F327810

General Info

Members Datasets Scaffolds Average Seq Length
216 100 432 313

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0001131|Ga0395900_0001131_7381_8388
Length 335
Sequence MVLTLLTRHWMARRHYPFASWAACIARSLRVLLFRRAHLELLAMDVYRNYVTQVHDDVFHHLSHRNYLAKGLSLRQRVRCVLTHYRFEDATFDAAYKHAVYRDGGLVLWRHEAAGSRVEVRLGMAQRLNAEGDLTLSLLADGKCVHRLSFSWVDERFAGTAAPGGPGMVPFIARNQGPRTGALDAVDAFRHAFPGNSPLVTTPGFFCFAALQGIAQALSMGQVMAVKSAWHCAYDPSDEKHFANAYDGFWRILGGHELPGRAWHITLPFYMKPLAEMPSKHRKRAVVRREQWRAIAESACQALQCRMTQADDRTGAPVDTSLQAGRETASEHPLS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
6 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
7 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
8 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
9 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
10 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
11 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
12 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
13 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
14 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
15 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
16 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
17 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
18 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
19 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
20 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
21 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
22 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
23 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
24 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
25 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
26 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
27 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
28 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
29 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
30 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
31 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
32 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
33 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
34 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
35 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
36 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
37 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
38 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
39 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
40 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
41 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
42 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
43 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
44 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
45 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
46 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
47 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
48 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
49 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
50 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
51 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
52 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
53 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
54 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
55 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
56 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
57 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
