F327743

General Info

Members Datasets Scaffolds Average Seq Length
216 146 207 116

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10036488|Ga0316576_100364883
Length 126
Sequence MVVRFAAELSDAEVDRIFRALADATRRDIVRRTLGGEASVSELARAYDMSFAAVQKHVSVLEGAGLVTKHPQGRERIVRGNPDTIRRAQALLERYERIWRSRIDRLDALLAETDDPTPNTSAKGPH

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221641 Nocardioides sp. Root122 Isolate Unclassified
3 2643221696 Nocardioides sp. Root140 Isolate Unclassified
4 2739367898 Nocardioides sp. CF479 Isolate Unclassified
5 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
6 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
7 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
8 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
86 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
90 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
132 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
144 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
145 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 0
Isolates 4.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 10.19
Nodule 0.46
Rhizoplane 10.65
Rhizosphere 71.3
Stem 0
Stem Tuber 0
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1015684 3300003792 Bacteria 2190
2 Ga0070658_10469195 3300005327 Bacteria 1086
3 Ga0070690_101086402 3300005330 Bacteria 634
4 Ga0068868_100532669 3300005338 Bacteria 1033
5 Ga0068868_100750935 3300005338 Bacteria 877
6 Ga0070689_100957360 3300005340 Bacteria 760
7 Ga0070659_100198775 3300005366 Bacteria 1649
8 Ga0070705_100990124 3300005440 Bacteria 682
9 Ga0070678_100495728 3300005456 Bacteria 1077
10 Ga0070662_100541414 3300005457 Bacteria 975
11 Ga0070662_101287955 3300005457 Bacteria 629
12 Ga0070684_100359157 3300005535 Bacteria 1341
13 Ga0070665_100580483 3300005548 Bacteria 1134
14 Ga0070664_102179454 3300005564 Bacteria 526
15 Ga0068854_100640424 3300005578 Bacteria 912
16 Ga0068852_100914579 3300005616 Bacteria 895
17 Ga0068859_100428064 3300005617 Bacteria 1420
18 Ga0068861_100390287 3300005719 Bacteria 1232
19 Ga0068861_102318525 3300005719 Bacteria 539
20 Ga0068851_10428119 3300005834 Bacteria 783
21 Ga0068870_11175043 3300005840 Bacteria 555
22 Ga0068863_101271179 3300005841 Bacteria 743
23 Ga0068862_100684854 3300005844 Bacteria 992
24 Ga0070717_11673354 3300006028 Bacteria 576
25 Ga0075365_10081477 3300006038 Bacteria 2193
26 Ga0075365_10407898 3300006038 Bacteria 959
27 Ga0075365_10421690 3300006038 Bacteria 942
28 Ga0075365_10723269 3300006038 Bacteria 703
29 Ga0075363_100408298 3300006048 Bacteria 799
30 Ga0075364_10179248 3300006051 Bacteria 1433
31 Ga0075362_10299092 3300006177 Bacteria 798
32 Ga0075362_10734637 3300006177 Bacteria 516
33 Ga0075370_10432573 3300006353 Bacteria 791
34 Ga0075433_10599854 3300006852 Bacteria 967
35 Ga0097620_100428035 3300006931 Bacteria 1420
36 Ga0105240_11774399 3300009093 Bacteria 643
37 Ga0105247_10045278 3300009101 Bacteria 2699
38 Ga0105247_11724077 3300009101 Bacteria 519
39 Ga0105243_10100682 3300009148 Bacteria 2398
40 Ga0105241_11148214 3300009174 Bacteria 733
41 Ga0105238_11177748 3300009551 Bacteria 790
42 Ga0105249_10733325 3300009553 Bacteria 1050
