F327763

General Info

Members Datasets Scaffolds Average Seq Length
216 134 432 217

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10004550|Ga0307510_100045509
Length 241
Sequence LFKSDSRIMQAELSVLLFAAVTVACLHTVTGPDHYLPFIALSKSRGWSFGKTIFWTIFCGCGHVWSSVLLGLGGAAIGWSLSKVKWMENVRGGVAGWAMLGFGLVYGVWGLIRARQNRRHKHFDVREDGSVYVYDHKHGETVRPQDRHAVTPWVMFIVFVLGPCEPMIPLLYFPAAKASWVGMGLLIGVYTFFTLATMVGMVVSGYYGLNFLKTEKLERYVHALGGLTLFLCGAGMVFMGW

Samples

Sample ID Description Type Environment
1 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
107 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
108 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
109 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
110 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
128 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
129 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
130 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
133 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
134 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.48
Nodule 0
Rhizoplane 0.46
Rhizosphere 84.72
Stem 0
Stem Tuber 0
Unclassified 9.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307510_10004550 3300033180 Bacteria 16324
2 rootH1_10139850 3300003316 Bacteria 1513
3 rootH2_10024374 3300003320 Bacteria 22689
4 rootH2_10295936 3300003320 Bacteria 1326
5 rootH2_10326310 3300003320 Unclassified 1215
6 rootL2_10066886 3300003322 Bacteria 1971
7 rootL2_10243901 3300003322 Bacteria 1169
8 rootL2_10287018 3300003322 Unclassified 1742
9 Ga0065714_10232516 3300005288 Bacteria 813
10 Ga0065712_10172191 3300005290 Bacteria 1237
11 Ga0065715_10180660 3300005293 Unclassified 1475
12 Ga0070683_100119874 3300005329 Bacteria 2485
13 Ga0070670_100105803 3300005331 Bacteria 2424
14 Ga0068869_100041704 3300005334 Bacteria 3288
15 Ga0068869_100104578 3300005334 Bacteria 2146
16 Ga0070666_10000143 3300005335 Bacteria 48999
17 Ga0068868_100113574 3300005338 Bacteria 2203
18 Ga0068868_100252997 3300005338 Unclassified 1483
19 Ga0070671_100168341 3300005355 Bacteria 1853
20 Ga0070671_100531705 3300005355 Bacteria 1013
21 Ga0070674_100434502 3300005356 Unclassified 1080
22 Ga0070659_100000092 3300005366 Bacteria 67270
23 Ga0070667_100032392 3300005367 Bacteria 4359
24 Ga0070699_100854055 3300005518 Bacteria 833
25 Ga0070665_100000001 3300005548 Bacteria 1083363
26 Ga0070704_101041396 3300005549 Unclassified 741
27 Ga0068855_100044964 3300005563 Bacteria 5224
28 Ga0070664_100003686 3300005564 Bacteria 12355
29 Ga0068856_100123925 3300005614 Bacteria 2586
30 Ga0068852_100023151 3300005616 Bacteria 4994
31 Ga0068852_100293141 3300005616 Bacteria 1572
32 Ga0068859_100000099 3300005617 Bacteria 80240
33 Ga0068859_100198035 3300005617 Bacteria 2093
34 Ga0068864_100101913 3300005618 Bacteria 2547
35 Ga0068864_100127075 3300005618 Bacteria 2285
36 Ga0068851_10005726 3300005834 Bacteria 5654
37 Ga0068863_100284569 3300005841 Bacteria 1602
38 Ga0068858_100026082 3300005842 Bacteria 5433