58 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
59 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
60 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
61 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
62 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
63 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
64 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
65 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
66 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
67 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
68 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
69 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
70 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
71 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
72 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
76 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
77 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
80 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
81 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
84 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
96 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
99 2643221684 Massilia sp. Root133 Isolate Unclassified
100 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 5.09
Rhizosphere 90.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0001131 3300037418 Bacteria 33729
2 rootL2_10012908 3300003322 Bacteria 6121
3 Ga0055542_1009285 3300003762 Bacteria 1865
4 Ga0070658_10228548 3300005327 Bacteria 1575
5 Ga0070664_100075355 3300005564 Bacteria 2897
6 Ga0157372_10474568 3300013307 Bacteria 1458
7 Ga0209148_1001160 3300025254 Bacteria 15323
8 Ga0207674_10363129 3300026116 Bacteria 1400
9 Ga0395899_0056898 3300037312 Bacteria 2888
10 Ga0395899_0088799 3300037312 Bacteria 2242
11 Ga0395899_0119039 3300037312 Bacteria 1893
12 Ga0395899_0255494 3300037312 Bacteria 1201
13 Ga0395900_0051201 3300037418 Bacteria 4254
14 Ga0395900_0104272 3300037418 Bacteria 2913
15 Ga0395900_0124955 3300037418 Bacteria 2638
16 Ga0395900_0125430 3300037418 Bacteria 2633
17 Ga0395900_0197966 3300037418 Bacteria 2034
18 Ga0395898_0068091 3300037466 Bacteria 3445
19 Ga0395898_0122509 3300037466 Bacteria 2491
20 Ga0395898_0441091 3300037466 Bacteria 1240
21 Ga0395905_0042611 3300037471 Bacteria 4259
22 Ga0395905_0068791 3300037471 Bacteria 3316
23 Ga0395905_0215948 3300037471 Bacteria 1796
24 Ga0395905_0329724 3300037471 Bacteria 1416
25 Ga0395901_0000044 3300038443 Bacteria 197088
26 Ga0395901_0071544 3300038443 Bacteria 3614
27 Ga0395901_0181377 3300038443 Bacteria 2208
28 Ga0439448_0036071 3300042005 Bacteria 1585
29 Ga0439455_0033778 3300042012 Bacteria 1284
30 Ga0439458_0023735 3300042157 Bacteria 1431
31 Ga0466969_0022649 3300044656 Bacteria 3242
32 Ga0466972_0019958 3300044658 Bacteria 3349
33 Ga0466965_0037995 3300044683 Bacteria 2364
34 Ga0466966_0006432 3300044684 Bacteria 7772
35 Ga0466966_0018470 3300044684 Bacteria 4598
36 Ga0466966_0036823 3300044684 Bacteria 3158
37 Ga0466961_0028044 3300044693 Bacteria 3621
38 Ga0466963_0014755 3300044694 Bacteria 4823
39 Ga0466964_0017997 3300044706 Bacteria 2707
40 Ga0466968_0000823 3300044735 Bacteria 10800
41 Ga0466957_0001388 3300044842 Bacteria 12635
42 Ga0466957_0078697 3300044842 Bacteria 2050
43 Ga0466957_0088612 3300044842 Bacteria 1936
44 Ga0466959_0200265 3300045049 Bacteria 1390
45 Ga0466959_0207726 3300045049 Bacteria 1361
46 Ga0466958_0027177 3300045836 Bacteria 3386
47 Ga0466958_0104838 3300045836 Bacteria 1761
48 Ga0466967_0007135 3300045976 Bacteria 8018