43 Ga0105249_13015553 3300009553 Bacteria 541
44 Ga0105246_10897164 3300011119 Bacteria 795
45 Ga0157371_10457167 3300013102 Bacteria 939
46 Ga0157370_10898914 3300013104 Bacteria 804
47 Ga0163162_12265450 3300013306 Bacteria 624
48 Ga0157375_10738587 3300013308 Bacteria 1136
49 Ga0157375_10810299 3300013308 Bacteria 1085
50 Ga0157375_12858765 3300013308 Bacteria 577
51 Ga0157376_11259070 3300014969 Bacteria 769
52 Ga0163161_10010769 3300017792 Bacteria 6337
53 Ga0163161_11325617 3300017792 Bacteria 626
54 Ga0209051_1003597 3300025303 Bacteria 10072
55 Ga0207710_10192423 3300025900 Bacteria 1005
56 Ga0207688_10592477 3300025901 Bacteria 698
57 Ga0207687_10765887 3300025927 Bacteria 822
58 Ga0207644_10284802 3300025931 Bacteria 1328
59 Ga0207709_10019688 3300025935 Bacteria 3799
60 Ga0207712_10671081 3300025961 Bacteria 902
61 Ga0207677_10201940 3300026023 Bacteria 1581
62 Ga0207703_10134665 3300026035 Bacteria 2138
63 Ga0207708_10706490 3300026075 Bacteria 862
64 Ga0207641_11653258 3300026088 Bacteria 642
65 Ga0207675_100063241 3300026118 Bacteria 3458
66 Ga0207683_10477243 3300026121 Bacteria 1151
67 Ga0207683_10485551 3300026121 Bacteria 1140
68 Ga0268265_12124401 3300028380 Bacteria 569
69 Ga0316181_1267792 3300030744 Bacteria 546
70 Ga0265327_10005797 3300031251 Bacteria 10156
71 Ga0307513_10494635 3300031456 Bacteria 941
72 Ga0307408_100753578 3300031548 Bacteria 880
73 Ga0307408_100823779 3300031548 Bacteria 844
74 Ga0316576_10036488 3300031727 Bacteria 3515
75 Ga0316576_10072067 3300031727 Unclassified 2549
76 Ga0316576_10109421 3300031727 Bacteria 2071
77 Ga0316578_10100253 3300031728 Bacteria 1736
78 Ga0307405_10141883 3300031731 Bacteria 1677
79 Ga0307405_11096628 3300031731 Bacteria 684
80 Ga0307405_11311081 3300031731 Bacteria 630
81 Ga0307413_10396376 3300031824 Bacteria 1080
82 Ga0307410_10427280 3300031852 Bacteria 1076
83 Ga0307410_10860287 3300031852 Bacteria 775
84 Ga0307410_11063358 3300031852 Bacteria 700
85 Ga0307407_10268831 3300031903 Bacteria 1176
86 Ga0307412_10641378 3300031911 Bacteria 905
87 Ga0307412_11178772 3300031911 Bacteria 685
88 Ga0307409_100090679 3300031995 Bacteria 2503
89 Ga0307409_100725713 3300031995 Bacteria 995
90 Ga0307409_101116547 3300031995 Bacteria 810
91 Ga0307414_10846994 3300032004 Bacteria 836
92 Ga0307411_10626526 3300032005 Bacteria 928
93 Ga0307415_100187269 3300032126 Bacteria 1630
94 Ga0307415_101113400 3300032126 Bacteria 740
95 Ga0316580_10018025 3300032139 Bacteria 2173
96 Ga0316574_0033512 3300035398 Bacteria 3126
97 Ga0316574_0036491 3300035398 Bacteria 3010
98 Ga0316582_0155248 3300036647 Bacteria 1549
99 Ga0316584_0031624 3300036712 Bacteria 3913
100 Ga0316584_0237273 3300036712 Unclassified 1335
101 Ga0316584_0888839 3300036712 Bacteria 600
102 Ga0395899_0021176 3300037312 Bacteria 4932
103 Ga0436363_0784123 3300039450 Bacteria 1106
104 Ga0436363_1464562 3300039450 Bacteria 2884
105 Ga0451791_0395707 3300041451 Bacteria 564
106 Ga0451791_0823325 3300041451 Bacteria 917
107 Ga0451791_0873618 3300041451 Bacteria 2668
108 Ga0451797_0183980 3300041453 Bacteria 1451
109 Ga0451807_0730687 3300041486 Bacteria 755
110 Ga0451837_1056526 3300041494 Bacteria 838
111 Ga0451837_1469442 3300041494 Bacteria 2268