39 Ga0068860_100000004 3300005843 Bacteria 506126
40 Ga0068860_100001298 3300005843 Bacteria 27144
41 Ga0068860_100002087 3300005843 Bacteria 21045
42 Ga0068860_100056299 3300005843 Bacteria 3739
43 Ga0068862_100279003 3300005844 Bacteria 1531
44 Ga0075366_10011674 3300006195 Bacteria 4963
45 Ga0075366_10161625 3300006195 Bacteria 1357
46 Ga0075366_10228382 3300006195 Bacteria 1134
47 Ga0097621_100131522 3300006237 Bacteria 2131
48 Ga0097621_100239428 3300006237 Bacteria 1586
49 Ga0068871_100177173 3300006358 Bacteria 1831
50 Ga0097620_100000099 3300006931 Bacteria 80240
51 Ga0105240_10000160 3300009093 Bacteria 137390
52 Ga0105240_10000649 3300009093 Bacteria 64145
53 Ga0105240_10025119 3300009093 Bacteria 7837
54 Ga0105240_10180447 3300009093 Bacteria 2492
55 Ga0105240_10208940 3300009093 Bacteria 2282
56 Ga0105240_10370149 3300009093 Bacteria 1620
57 Ga0105245_10061513 3300009098 Bacteria 3385
58 Ga0105247_10013926 3300009101 Bacteria 4823
59 Ga0114129_10001547 3300009147 Bacteria 31199
60 Ga0114129_10763238 3300009147 Bacteria 1237
61 Ga0105243_10362588 3300009148 Bacteria 1334
62 Ga0105241_10000397 3300009174 Bacteria 32881
63 Ga0105241_10003932 3300009174 Bacteria 10994
64 Ga0105241_10025021 3300009174 Bacteria 4436
65 Ga0105242_10238172 3300009176 Bacteria 1635
66 Ga0105237_10005762 3300009545 Bacteria 13917
67 Ga0105237_10092407 3300009545 Bacteria 3015
68 Ga0105237_10164563 3300009545 Bacteria 2217
69 Ga0105237_10340346 3300009545 Bacteria 1505
70 Ga0105238_10000489 3300009551 Bacteria 41694
71 Ga0105249_10014586 3300009553 Bacteria 6947
72 Ga0105239_10000140 3300010375 Bacteria 101896
73 Ga0105239_10015710 3300010375 Bacteria 8379
74 Ga0105239_10590767 3300010375 Unclassified 1266
75 Ga0105239_11214538 3300010375 Unclassified 869
76 Ga0105246_10177162 3300011119 Bacteria 1638
77 Ga0157374_10000004 3300013296 Bacteria 759774
78 Ga0157374_10365189 3300013296 Bacteria 1436
79 Ga0157378_10722254 3300013297 Bacteria 1017
80 Ga0163162_10000498 3300013306 Bacteria 36558
81 Ga0163162_10001194 3300013306 Bacteria 24252
82 Ga0157372_10023345 3300013307 Bacteria 6704
83 Ga0157372_10031870 3300013307 Bacteria 5776
84 Ga0157372_10048391 3300013307 Bacteria 4727
85 Ga0157375_10037242 3300013308 Bacteria 4659
86 Ga0157375_10374857 3300013308 Bacteria 1590
87 Ga0163163_10153887 3300014325 Bacteria 2343
88 Ga0157377_10131881 3300014745 Bacteria 1527
89 Ga0157379_10414925 3300014968 Bacteria 1239
90 Ga0157376_10004730 3300014969 Bacteria 9481
91 Ga0209646_1001491 3300025246 Bacteria 6230
92 Ga0207656_10008523 3300025321 Bacteria 3778
93 Ga0207710_10016476 3300025900 Bacteria 3128
94 Ga0207680_10000096 3300025903 Bacteria 40670
95 Ga0207654_10000240 3300025911 Bacteria 33102
96 Ga0207695_10000027 3300025913 Bacteria 612456
97 Ga0207695_10013038 3300025913 Bacteria 9928
98 Ga0207695_10105773 3300025913 Bacteria 2801
99 Ga0207695_10144574 3300025913 Bacteria 2323
100 Ga0207671_10001586 3300025914 Bacteria 25838
101 Ga0207671_10010216 3300025914 Bacteria 7770