49 Ga0466967_0187321 3300045976 Bacteria 1954
50 Ga0495617_000022 3300046452 Bacteria 185975
51 Ga0495627_000222 3300046453 Bacteria 61109
52 Ga0495627_001957 3300046453 Bacteria 10666
53 Ga0495603_0184296 3300046455 Bacteria 1207
54 Ga0495590_0005682 3300046457 Bacteria 4906
55 Ga0495590_0033412 3300046457 Bacteria 1799
56 Ga0495650_0000351 3300046471 Bacteria 81358
57 Ga0495650_0009956 3300046471 Bacteria 5353
58 Ga0495582_0002544 3300046473 Bacteria 10153
59 Ga0495582_0062238 3300046473 Bacteria 2061
60 Ga0495605_0000064 3300046474 Bacteria 140769
61 Ga0495605_0012241 3300046474 Bacteria 4764
62 Ga0495605_0016235 3300046474 Bacteria 4033
63 Ga0495639_0075677 3300046475 Archaea 1561
64 Ga0495584_0000031 3300046491 Bacteria 100128
65 Ga0495584_0004078 3300046491 Bacteria 7886
66 Ga0495584_0121345 3300046491 Bacteria 1323
67 Ga0495584_0128532 3300046491 Bacteria 1285
68 Ga0495585_0018175 3300046492 Bacteria 4056
69 Ga0495585_0049209 3300046492 Bacteria 2341
70 Ga0495594_0003125 3300046499 Bacteria 8562
71 Ga0495594_0036506 3300046499 Bacteria 2680
72 Ga0495596_0004448 3300046500 Bacteria 6820
73 Ga0495596_0004957 3300046500 Bacteria 6381
74 Ga0495596_0012700 3300046500 Bacteria 3595
75 Ga0495596_0013450 3300046500 Bacteria 3471
76 Ga0495596_0013725 3300046500 Bacteria 3427
77 Ga0495607_0003075 3300046501 Bacteria 12972
78 Ga0495607_0004918 3300046501 Bacteria 9716
79 Ga0495607_0098623 3300046501 Bacteria 1568
80 Ga0495583_0000658 3300046506 Bacteria 45286
81 Ga0495583_0051744 3300046506 Bacteria 1871
82 Ga0495583_0080141 3300046506 Bacteria 1419
83 Ga0495583_0120026 3300046506 Bacteria 1107
84 Ga0495606_0004509 3300046507 Bacteria 13865
85 Ga0495606_0197602 3300046507 Bacteria 1148
86 Ga0495616_0001227 3300046513 Bacteria 18037
87 Ga0495616_0051128 3300046513 Bacteria 2062
88 Ga0495616_0090567 3300046513 Bacteria 1448
89 Ga0495631_0027485 3300046518 Bacteria 2602
90 Ga0495632_0000026 3300046519 Bacteria 176367
91 Ga0495632_0000072 3300046519 Bacteria 104826
92 Ga0495632_0065015 3300046519 Bacteria 1763
93 Ga0495643_0001162 3300046522 Bacteria 25735
94 Ga0495643_0017338 3300046522 Bacteria 4210
95 Ga0495644_0019358 3300046523 Bacteria 2599
96 Ga0495644_0071641 3300046523 Bacteria 1302
97 Ga0495644_0091344 3300046523 Bacteria 1149
98 Ga0495648_0005189 3300046524 Bacteria 10896
99 Ga0495648_0008358 3300046524 Bacteria 8157
100 Ga0495648_0039204 3300046524 Bacteria 3017
101 Ga0495648_0135624 3300046524 Bacteria 1302
102 Ga0495666_0027528 3300046526 Bacteria 2797
103 Ga0495642_0000226 3300046528 Bacteria 32285
104 Ga0495642_0000321 3300046528 Bacteria 26150
105 Ga0495642_0004215 3300046528 Bacteria 5597
106 Ga0495642_0042743 3300046528 Bacteria 1847
107 Ga0495642_0058211 3300046528 Bacteria 1599
108 Ga0495652_0020878 3300046529 Bacteria 5820
109 Ga0495654_0004111 3300046530 Bacteria 8731
110 Ga0495654_0012645 3300046530 Bacteria 4530
111 Ga0495665_0014417 3300046531 Bacteria 4263
112 Ga0495587_0139792 3300046536 Bacteria 1382
113 Ga0495609_0000150 3300046538 Bacteria 72210
114 Ga0495609_0003172 3300046538 Bacteria 9569
115 Ga0495609_0006301 3300046538 Bacteria 6072
116 Ga0495609_0021416 3300046538 Bacteria 2982
117 Ga0495609_0075509 3300046538 Bacteria 1477
118 Ga0495609_0136913 3300046538 Bacteria 1046
119 Ga0495597_0000032 3300046542 Bacteria 126825
120 Ga0495597_0001221 3300046542 Bacteria 19125
121 Ga0495622_0013767 3300046557 Bacteria 3750
122 Ga0495633_0035097 3300046558 Bacteria 2409
123 Ga0495668_0000320 3300046616 Bacteria 65752
124 Ga0495668_0001598 3300046616 Bacteria 21231
125 Ga0495668_0003400 3300046616 Bacteria 11950