112 Ga0451839_1086898 3300041496 Bacteria 776
113 Ga0451841_1172005 3300041498 Bacteria 1025
114 Ga0451843_1284914 3300041509 Bacteria 561
115 Ga0451843_1659197 3300041509 Bacteria 570
116 Ga0451853_3321742 3300041512 Bacteria 576
117 Ga0439434_0185876 3300042435 Bacteria 697
118 Ga0466972_0163752 3300044658 Bacteria 1044
119 Ga0466965_0035420 3300044683 Bacteria 2445
120 Ga0466970_0959790 3300044765 Bacteria 504
121 Ga0466960_0000047 3300044901 Bacteria 40180
122 Ga0466960_0209757 3300044901 Bacteria 1068
123 Ga0466960_0899331 3300044901 Bacteria 540
124 Ga0466958_0542158 3300045836 Bacteria 756
125 Ga0466967_0133250 3300045976 Bacteria 2309
126 Ga0496100_0137415 3300048903 Bacteria 1728
127 Ga0496100_0887187 3300048903 Bacteria 700
128 Ga0496102_0035739 3300048905 Bacteria 4474
129 Ga0496102_0112459 3300048905 Bacteria 2540
130 Ga0496104_0084388 3300048907 Bacteria 3031
131 Ga0496104_0395685 3300048907 Bacteria 1294
132 Ga0496106_0044600 3300048909 Bacteria 3329
133 Ga0496107_0184094 3300048910 Bacteria 1551
134 Ga0496107_1010088 3300048910 Bacteria 603
135 Ga0496108_0033072 3300048911 Bacteria 4296
136 Ga0496108_0872555 3300048911 Bacteria 773
137 Ga0496109_0491458 3300048912 Bacteria 1158
138 Ga0496110_0079199 3300048913 Bacteria 2925
139 Ga0496110_0849388 3300048913 Bacteria 818
140 Ga0496112_0125016 3300048915 Bacteria 2543
141 Ga0496112_0724257 3300048915 Bacteria 922
142 Ga0496112_0743080 3300048915 Bacteria 908
143 Ga0496113_0657388 3300048916 Bacteria 838
144 Ga0496126_0000003 3300048929 Bacteria 961576
145 Ga0501031_0003208 3300049568 Bacteria 10493
146 Ga0501032_0025726 3300049569 Bacteria 4056
147 Ga0501033_0012104 3300049570 Bacteria 6586
148 Ga0501033_0249912 3300049570 Bacteria 1257
149 Ga0501034_0029550 3300049571 Bacteria 5572
150 Ga0501034_0135127 3300049571 Bacteria 2447
151 Ga0501036_0006349 3300049572 Bacteria 9592
152 Ga0501036_0012710 3300049572 Bacteria 6984
153 Ga0501036_0519119 3300049572 Bacteria 991
154 Ga0501036_0926978 3300049572 Bacteria 714
155 Ga0501037_0003345 3300049573 Bacteria 11655
156 Ga0501037_0106542 3300049573 Bacteria 2020
157 Ga0501037_0452261 3300049573 Bacteria 876
158 Ga0501038_0001608 3300049574 Bacteria 20970
159 Ga0501038_0008686 3300049574 Bacteria 9327
160 Ga0501038_1327348 3300049574 Bacteria 519
161 Ga0501039_0017542 3300049575 Bacteria 5491
162 Ga0501039_0419694 3300049575 Bacteria 1051
163 Ga0501039_1469731 3300049575 Bacteria 524
164 Ga0501040_0291171 3300049576 Bacteria 1167
165 Ga0501041_0134604 3300049577 Bacteria 1540
166 Ga0501042_0008843 3300049578 Bacteria 6677
167 Ga0501042_0121581 3300049578 Bacteria 1880
168 Ga0501043_0010413 3300049579 Bacteria 7285
169 Ga0501043_0035213 3300049579 Bacteria 3938
170 Ga0501043_0055005 3300049579 Bacteria 3126
171 Ga0501043_0169899 3300049579 Bacteria 1701
172 Ga0501046_0004864 3300049580 Bacteria 12102
173 Ga0501046_0006883 3300049580 Bacteria 10021
174 Ga0501047_0008061 3300049581 Bacteria 9939
175 Ga0501047_0189540 3300049581 Bacteria 1920
176 Ga0501048_0004741 3300049582 Bacteria 10354
177 Ga0501067_0116746 3300049583 Bacteria 1484
178 Ga0501067_0147639 3300049583 Bacteria 1310
179 Ga0501067_0563970 3300049583 Bacteria 638