102 Ga0207671_10048925 3300025914 Bacteria 3129
103 Ga0207650_10016070 3300025925 Bacteria 5224
104 Ga0207644_10028480 3300025931 Unclassified 3868
105 Ga0207690_10000309 3300025932 Bacteria 33416
106 Ga0207669_10458827 3300025937 Unclassified 1011
107 Ga0207691_10097869 3300025940 Bacteria 2622
108 Ga0207691_10262315 3300025940 Bacteria 1489
109 Ga0207689_10001706 3300025942 Bacteria 20803
110 Ga0207689_10057364 3300025942 Bacteria 3204
111 Ga0207661_10032497 3300025944 Bacteria 4043
112 Ga0207679_10005034 3300025945 Bacteria 8258
113 Ga0207667_10084278 3300025949 Bacteria 3290
114 Ga0207667_10104895 3300025949 Bacteria 2916
115 Ga0207640_10662155 3300025981 Unclassified 891
116 Ga0207658_10114240 3300025986 Bacteria 2140
117 Ga0207677_10112345 3300026023 Bacteria 2031
118 Ga0207677_10272024 3300026023 Unclassified 1386
119 Ga0207703_10003309 3300026035 Bacteria 13527
120 Ga0207639_10484857 3300026041 Bacteria 1127
121 Ga0207641_10000998 3300026088 Bacteria 28957
122 Ga0207648_10000937 3300026089 Bacteria 32934
123 Ga0207676_10302795 3300026095 Unclassified 1460
124 Ga0207676_10467126 3300026095 Unclassified 1192
125 Ga0207674_10013652 3300026116 Bacteria 8996
126 Ga0207674_10353356 3300026116 Bacteria 1421
127 Ga0207683_10168765 3300026121 Bacteria 1981
128 Ga0207698_10009912 3300026142 Bacteria 6094
129 Ga0207698_10682863 3300026142 Bacteria 1020
130 Ga0268266_10000232 3300028379 Bacteria 95941
131 Ga0268265_10105938 3300028380 Bacteria 2283
132 Ga0268265_11036317 3300028380 Bacteria 812
133 Ga0268264_10000011 3300028381 Bacteria 580884
134 Ga0268264_10001066 3300028381 Bacteria 27233
135 Ga0268264_10018080 3300028381 Bacteria 5766
136 Ga0268264_10041317 3300028381 Bacteria 3814
137 Ga0307511_10001426 3300030521 Bacteria 25220
138 Ga0265330_10000008 3300031235 Bacteria 192028
139 Ga0265332_10000297 3300031238 Bacteria 38969
140 Ga0265332_10002996 3300031238 Bacteria 8286
141 Ga0265329_10009387 3300031242 Bacteria 3657
142 Ga0265316_10000036 3300031344 Bacteria 150384
143 Ga0307513_10144818 3300031456 Bacteria 2296
144 Ga0307509_10006991 3300031507 Bacteria 14957
145 Ga0307509_10089692 3300031507 Bacteria 3152
146 Ga0307408_100008475 3300031548 Bacteria 6790
147 Ga0316575_10065543 3300031665 Bacteria 1455
148 Ga0316579_10104869 3300031691 Unclassified 1355
149 Ga0265314_10000005 3300031711 Bacteria 668532
150 Ga0265342_10002227 3300031712 Bacteria 17013
151 Ga0316576_10001201 3300031727 Bacteria 13665
152 Ga0316576_10003998 3300031727 Bacteria 8764
153 Ga0316576_10005879 3300031727 Bacteria 7569
154 Ga0316576_10026379 3300031727 Bacteria 4077
155 Ga0316576_10143252 3300031727 Bacteria 1799
156 Ga0316578_10037070 3300031728 Bacteria 2808
157 Ga0316578_10124685 3300031728 Bacteria 1549
158 Ga0316577_10002976 3300031733 Bacteria 8481
159 Ga0316577_10016198 3300031733 Bacteria 4105
160 Ga0316577_10086056 3300031733 Bacteria 1759
161 Ga0316577_10159492 3300031733 Unclassified 1272
162 Ga0316577_10316851 3300031733 Unclassified 884
163 Ga0316580_10004155 3300032139 Bacteria 4174