126 Ga0495668_0012763 3300046616 Bacteria 4975
127 Ga0495668_0065194 3300046616 Archaea 2005
128 Ga0495634_0015257 3300046642 Bacteria 5524
129 Ga0495611_0099668 3300046648 Bacteria 1348
130 Ga0495625_0034083 3300046660 Bacteria 3759
131 Ga0495625_0056386 3300046660 Bacteria 2797
132 Ga0495625_0140443 3300046660 Bacteria 1630
133 Ga0495661_0001944 3300046665 Bacteria 16399
134 Ga0495661_0035317 3300046665 Bacteria 3137
135 Ga0495661_0045523 3300046665 Bacteria 2682
136 Ga0495661_0053691 3300046665 Bacteria 2422
137 Ga0495661_0075282 3300046665 Bacteria 1962
138 Ga0495661_0094800 3300046665 Bacteria 1691
139 Ga0495661_0130189 3300046665 Bacteria 1379
140 Ga0495661_0149593 3300046665 Bacteria 1262
141 Ga0495588_0000125 3300046674 Bacteria 130469
142 Ga0495588_0004296 3300046674 Bacteria 6281
143 Ga0495588_0008781 3300046674 Bacteria 4644
144 Ga0495588_0016814 3300046674 Bacteria 3540
145 Ga0495623_0033530 3300046679 Bacteria 3294
146 Ga0495623_0036889 3300046679 Bacteria 3131
147 Ga0495646_0065932 3300046680 Bacteria 2143
148 Ga0495669_0000105 3300046684 Bacteria 53515
149 Ga0495669_0001322 3300046684 Bacteria 10256
150 Ga0495669_0014621 3300046684 Bacteria 3355
151 Ga0495613_0032213 3300046689 Bacteria 3893
152 Ga0495670_0030482 3300046691 Bacteria 2679
153 Ga0495670_0088521 3300046691 Bacteria 1582
154 Ga0495671_0000059 3300046692 Bacteria 107979
155 Ga0495671_0003557 3300046692 Bacteria 9520
156 Ga0495649_0007003 3300046694 Bacteria 6955
157 Ga0495649_0016665 3300046694 Bacteria 4164
158 Ga0495649_0052653 3300046694 Bacteria 2205
159 Ga0495649_0059582 3300046694 Bacteria 2055
160 Ga0495589_0002201 3300046794 Bacteria 10976
161 Ga0495589_0049374 3300046794 Bacteria 2082
162 Ga0495589_0053634 3300046794 Bacteria 1989
163 Ga0495600_0028913 3300046809 Bacteria 3587
164 Ga0495660_0000147 3300046810 Bacteria 76712
165 Ga0495660_0003406 3300046810 Bacteria 9841
166 Ga0495660_0010900 3300046810 Bacteria 5281
167 Ga0495660_0023395 3300046810 Bacteria 3524
168 Ga0495660_0051244 3300046810 Bacteria 2246
169 Ga0495672_0000101 3300047320 Bacteria 139193
170 Ga0495672_0000166 3300047320 Bacteria 95954
171 Ga0495672_0000314 3300047320 Bacteria 64460
172 Ga0495672_0013865 3300047320 Bacteria 5541
173 Ga0495672_0076149 3300047320 Bacteria 1885
174 Ga0495683_0042700 3300047323 Bacteria 2285
175 Ga0495687_000103 3300047443 Bacteria 128840
176 Ga0495687_000205 3300047443 Bacteria 84650
177 Ga0495687_000361 3300047443 Bacteria 56861
178 Ga0495687_000584 3300047443 Bacteria 42785
179 Ga0495675_0016338 3300047444 Bacteria 4695
180 Ga0495677_0001041 3300047445 Bacteria 11139
181 Ga0495677_0037260 3300047445 Bacteria 1776
182 Ga0495679_011185 3300047446 Bacteria 3479
183 Ga0495681_0002229 3300047470 Bacteria 13947
184 Ga0495686_0000109 3300047472 Bacteria 171482
185 Ga0495686_0000494 3300047472 Bacteria 57947
186 Ga0495686_0038103 3300047472 Bacteria 3076
187 Ga0495614_0011469 3300048089 Bacteria 3899
188 Ga0495626_0000022 3300048091 Bacteria 216166
189 Ga0495626_0000122 3300048091 Bacteria 101672
190 Ga0495626_0002391 3300048091 Bacteria 13097
191 Ga0495626_0008036 3300048091 Bacteria 5824
192 Ga0495626_0103624 3300048091 Bacteria 1238
193 Ga0496102_0000068 3300048905 Bacteria 156306
194 Ga0496102_0112018 3300048905 Bacteria 2544
195 Ga0496102_0131953 3300048905 Bacteria 2339
196 Ga0496102_0262933 3300048905 Bacteria 1627
197 Ga0496103_0104775 3300048906 Bacteria 1793
198 Ga0496103_0128305 3300048906 Bacteria 1618
199 Ga0496106_0003368 3300048909 Bacteria 11916
200 Ga0496110_0000009 3300048913 Bacteria 111367
