581 Bacteria 1697
180 Ga0501048_0240000 3300049582 Bacteria 1286
181 Ga0501067_0005166 3300049583 Bacteria 7258
182 Ga0501067_0051886 3300049583 Bacteria 2272
183 Ga0501068_0068780 3300049584 Bacteria 2158
184 Ga0501068_0246762 3300049584 Bacteria 1137
185 Ga0501069_0022706 3300049585 Bacteria 3416
186 Ga0501069_0197907 3300049585 Bacteria 1164
187 Ga0501070_0004392 3300049586 Bacteria 12110
188 Ga0501070_0043432 3300049586 Bacteria 3740
189 Ga0501070_0541862 3300049586 Unclassified 932
190 Ga0501072_0022150 3300049588 Bacteria 4929
191 Ga0501073_0188763 3300049589 Bacteria 1426
192 Ga0501073_0220787 3300049589 Bacteria 1309
193 Ga0501073_0320023 3300049589 Bacteria 1070
194 Ga0501074_0087158 3300049590 Bacteria 2236
195 Ga0501079_0067460 3300049741 Bacteria 2761
196 Ga0501079_0133875 3300049741 Bacteria 1929
197 Ga0501080_0057049 3300049742 Bacteria 3636
198 Ga0501080_0061741 3300049742 Bacteria 3488
199 Ga0501080_0086971 3300049742 Bacteria 2904
200 Ga0501080_0333870 3300049742 Bacteria 1370
201 Ga0501080_0741386 3300049742 Bacteria 864
202 Ga0501083_0123433 3300049744 Bacteria 1698
203 Ga0501035_0022427 3300049822 Bacteria 5798
204 Ga0501035_0100663 3300049822 Bacteria 2537
205 Ga0501044_0031957 3300049823 Bacteria 5534
206 Ga0501044_0040392 3300049823 Bacteria 4862
207 Ga0501044_0079211 3300049823 Bacteria 3329
208 Ga0501044_0137294 3300049823 Bacteria 2436
209 Ga0501044_0171125 3300049823 Bacteria 2143
210 Ga0500651_0012922 3300053093 Bacteria 5073
211 Ga0500651_0173557 3300053093 Bacteria 1284
212 Ga0500636_0282325 3300053177 Bacteria 828
213 Ga0501084_0001265 3300054114 Bacteria 19921
214 Ga0501084_0034780 3300054114 Bacteria 4213
215 Ga0501082_0050644 3300060353 Bacteria 3581
216 Ga0501082_0140248 3300060353 Bacteria 2098
217 Ga0436365_0389970
218 Ga0070683_100215649
219 Ga0070666_10000928
220 Ga0070660_100304791
221 Ga0070689_100058253
222 Ga0070661_100001673
223 Ga0070661_100161296
224 Ga0070671_100145715
225 Ga0070667_100082183
226 Ga0070709_10013933
227 Ga0070714_100217096
228 Ga0070714_100399262
229 Ga0070713_100103061
230 Ga0070713_100456419
231 Ga0070710_10122802
232 Ga0070710_10212485
233 Ga0070711_100022785
234 Ga0070711_100095702
235 Ga0070681_10009074
236 Ga0068867_100439376
237 Ga0070699_100182088
238 Ga0068853_100015650
239 Ga0068853_100204339
240 Ga0070695_100025423
241 Ga0070696_100164189
242 Ga0070693_100077641
243 Ga0068855_100547724
244 Ga0068857_100078143
245 Ga0068854_100685028
246 Ga0068852_100019792
247 Ga0068858_100024934
248 Ga0068860_100171152
249 Ga0081540_1001643
250 Ga0070712_100001801
251 Ga0097621_100305702
252 Ga0068871_100804263
253 Ga0105240_10432300
254 Ga0111539_11150818
255 Ga0105245_10204758
256 Ga0105241_10291553
257 Ga0105241_10513578
258 Ga0105248_10650281
259 Ga0105238_10094530
260 Ga0105238_10118495
261 Ga0099796_10031690
262 Ga0105239_10002511
263 Ga0105239_10007373
264 Ga0105246_10125590
265 Ga0157369_10670489
266 Ga0157374_10556581
267 Ga0157372_10200637
268 Ga0157372_10220425
269 Ga0157372_10622120
270 Ga0157380_10478759
271 Ga0157379_10004622
272 Ga0157379_10007146
273 Ga0157376_10856261
274 Ga0213876_10000719
275 Ga0209051_1007311
276 Ga0207692_10224532
277 Ga0207680_10000745
278 Ga0207680_10001130
279 Ga0207680_10602671
280 Ga0207647_10000694
281 Ga0207699_10653770
282 Ga0207654_10026324
283 Ga0207707_10037208
284 Ga0207695_10000003
285 Ga0207695_10021403
286 Ga0207695_10067757
287 Ga0207695_10251736
288 Ga0207695_10396906
289 Ga0207657_10032885
290 Ga0207649_10000497
291 Ga0207694_10000016
292 Ga0207659_10632634
293 Ga0207700_10105025
294 Ga0207706_10265068
295 Ga0207711_10000003
296 Ga0207711_10000005
297 Ga0207711_10000009
298 Ga0207711_10000015
299 Ga0207711_10526527
300 Ga0207667_10000021
301 Ga0207667_10045764
302 Ga0207667_10285724
303 Ga0207667_10398268
304 Ga0207667_10694960
305 Ga0207651_10359782
306 Ga0207703_10012152
307 Ga0207639_10008280
308 Ga0207639_10057008
309 Ga0207639_10098635
310 Ga0207639_10126155
311 Ga0207674_10011332
312 Ga0207674_10100776
313 Ga0207674_10102387
314 Ga0207675_100224270
315 Ga0207698_10100400
316 Ga0265338_10189158
317 Ga0265330_10178276
318 Ga0265320_10000179
319 Ga0265325_10050793