180 Ga0501070_0027513 3300049586 Bacteria 4770
181 Ga0501071_0704576 3300049587 Bacteria 777
182 Ga0501073_0022862 3300049589 Bacteria 4497
183 Ga0501073_0224284 3300049589 Bacteria 1298
184 Ga0501074_1236619 3300049590 Bacteria 524
185 Ga0501239_028626 3300049672 Bacteria 721
186 Ga0501221_162628 3300049704 Bacteria 599
187 Ga0501079_0463165 3300049741 Bacteria 996
188 Ga0501080_0017838 3300049742 Bacteria 6571
189 Ga0501083_0124386 3300049744 Bacteria 1691
190 Ga0501268_131896 3300049765 Bacteria 563
191 Ga0501035_0011104 3300049822 Bacteria 8340
192 Ga0501035_0022301 3300049822 Bacteria 5814
193 Ga0501035_0415645 3300049822 Bacteria 1117
194 Ga0501045_0225415 3300049824 Bacteria 1395
195 Ga0501045_0862706 3300049824 Bacteria 666
196 nmdc:mga00v17_317777_c1 3300050491 Bacteria 1012
197 nmdc:mga00v17_524411_c1 3300050491 Bacteria 767
198 nmdc:mga0yw44_1006938_c1 3300050492 Bacteria 564
199 nmdc:mga0yw44_1224126_c1 3300050492 Bacteria 506
200 nmdc:mga0yw44_26429_c1 3300050492 Bacteria 3315
201 nmdc:mga0yw44_520292_c1 3300050492 Bacteria 807
202 nmdc:mga0yw44_762541_c1 3300050492 Bacteria 657
203 nmdc:mga06z11_17630_c1 3300050494 Bacteria 3245
204 nmdc:mga07m45_434981_c1 3300050496 Bacteria 761
205 Ga0500554_241306 3300053102 Bacteria 597
206 Ga0500628_001677 3300053129 Bacteria 3750
207 Ga0590077_003370 3300059426 Bacteria 3314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_102179454 Ga0070664_1021794542 108
2 3300011119 Ga0105246_10897164 Ga0105246_108971642 108
3 3300048910 Ga0496107_1010088 Ga0496107_1010088_180_515 108
4 3300048911 Ga0496108_0033072 Ga0496108_0033072_1652_1987 108
5 3300048912 Ga0496109_0491458 Ga0496109_0491458_154_489 108
6 3300048913 Ga0496110_0079199 Ga0496110_0079199_1051_1386 108
7 3300048915 Ga0496112_0724257 Ga0496112_0724257_133_468 108
8 3300049571 Ga0501034_0029550 Ga0501034_0029550_1311_1646 108
9 3300049572 Ga0501036_0012710 Ga0501036_0012710_6101_6436 108
10 3300049574 Ga0501038_0001608 Ga0501038_0001608_10188_10523 108
11 3300049581 Ga0501047_0189540 Ga0501047_0189540_1405_1740 108
12 3300049589 Ga0501073_0224284 Ga0501073_0224284_900_1235 108
13 3300049822 Ga0501035_0011104 Ga0501035_0011104_6820_7155 108
14 3300049568 Ga0501031_0003208 Ga0501031_0003208_5584_5922 109
15 3300049569 Ga0501032_0025726 Ga0501032_0025726_970_1308 109
16 3300049570 Ga0501033_0012104 Ga0501033_0012104_3212_3550 109
17 3300049571 Ga0501034_0135127 Ga0501034_0135127_260_598 109
18 3300049572 Ga0501036_0006349 Ga0501036_0006349_6492_6830 109
19 3300049573 Ga0501037_0003345 Ga0501037_0003345_5333_5671 109
20 3300049574 Ga0501038_0008686 Ga0501038_0008686_6405_6743 109
21 3300049575 Ga0501039_0017542 Ga0501039_0017542_4408_4746 109
22 3300049578 Ga0501042_0008843 Ga0501042_0008843_2557_2895 109
23 3300049579 Ga0501043_0010413 Ga0501043_0010413_4891_5229 109
24 3300049579 Ga0501043_0035213 Ga0501043_0035213_3470_3808 109
25 3300049579 Ga0501043_0169899 Ga0501043_0169899_796_1134 109
26 3300049580 Ga0501046_0004864 Ga0501046_0004864_6414_6752 109
27 3300049580 Ga0501046_0006883 Ga0501046_0006883_2955_3293 109
28 3300049581 Ga0501047_0008061 Ga0501047_0008061_4396_4734 109
29 3300049582 Ga0501048_0004741 Ga0501048_0004741_3722_4060 109