201 Ga0496110_0154069 3300048913 Bacteria 2082
202 Ga0496111_0349012 3300048914 Bacteria 1095
203 Ga0496115_0047054 3300048918 Bacteria 3449
204 Ga0496121_0381238 3300048924 Bacteria 930
205 Ga0496122_0060383 3300048925 Bacteria 2792
206 Ga0496123_0005901 3300048926 Bacteria 12091
207 Ga0496124_0034226 3300048927 Bacteria 4462
208 Ga0496124_0068864 3300048927 Bacteria 2940
209 Ga0495678_000290 3300049459 Bacteria 55357
210 Ga0495678_024420 3300049459 Bacteria 2610
211 Ga0495682_0000112 3300049460 Bacteria 70727
212 Ga0495682_0006407 3300049460 Bacteria 4761
213 Ga0501035_0001162 3300049822 Bacteria 27461
214 Ga0466962_0068107 3300061719 Bacteria 1699
215 2644471719 2643221684 Bacteria 7145183
216 8047675854 8047673197 Bacteria 7395230
217 Ga0395900_0001131
218 rootL2_10012908
219 Ga0055542_1009285
220 Ga0070658_10228548
221 Ga0070664_100075355
222 Ga0157372_10474568
223 Ga0209148_1001160
224 Ga0207674_10363129
225 Ga0395899_0056898
226 Ga0395899_0088799
227 Ga0395899_0119039
228 Ga0395899_0255494
229 Ga0395900_0051201
230 Ga0395900_0104272
231 Ga0395900_0124955
232 Ga0395900_0125430
233 Ga0395900_0197966
234 Ga0395898_0068091
235 Ga0395898_0122509
236 Ga0395898_0441091
237 Ga0395905_0042611
238 Ga0395905_0068791
239 Ga0395905_0215948
240 Ga0395905_0329724
241 Ga0395901_0000044
242 Ga0395901_0071544
243 Ga0395901_0181377
244 Ga0439448_0036071
245 Ga0439455_0033778
246 Ga0439458_0023735
247 Ga0466969_0022649
248 Ga0466972_0019958
249 Ga0466965_0037995
250 Ga0466966_0006432
251 Ga0466966_0018470
252 Ga0466966_0036823
253 Ga0466961_0028044
254 Ga0466963_0014755
255 Ga0466964_0017997
256 Ga0466968_0000823
257 Ga0466957_0001388
258 Ga0466957_0078697
259 Ga0466957_0088612
260 Ga0466959_0200265
261 Ga0466959_0207726
262 Ga0466958_0027177
263 Ga0466958_0104838
264 Ga0466967_0007135
265 Ga0466967_0187321
266 Ga0495617_000022
267 Ga0495627_000222
268 Ga0495627_001957
269 Ga0495603_0184296
270 Ga0495590_0005682
271 Ga0495590_0033412
272 Ga0495650_0000351
273 Ga0495650_0009956
274 Ga0495582_0002544
275 Ga0495582_0062238
276 Ga0495605_0000064
277 Ga0495605_0012241
278 Ga0495605_0016235
279 Ga0495639_0075677
280 Ga0495584_0000031
281 Ga0495584_0004078
282 Ga0495584_0121345
283 Ga0495584_0128532
284 Ga0495585_0018175
285 Ga0495585_0049209
286 Ga0495594_0003125
287 Ga0495594_0036506
288 Ga0495596_0004448
289 Ga0495596_0004957
290 Ga0495596_0012700
291 Ga0495596_0013450
292 Ga0495596_0013725
293 Ga0495607_0003075
294 Ga0495607_0004918
295 Ga0495607_0098623
296 Ga0495583_0000658
297 Ga0495583_0051744
298 Ga0495583_0080141
299 Ga0495583_0120026
300 Ga0495606_0004509
301 Ga0495606_0197602
302 Ga0495616_0001227
303 Ga0495616_0051128
304 Ga0495616_0090567
305 Ga0495631_0027485
306 Ga0495632_0000026
307 Ga0495632_0000072
308 Ga0495632_0065015
309 Ga0495643_0001162
310 Ga0495643_0017338
311 Ga0495644_0019358
312 Ga0495644_0071641
313 Ga0495644_0091344
314 Ga0495648_0005189
315 Ga0495648_0008358
316 Ga0495648_0039204
317 Ga0495648_0135624
318 Ga0495666_0027528
319 Ga0495642_0000226
320 Ga0495642_0000321
321 Ga0495642_0004215
322 Ga0495642_0042743
323 Ga0495642_0058211
324 Ga0495652_0020878
325 Ga0495654_0004111
326 Ga0495654_0012645
327 Ga0495665_0014417
328 Ga0495587_0139792
329 Ga0495609_0000150
330 Ga0495609_0003172
331 Ga0495609_0006301
332 Ga0495609_0021416
333 Ga0495609_0075509
334 Ga0495609_0136913
335 Ga0495597_0000032
336 Ga0495597_0001221
337 Ga0495622_0013767
338 Ga0495633_0035097
339 Ga0495668_0000320
340 Ga0495668_0001598
341 Ga0495668_0003400
342 Ga0495668_0012763
343 Ga0495668_0065194
344 Ga0495634_0015257
345 Ga0495611_0099668