164 Ga0316574_0003119 3300035398 Bacteria 8469
165 Ga0316574_0003272 3300035398 Bacteria 8323
166 Ga0316574_0006187 3300035398 Bacteria 6446
167 Ga0316574_0019375 3300035398 Bacteria 4012
168 Ga0316574_0087960 3300035398 Bacteria 1978
169 Ga0316574_0378367 3300035398 Bacteria 893
170 Ga0316574_0507789 3300035398 Bacteria 751
171 Ga0316582_0126076 3300036647 Bacteria 1717
172 Ga0316582_0384402 3300036647 Archaea 966
173 Ga0316584_0027025 3300036712 Bacteria 4221
174 Ga0316584_0040072 3300036712 Bacteria 3490
175 Ga0316584_0049087 3300036712 Bacteria 3154
176 Ga0316584_0116222 3300036712 Bacteria 2001
177 Ga0316584_0192344 3300036712 Bacteria 1508
178 Ga0316584_0221778 3300036712 Bacteria 1389
179 Ga0395905_0654197 3300037471 Bacteria 953
180 Ga0316581_0051850 3300037588 Unclassified 1257
181 Ga0400486_13042 3300038742 Bacteria 2346
182 Ga0400483_201282 3300039062 Bacteria 1296
183 Ga0400489_30404 3300039093 Unclassified 1130
184 Ga0451798_0346244 3300041458 Bacteria 812
185 Ga0451841_1242608 3300041498 Bacteria 1336
186 Ga0439433_0036164 3300041999 Bacteria 1140
187 Ga0439449_0020145 3300042007 Bacteria 2499
188 Ga0466969_0166091 3300044656 Bacteria 1013
189 Ga0466972_0000039 3300044658 Bacteria 135618
190 Ga0466972_0018592 3300044658 Bacteria 3476
191 Ga0466972_0037728 3300044658 Bacteria 2362
192 Ga0453684_0108127 3300044712 Bacteria 3385
193 Ga0453684_0732474 3300044712 Bacteria 1072
194 Ga0466968_0006985 3300044735 Unclassified 4278
195 Ga0466957_0002264 3300044842 Bacteria 10313
196 Ga0495638_0173796 3300046460 Bacteria 1234
197 Ga0495606_0085429 3300046507 Bacteria 1952
198 Ga0495648_0001281 3300046524 Bacteria 25084
199 Ga0495611_0137237 3300046648 Unclassified 1142
200 Ga0495687_000001 3300047443 Bacteria 1215582
201 Ga0495686_0000772 3300047472 Bacteria 42035
202 Ga0495686_0022375 3300047472 Bacteria 4184
203 Ga0495686_0031313 3300047472 Bacteria 3450
204 nmdc:mga0k408_37275_c1 3300050493 Bacteria 2791
205 nmdc:mga05p37_5921_c1 3300050507 Bacteria 14385
206 Ga0500578_0014371 3300053086 Bacteria 5092
207 Ga0500646_0059862 3300053090 Bacteria 1118
208 Ga0500646_0069510 3300053090 Bacteria 1053
209 Ga0500583_0027238 3300053092 Bacteria 2465
210 Ga0500583_0280504 3300053092 Bacteria 818
211 Ga0500589_028895 3300053147 Bacteria 2577
212 Ga0500616_0007156 3300053153 Bacteria 7137
213 Ga0500622_0002546 3300053156 Bacteria 13066
214 Ga0500622_0010378 3300053156 Bacteria 5115
215 Ga0500611_000013 3300053727 Bacteria 135447
216 2738727163 2738541278 Bacteria 9755573
217 Ga0307510_10004550
218 rootH1_10139850
219 rootH2_10024374
220 rootH2_10295936
221 rootH2_10326310
222 rootL2_10066886
223 rootL2_10243901
224 rootL2_10287018
225 Ga0065714_10232516
226 Ga0065712_10172191
227 Ga0065715_10180660
228 Ga0070683_100119874
229 Ga0070670_100105803
230 Ga0068869_100041704
231 Ga0068869_100104578
232 Ga0070666_10000143
233 Ga0068868_100113574
234 Ga0068868_100252997
235 Ga0070671_100168341
236 Ga0070671_100531705
237 Ga0070674_100434502
238 Ga0070659_100000092