30 3300049583 Ga0501067_0116746 Ga0501067_0116746_103_441 109
31 3300049586 Ga0501070_0027513 Ga0501070_0027513_2761_3099 109
32 3300049589 Ga0501073_0022862 Ga0501073_0022862_3308_3646 109
33 3300049741 Ga0501079_0463165 Ga0501079_0463165_172_510 109
34 3300049742 Ga0501080_0017838 Ga0501080_0017838_1464_1802 109
35 3300049744 Ga0501083_0124386 Ga0501083_0124386_525_863 109
36 3300049822 Ga0501035_0022301 Ga0501035_0022301_1081_1419 109
37 3300049824 Ga0501045_0862706 Ga0501045_0862706_118_456 109
38 3300030744 Ga0316181_1267792 Ga0316181_12677921 110
39 3300031548 Ga0307408_100823779 Ga0307408_1008237792 110
40 3300031727 Ga0316576_10072067 Ga0316576_100720672 110
41 3300031727 Ga0316576_10109421 Ga0316576_101094216 110
42 3300031731 Ga0307405_11096628 Ga0307405_110966281 110
43 3300031824 Ga0307413_10396376 Ga0307413_103963762 110
44 3300031911 Ga0307412_11178772 Ga0307412_111787722 110
45 3300032005 Ga0307411_10626526 Ga0307411_106265262 110
46 3300032126 Ga0307415_101113400 Ga0307415_1011134001 110
47 3300032139 Ga0316580_10018025 Ga0316580_100180253 110
48 3300035398 Ga0316574_0033512 Ga0316574_0033512_1950_2297 110
49 3300036647 Ga0316582_0155248 Ga0316582_0155248_970_1317 110
50 3300036712 Ga0316584_0237273 Ga0316584_0237273_126_473 110
51 3300036712 Ga0316584_0888839 Ga0316584_0888839_126_473 110
52 3300041451 Ga0451791_0823325 Ga0451791_0823325_62_460 110
53 3300041494 Ga0451837_1056526 Ga0451837_1056526_210_578 110
54 3300042435 Ga0439434_0185876 Ga0439434_0185876_277_621 110
55 3300049570 Ga0501033_0249912 Ga0501033_0249912_584_934 110
56 3300049572 Ga0501036_0519119 Ga0501036_0519119_304_654 110
57 3300049573 Ga0501037_0106542 Ga0501037_0106542_13_363 110
58 3300049575 Ga0501039_1469731 Ga0501039_1469731_21_362 110
59 3300049579 Ga0501043_0055005 Ga0501043_0055005_1796_2146 110
60 3300049583 Ga0501067_0147639 Ga0501067_0147639_346_690 110
61 3300049672 Ga0501239_028626 Ga0501239_028626_274_624 110
62 3300049704 Ga0501221_162628 Ga0501221_162628_77_427 110
63 3300049765 Ga0501268_131896 Ga0501268_131896_112_462 110
64 3300053102 Ga0500554_241306 Ga0500554_241306_100_450 110
65 3300053129 Ga0500628_001677 Ga0500628_001677_2368_2718 110
66 3300059426 Ga0590077_003370 Ga0590077_003370_81_431 110
67 iso_pu_bacteria 2643221641 2644227990 110
68 iso_pu_bacteria 2818991462 2819692953 110
69 iso_pu_bacteria 2818991469 2819727361 110
70 iso_pu_bacteria 8054609563 8054611917 110
71 iso_pu_bacteria 2739367898 2740165499 111
72 iso_pu_bacteria 2887443736 2887447383 111
73 iso_pu_bacteria 2984592036 2984593839 111
74 3300005327 Ga0070658_10469195 Ga0070658_104691952 112
75 3300005330 Ga0070690_101086402 Ga0070690_1010864022 112
76 3300005338 Ga0068868_100750935 Ga0068868_1007509352 112
77 3300005366 Ga0070659_100198775 Ga0070659_1001987752 112
78 3300005535 Ga0070684_100359157 Ga0070684_1003591572 112
79 3300005578 Ga0068854_100640424 Ga0068854_1006404242 112
80 3300005616 Ga0068852_100914579 Ga0068852_1009145792 112
81 3300005617 Ga0068859_100428064 Ga0068859_1004280642 112
82 3300005834 Ga0068851_10428119 Ga0068851_104281191 112
83 3300005840 Ga0068870_11175043 Ga0068870_111750431 112