346 Ga0495625_0034083
347 Ga0495625_0056386
348 Ga0495625_0140443
349 Ga0495661_0001944
350 Ga0495661_0035317
351 Ga0495661_0045523
352 Ga0495661_0053691
353 Ga0495661_0075282
354 Ga0495661_0094800
355 Ga0495661_0130189
356 Ga0495661_0149593
357 Ga0495588_0000125
358 Ga0495588_0004296
359 Ga0495588_0008781
360 Ga0495588_0016814
361 Ga0495623_0033530
362 Ga0495623_0036889
363 Ga0495646_0065932
364 Ga0495669_0000105
365 Ga0495669_0001322
366 Ga0495669_0014621
367 Ga0495613_0032213
368 Ga0495670_0030482
369 Ga0495670_0088521
370 Ga0495671_0000059
371 Ga0495671_0003557
372 Ga0495649_0007003
373 Ga0495649_0016665
374 Ga0495649_0052653
375 Ga0495649_0059582
376 Ga0495589_0002201
377 Ga0495589_0049374
378 Ga0495589_0053634
379 Ga0495600_0028913
380 Ga0495660_0000147
381 Ga0495660_0003406
382 Ga0495660_0010900
383 Ga0495660_0023395
384 Ga0495660_0051244
385 Ga0495672_0000101
386 Ga0495672_0000166
387 Ga0495672_0000314
388 Ga0495672_0013865
389 Ga0495672_0076149
390 Ga0495683_0042700
391 Ga0495687_000103
392 Ga0495687_000205
393 Ga0495687_000361
394 Ga0495687_000584
395 Ga0495675_0016338
396 Ga0495677_0001041
397 Ga0495677_0037260
398 Ga0495679_011185
399 Ga0495681_0002229
400 Ga0495686_0000109
401 Ga0495686_0000494
402 Ga0495686_0038103
403 Ga0495614_0011469
404 Ga0495626_0000022
405 Ga0495626_0000122
406 Ga0495626_0002391
407 Ga0495626_0008036
408 Ga0495626_0103624
409 Ga0496102_0000068
410 Ga0496102_0112018
411 Ga0496102_0131953
412 Ga0496102_0262933
413 Ga0496103_0104775
414 Ga0496103_0128305
415 Ga0496106_0003368
416 Ga0496110_0000009
417 Ga0496110_0154069
418 Ga0496111_0349012
419 Ga0496115_0047054
420 Ga0496121_0381238
421 Ga0496122_0060383
422 Ga0496123_0005901
423 Ga0496124_0034226
424 Ga0496124_0068864
425 Ga0495678_000290
426 Ga0495678_024420
427 Ga0495682_0000112
428 Ga0495682_0006407
429 Ga0501035_0001162
430 Ga0466962_0068107
431 2644471719
432 8047675854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04393

DUF535

Protein of unknown function (DUF535)

13

299

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bo4-assembly1.cif.gz_B crystal structure of a gcn5-related n-acetyltransferase: serratia marescens aminoglycoside 3-n-acetyltransferase 0.7329 128 226
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.7327 131 259
2q0y-assembly1.cif.gz_A-2 crystal structure of gcn5-related n-acetyltransferase (yp_295895.1) from ralstonia eutropha jmp134 at 1.80 a resolution 0.7223 133 260
4crz-assembly1.cif.gz_B direct visualisation of strain-induced protein prost-translational modification 0.7217 133 264
3i9s-assembly1.cif.gz_B structure from the mobile metagenome of v.cholerae. integron cassette protein vch_cass6 0.7179 125 259
ID Description Score Start End Superfamily
af_Q54S78_862_1009_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.7487 133 151 2.60.40.150
af_P79081_1_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7486 129 260 3.40.630.30
af_Q54IG0_5_154_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7438 132 260 3.40.630.30
1bo4B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7329 128 226 3.40.630.30
af_P34548_48_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7207 206 226 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4Q3JQS7-F1-model_v4 deleted 0.9305 83 313
AF-A0A126PES4-F1-model_v4 Suppressor of fused-like domain-containing protein 0.8683 80 311 GO:0006974
AF-A0A840RRR4-F1-model_v4 Uncharacterized protein 0.8668 79 313
AF-A0A6B8KED5-F1-model_v4 DUF535 domain-containing protein 0.862 68 305 GO:0006974
AF-A0A6L8LB96-F1-model_v4 deleted 0.8616 59 309

Map