239 Ga0070667_100032392
240 Ga0070699_100854055
241 Ga0070665_100000001
242 Ga0070704_101041396
243 Ga0068855_100044964
244 Ga0070664_100003686
245 Ga0068856_100123925
246 Ga0068852_100023151
247 Ga0068852_100293141
248 Ga0068859_100000099
249 Ga0068859_100198035
250 Ga0068864_100101913
251 Ga0068864_100127075
252 Ga0068851_10005726
253 Ga0068863_100284569
254 Ga0068858_100026082
255 Ga0068860_100000004
256 Ga0068860_100001298
257 Ga0068860_100002087
258 Ga0068860_100056299
259 Ga0068862_100279003
260 Ga0075366_10011674
261 Ga0075366_10161625
262 Ga0075366_10228382
263 Ga0097621_100131522
264 Ga0097621_100239428
265 Ga0068871_100177173
266 Ga0097620_100000099
267 Ga0105240_10000160
268 Ga0105240_10000649
269 Ga0105240_10025119
270 Ga0105240_10180447
271 Ga0105240_10208940
272 Ga0105240_10370149
273 Ga0105245_10061513
274 Ga0105247_10013926
275 Ga0114129_10001547
276 Ga0114129_10763238
277 Ga0105243_10362588
278 Ga0105241_10000397
279 Ga0105241_10003932
280 Ga0105241_10025021
281 Ga0105242_10238172
282 Ga0105237_10005762
283 Ga0105237_10092407
284 Ga0105237_10164563
285 Ga0105237_10340346
286 Ga0105238_10000489
287 Ga0105249_10014586
288 Ga0105239_10000140
289 Ga0105239_10015710
290 Ga0105239_10590767
291 Ga0105239_11214538
292 Ga0105246_10177162
293 Ga0157374_10000004
294 Ga0157374_10365189
295 Ga0157378_10722254
296 Ga0163162_10000498
297 Ga0163162_10001194
298 Ga0157372_10023345
299 Ga0157372_10031870
300 Ga0157372_10048391
301 Ga0157375_10037242
302 Ga0157375_10374857
303 Ga0163163_10153887
304 Ga0157377_10131881
305 Ga0157379_10414925
306 Ga0157376_10004730
307 Ga0209646_1001491
308 Ga0207656_10008523
309 Ga0207710_10016476
310 Ga0207680_10000096
311 Ga0207654_10000240
312 Ga0207695_10000027
313 Ga0207695_10013038
314 Ga0207695_10105773
315 Ga0207695_10144574
316 Ga0207671_10001586
317 Ga0207671_10010216
318 Ga0207671_10048925
319 Ga0207650_10016070
320 Ga0207644_10028480
321 Ga0207690_10000309
322 Ga0207669_10458827
323 Ga0207691_10097869
324 Ga0207691_10262315
325 Ga0207689_10001706
326 Ga0207689_10057364
327 Ga0207661_10032497
328 Ga0207679_10005034
329 Ga0207667_10084278
330 Ga0207667_10104895
331 Ga0207640_10662155
332 Ga0207658_10114240
333 Ga0207677_10112345
334 Ga0207677_10272024
335 Ga0207703_10003309
336 Ga0207639_10484857
337 Ga0207641_10000998
338 Ga0207648_10000937
339 Ga0207676_10302795
340 Ga0207676_10467126
341 Ga0207674_10013652
342 Ga0207674_10353356
343 Ga0207683_10168765
344 Ga0207698_10009912
345 Ga0207698_10682863
346 Ga0268266_10000232
347 Ga0268265_10105938
348 Ga0268265_11036317
349 Ga0268264_10000011
350 Ga0268264_10001066
351 Ga0268264_10018080
352 Ga0268264_10041317
353 Ga0307511_10001426
354 Ga0265330_10000008
355 Ga0265332_10000297
356 Ga0265332_10002996
357 Ga0265329_10009387
358 Ga0265316_10000036
359 Ga0307513_10144818
360 Ga0307509_10006991
361 Ga0307509_10089692
362 Ga0307408_100008475
363 Ga0316575_10065543
364 Ga0316579_10104869
365 Ga0265314_10000005
366 Ga0265342_10002227
367 Ga0316576_10001201