320 Ga0265340_10000080
321 Ga0265340_10005944
322 Ga0265340_10066914
323 Ga0265339_10032481
324 Ga0265331_10000080
325 Ga0265331_10001287
326 Ga0265327_10000095
327 Ga0265316_10031713
328 Ga0265316_10380218
329 Ga0265313_10026191
330 Ga0265313_10083338
331 Ga0265313_10275914
332 Ga0307508_10034894
333 Ga0265314_10000522
334 Ga0265314_10043363
335 Ga0265314_10054310
336 Ga0265342_10007308
337 Ga0265342_10022010
338 Ga0316576_10029660
339 Ga0316578_10025285
340 Ga0307410_10207615
341 Ga0307409_100161770
342 Ga0307416_101461515
343 Ga0307416_101478717
344 Ga0373936_0028940
345 Ga0373945_0039974
346 Ga0373954_0156103
347 Ga0373943_0003679
348 Ga0316574_0002023
349 Ga0373935_0022744
350 Ga0373927_0056211
351 Ga0373947_0002202
352 Ga0373947_0173166
353 Ga0373947_0308965
354 Ga0373937_0015860
355 Ga0373937_0017255
356 Ga0373925_0003131
357 Ga0373925_0166323
358 Ga0373925_0182699
359 Ga0436365_0148693
360 Ga0436365_1004240
361 Ga0436361_0011589
362 Ga0436363_1540603
363 Ga0451577_0122552
364 Ga0495641_0229505
365 Ga0495580_0263861
366 Ga0495582_0074512
367 Ga0495652_0060713
368 Ga0495652_0521216
369 Ga0495665_0036473
370 Ga0495665_0203787
371 Ga0495586_0153145
372 Ga0495586_0284879
373 Ga0495645_0028954
374 Ga0495645_0236796
375 Ga0495599_0597473
376 Ga0495658_0002905
377 Ga0495658_0209919
378 Ga0495600_0271830
379 Ga0495674_0182584
380 Ga0495680_0300521
381 Ga0495677_0150048
382 Ga0496106_0307451
383 Ga0496111_0403635
384 Ga0501032_0056277
385 Ga0501034_0012246
386 Ga0501034_0294584
387 Ga0501036_0076353
388 Ga0501036_0210364
389 Ga0501038_0113425
390 Ga0501038_0188151
391 Ga0501039_0142787
392 Ga0501046_0113455
393 Ga0501047_0012081
394 Ga0501047_0122671
395 Ga0501047_0232299
396 Ga0501048_0240000
397 Ga0501067_0005166
398 Ga0501067_0051886
399 Ga0501068_0068780
400 Ga0501068_0246762
401 Ga0501069_0022706
402 Ga0501069_0197907
403 Ga0501070_0004392
404 Ga0501070_0043432
405 Ga0501070_0541862
406 Ga0501072_0022150
407 Ga0501073_0188763
408 Ga0501073_0220787
409 Ga0501073_0320023
410 Ga0501074_0087158
411 Ga0501079_0067460
412 Ga0501079_0133875
413 Ga0501080_0057049
414 Ga0501080_0061741
415 Ga0501080_0086971
416 Ga0501080_0333870
417 Ga0501080_0741386
418 Ga0501083_0123433
419 Ga0501035_0022427
420 Ga0501035_0100663
421 Ga0501044_0031957
422 Ga0501044_0040392
423 Ga0501044_0079211
424 Ga0501044_0137294
425 Ga0501044_0171125
426 Ga0500651_0012922
427 Ga0500651_0173557
428 Ga0500636_0282325
429 Ga0501084_0001265
430 Ga0501084_0034780
431 Ga0501082_0050644
432 Ga0501082_0140248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

48

124

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

173

238

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

57

124

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

52

130

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

141

243

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

154

245

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9694 2 200
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9553 2 200
4hz2-assembly1.cif.gz_A crystal structure of glutathione s-transferase xaut_3756 (target efi-507152) from xanthobacter autotrophicus py2 0.9525 1 199
3m8n-assembly2.cif.gz_C crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9388 2 202
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9343 2 202
ID Description Score Start End Superfamily
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9659 1 76 3.40.30.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9536 2 76 3.40.30.10
3m3mA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9492 82 197 1.20.1050.10
4e8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9438 2 77 3.40.30.10
af_Q7JYX0_7_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9415 4 76 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3C0XCK6-F1-model_v4 deleted 0.9979 90 209
AF-B0RW10-F1-model_v4 Glutathione S-transferase family protein 0.9968 2 202
AF-G0CLF1-F1-model_v4 deleted 0.9967 2 202
AF-A0A4R4IDC8-F1-model_v4 Glutathione S-transferase family protein 0.9966 2 212 GO:0016740
AF-A0A246KQP6-F1-model_v4 Glutathione S-transferase family protein 0.9962 2 211 GO:0016740

Map