84 3300005844 Ga0068862_100684854 Ga0068862_1006848542 112
85 3300006852 Ga0075433_10599854 Ga0075433_105998542 112
86 3300006931 Ga0097620_100428035 Ga0097620_1004280352 112
87 3300009101 Ga0105247_11724077 Ga0105247_117240772 112
88 3300009174 Ga0105241_11148214 Ga0105241_111482142 112
89 3300009553 Ga0105249_13015553 Ga0105249_130155531 112
90 3300013306 Ga0163162_12265450 Ga0163162_122654502 112
91 3300013308 Ga0157375_10738587 Ga0157375_107385871 112
92 3300014969 Ga0157376_11259070 Ga0157376_112590702 112
93 3300025931 Ga0207644_10284802 Ga0207644_102848022 112
94 3300026023 Ga0207677_10201940 Ga0207677_102019402 112
95 3300026075 Ga0207708_10706490 Ga0207708_107064902 112
96 3300028380 Ga0268265_12124401 Ga0268265_121244011 112
97 3300031903 Ga0307407_10268831 Ga0307407_102688312 112
98 3300037312 Ga0395899_0021176 Ga0395899_0021176_137_496 112
99 3300005340 Ga0070689_100957360 Ga0070689_1009573601 113
100 3300005440 Ga0070705_100990124 Ga0070705_1009901241 113
101 3300005457 Ga0070662_100541414 Ga0070662_1005414141 113
102 3300005457 Ga0070662_101287955 Ga0070662_1012879551 113
103 3300005548 Ga0070665_100580483 Ga0070665_1005804832 113
104 3300005719 Ga0068861_100390287 Ga0068861_1003902871 113
105 3300006028 Ga0070717_11673354 Ga0070717_116733542 113
106 3300006038 Ga0075365_10421690 Ga0075365_104216902 113
107 3300006048 Ga0075363_100408298 Ga0075363_1004082982 113
108 3300006177 Ga0075362_10299092 Ga0075362_102990921 113
109 3300006353 Ga0075370_10432573 Ga0075370_104325732 113
110 3300009093 Ga0105240_11774399 Ga0105240_117743992 113
111 3300009101 Ga0105247_10045278 Ga0105247_100452783 113
112 3300009148 Ga0105243_10100682 Ga0105243_101006823 113
113 3300009551 Ga0105238_11177748 Ga0105238_111777482 113
114 3300009553 Ga0105249_10733325 Ga0105249_107333252 113
115 3300013102 Ga0157371_10457167 Ga0157371_104571671 113
116 3300013104 Ga0157370_10898914 Ga0157370_108989141 113
117 3300013308 Ga0157375_10810299 Ga0157375_108102992 113
118 3300013308 Ga0157375_12858765 Ga0157375_128587651 113
119 3300017792 Ga0163161_10010769 Ga0163161_100107694 113
120 3300017792 Ga0163161_11325617 Ga0163161_113256171 113
121 3300025900 Ga0207710_10192423 Ga0207710_101924233 113
122 3300025927 Ga0207687_10765887 Ga0207687_107658871 113
123 3300025935 Ga0207709_10019688 Ga0207709_100196881 113
124 3300025961 Ga0207712_10671081 Ga0207712_106710812 113
125 3300026035 Ga0207703_10134665 Ga0207703_101346653 113
126 3300026088 Ga0207641_11653258 Ga0207641_116532582 113
127 3300026118 Ga0207675_100063241 Ga0207675_1000632413 113
128 3300031251 Ga0265327_10005797 Ga0265327_100057976 113
129 3300031456 Ga0307513_10494635 Ga0307513_104946351 113
130 3300031731 Ga0307405_10141883 Ga0307405_101418833 113
131 3300031731 Ga0307405_11311081 Ga0307405_113110812 113
132 3300032126 Ga0307415_100187269 Ga0307415_1001872692 113
133 3300041486 Ga0451807_0730687 Ga0451807_0730687_119_460 113
134 3300041512 Ga0451853_3321742 Ga0451853_3321742_36_422 113
135 3300044658 Ga0466972_0163752 Ga0466972_0163752_579_920 113
136 3300044683 Ga0466965_0035420 Ga0466965_0035420_1089_1430 113
137 3300044765 Ga0466970_0959790 Ga0466970_0959790_138_479 113
138 3300044901 Ga0466960_0000047 Ga0466960_0000047_31644_31985 113