368 Ga0316576_10003998
369 Ga0316576_10005879
370 Ga0316576_10026379
371 Ga0316576_10143252
372 Ga0316578_10037070
373 Ga0316578_10124685
374 Ga0316577_10002976
375 Ga0316577_10016198
376 Ga0316577_10086056
377 Ga0316577_10159492
378 Ga0316577_10316851
379 Ga0316580_10004155
380 Ga0316574_0003119
381 Ga0316574_0003272
382 Ga0316574_0006187
383 Ga0316574_0019375
384 Ga0316574_0087960
385 Ga0316574_0378367
386 Ga0316574_0507789
387 Ga0316582_0126076
388 Ga0316582_0384402
389 Ga0316584_0027025
390 Ga0316584_0040072
391 Ga0316584_0049087
392 Ga0316584_0116222
393 Ga0316584_0192344
394 Ga0316584_0221778
395 Ga0395905_0654197
396 Ga0316581_0051850
397 Ga0400486_13042
398 Ga0400483_201282
399 Ga0400489_30404
400 Ga0451798_0346244
401 Ga0451841_1242608
402 Ga0439433_0036164
403 Ga0439449_0020145
404 Ga0466969_0166091
405 Ga0466972_0000039
406 Ga0466972_0018592
407 Ga0466972_0037728
408 Ga0453684_0108127
409 Ga0453684_0732474
410 Ga0466968_0006985
411 Ga0466957_0002264
412 Ga0495638_0173796
413 Ga0495606_0085429
414 Ga0495648_0001281
415 Ga0495611_0137237
416 Ga0495687_000001
417 Ga0495686_0000772
418 Ga0495686_0022375
419 Ga0495686_0031313
420 nmdc:mga0k408_37275_c1
421 nmdc:mga05p37_5921_c1
422 Ga0500578_0014371
423 Ga0500646_0059862
424 Ga0500646_0069510
425 Ga0500583_0027238
426 Ga0500583_0280504
427 Ga0500589_028895
428 Ga0500616_0007156
429 Ga0500622_0002546
430 Ga0500622_0010378
431 Ga0500611_000013
432 2738727163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mu2-assembly1.cif.gz_B crystal structure of hiv-2 reverse transcriptase 0.6067 86 122
2oy5-assembly1.cif.gz_O the crystal structure of ospa mutant 0.5956 94 122
6mly-assembly1.cif.gz_A bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.5821 90 126
8avc-assembly1.cif.gz_D mouse leptin:lep-r complex cryoem structure (3:3 model) 0.5709 90 115
1rjl-assembly1.cif.gz_C structure of the complex between ospb-ct and bactericidal fab-h6831 0.5649 92 127
ID Description Score Start End Superfamily
af_Q9Y7Y6_1_115_2.30.29.70 Mainly Beta;Roll;PH-domain like;Proteasomal ubiquitin receptor Rpn13/ADRM1 0.6835 94 121 2.30.29.70
af_Q3TIT8_280_489_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6744 12 69 1.20.1250.20
af_P9WJY7_198_393_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5865 1 68 1.20.1250.20
af_Q59P92_23_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5812 10 70 1.20.1250.20
af_C7G078_64_126_2.90.10.10 Mainly Beta;Orthogonal Prism;Agglutinin, subunit A;Bulb-type lectin domain 0.5716 87 106 2.90.10.10
ID Description Score Start End GO Terms
AF-A0A3N1B343-F1-model_v4 Uncharacterized protein 0.5879 89 141
AF-A0A3M1GHB0-F1-model_v4 Urease accessory protein UreH-like transmembrane domain-containing protein 0.5282 1 135 GO:0016020
AF-T0LUH1-F1-model_v4 Uncharacterized protein 0.5076 4 151 GO:0016020
AF-A0A1Q5P8C2-F1-model_v4 Urease accessory protein UreH-like transmembrane domain-containing protein 0.5034 6 192 GO:0016020
AF-A0A821IV13-F1-model_v4 Uncharacterized protein 0.4973 75 121

Map