139 3300044901 Ga0466960_0209757 Ga0466960_0209757_461_817 113
140 3300044901 Ga0466960_0899331 Ga0466960_0899331_158_511 113
141 3300045976 Ga0466967_0133250 Ga0466967_0133250_1525_1866 113
142 3300048903 Ga0496100_0887187 Ga0496100_0887187_343_684 113
143 3300048905 Ga0496102_0112459 Ga0496102_0112459_1471_1812 113
144 3300048907 Ga0496104_0395685 Ga0496104_0395685_854_1195 113
145 3300048909 Ga0496106_0044600 Ga0496106_0044600_83_442 113
146 3300048910 Ga0496107_0184094 Ga0496107_0184094_248_589 113
147 3300048911 Ga0496108_0872555 Ga0496108_0872555_39_380 113
148 3300048913 Ga0496110_0849388 Ga0496110_0849388_360_701 113
149 3300048915 Ga0496112_0743080 Ga0496112_0743080_395_736 113
150 3300050492 nmdc:mga0yw44_1224126_c1 nmdc:mga0yw44_1224126_c1_139_480 113
151 3300050492 nmdc:mga0yw44_520292_c1 nmdc:mga0yw44_520292_c1_125_478 113
152 3300050494 nmdc:mga06z11_17630_c1 nmdc:mga06z11_17630_c1_999_1349 113
153 3300050496 nmdc:mga07m45_434981_c1 nmdc:mga07m45_434981_c1_158_508 113
154 3300005338 Ga0068868_100532669 Ga0068868_1005326692 114
155 3300005456 Ga0070678_100495728 Ga0070678_1004957282 114
156 3300005841 Ga0068863_101271179 Ga0068863_1012711792 114
157 3300006038 Ga0075365_10081477 Ga0075365_100814772 114
158 3300006038 Ga0075365_10723269 Ga0075365_107232692 114
159 3300025901 Ga0207688_10592477 Ga0207688_105924772 114
160 3300026121 Ga0207683_10477243 Ga0207683_104772432 114
161 3300026121 Ga0207683_10485551 Ga0207683_104855512 114
162 3300031548 Ga0307408_100753578 Ga0307408_1007535782 114
163 3300031727 Ga0316576_10036488 Ga0316576_100364883 114
164 3300031728 Ga0316578_10100253 Ga0316578_101002532 114
165 3300031852 Ga0307410_10427280 Ga0307410_104272802 114
166 3300031852 Ga0307410_10860287 Ga0307410_108602872 114
167 3300031852 Ga0307410_11063358 Ga0307410_110633581 114
168 3300031911 Ga0307412_10641378 Ga0307412_106413781 114
169 3300031995 Ga0307409_100090679 Ga0307409_1000906793 114
170 3300031995 Ga0307409_100725713 Ga0307409_1007257132 114
171 3300031995 Ga0307409_101116547 Ga0307409_1011165471 114
172 3300032004 Ga0307414_10846994 Ga0307414_108469942 114
173 3300035398 Ga0316574_0036491 Ga0316574_0036491_2221_2601 114
174 3300036712 Ga0316584_0031624 Ga0316584_0031624_1988_2368 114
175 3300039450 Ga0436363_0784123 Ga0436363_0784123_616_990 114
176 3300039450 Ga0436363_1464562 Ga0436363_1464562_227_595 114
177 3300041451 Ga0451791_0395707 Ga0451791_0395707_80_451 114
178 3300041451 Ga0451791_0873618 Ga0451791_0873618_947_1315 114
179 3300041494 Ga0451837_1469442 Ga0451837_1469442_1288_1656 114
180 3300041496 Ga0451839_1086898 Ga0451839_1086898_110_496 114
181 3300041498 Ga0451841_1172005 Ga0451841_1172005_85_447 114
182 3300041509 Ga0451843_1284914 Ga0451843_1284914_144_530 114
183 3300041509 Ga0451843_1659197 Ga0451843_1659197_181_546 114
184 3300048903 Ga0496100_0137415 Ga0496100_0137415_625_999 114
185 3300048905 Ga0496102_0035739 Ga0496102_0035739_2899_3273 114
186 3300048907 Ga0496104_0084388 Ga0496104_0084388_1542_1916 114
187 3300048915 Ga0496112_0125016 Ga0496112_0125016_861_1235 114
188 3300048916 Ga0496113_0657388 Ga0496113_0657388_107_481 114
189 3300048929 Ga0496126_0000003 Ga0496126_0000003_730822_731178 114
190 3300049572 Ga0501036_0926978 Ga0501036_0926978_282_638 114
191 3300049573 Ga0501037_0452261 Ga0501037_0452261_147_503 114
192 3300049574 Ga0501038_1327348 Ga0501038_1327348_128_484 114
193 3300049575 Ga0501039_0419694 Ga0501039_0419694_425_796 114
194 3300049576 Ga0501040_0291171 Ga0501040_0291171_658_1029 114
195 3300049577 Ga0501041_0134604 Ga0501041_0134604_114_485 114
196 3300049578 Ga0501042_0121581 Ga0501042_0121581_501_872 114
197 3300049587 Ga0501071_0704576 Ga0501071_0704576_47_418 114
198 3300049590 Ga0501074_1236619 Ga0501074_1236619_29_400 114
199 3300049822 Ga0501035_0415645 Ga0501035_0415645_10_408 114
200 3300049824 Ga0501045_0225415 Ga0501045_0225415_637_993 114
201 3300050491 nmdc:mga00v17_524411_c1 nmdc:mga00v17_524411_c1_370_714 114
202 3300050492 nmdc:mga0yw44_1006938_c1 nmdc:mga0yw44_1006938_c1_204_548 114
203 3300050492 nmdc:mga0yw44_26429_c1 nmdc:mga0yw44_26429_c1_2483_2899 114
204 iso_pu_bacteria 2643221561 2643826966 114
205 iso_pu_bacteria 2643221696 2644534313 114
206 3300041453 Ga0451797_0183980 Ga0451797_0183980_427_801 115
207 3300049583 Ga0501067_0563970 Ga0501067_0563970_233_601 116
208 3300045836 Ga0466958_0542158 Ga0466958_0542158_352_705 117
209 3300003792 Ga0055540_1015684 Ga0055540_10156843 118
210 3300005719 Ga0068861_102318525 Ga0068861_1023185251 118
211 3300006038 Ga0075365_10407898 Ga0075365_104078981 118
212 3300006051 Ga0075364_10179248 Ga0075364_101792482 118
213 3300006177 Ga0075362_10734637 Ga0075362_107346372 118
214 3300025303 Ga0209051_1003597 Ga0209051_10035979 118
215 3300050491 nmdc:mga00v17_317777_c1 nmdc:mga00v17_317777_c1_387_758 118
216 3300050492 nmdc:mga0yw44_762541_c1 nmdc:mga0yw44_762541_c1_97_468 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

21

70

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

23

69

0.96

PF13518

HTH_28

Helix-turn-helix domain

25

82

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gho-assembly1.cif.gz_B crystal structure of spx in complex with yjbh 0.9286 34 76
6ghb-assembly2.cif.gz_D crystal structure of spx in complex with yjbh (oxidized) 0.9276 34 76
6ghb-assembly1.cif.gz_B crystal structure of spx in complex with yjbh (oxidized) 0.9246 34 76
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9215 7 75
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8879 7 89
ID Description Score Start End Superfamily
af_Q55GD9_117_192_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9061 44 76 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9015 7 90 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8632 3 87 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8612 19 76 1.10.10.10
af_P0C0A1_101_176_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8599 42 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2S9G3J3-F1-model_v4 Transcriptional regulator 0.9507 4 86 GO:0003700
AF-Q0AYF3-F1-model_v4 Transcriptional regulator, ArsR family 0.9427 11 89 GO:0003700
GO:0046685
AF-W1UDA1-F1-model_v4 deleted 0.934 7 87
AF-A0A3D5LWB7-F1-model_v4 deleted 0.9295 7 88
AF-A0A3D1WSD3-F1-model_v4 deleted 0.9281 8 90

Feature Viewer

pLDDT pTM Quality
90.92 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map