F327665

General Info

Members Datasets Scaffolds Average Seq Length
216 106 216 192

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10621860|Ga0207700_106218602
Length 199
Sequence MAMMSRTAEIERKTGETEIFVSLGVDGDGAGVRETGVGFLDHMLDLLARHGRLDLAVRANGDLHTGAHHTVEDVGICIGQALDQALGDRAGIARYGHATVPMDESRASAAIDISGRGLLAFDASLPPGSIGNFDHELTEEFFRALATNAKLTLHVTVEKGTNVHHVIEAVFKAVARALRLAVAIDPTEHGVPSTKGTLT

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
8 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
9 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
10 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
11 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
12 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
15 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
16 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
17 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
18 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
24 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
25 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
26 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
27 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
28 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
29 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
30 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
31 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
32 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
33 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
34 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
35 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
36 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
37 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
38 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
39 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
40 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
41 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
42 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
45 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
54 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
57 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
58 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
59 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
60 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
64 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
67 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
68 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
71 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
74 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
75 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
93 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
98 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
99 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
100 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
101 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
102 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
103 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 1.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 5.56
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 18.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10145239 3300005434 Bacteria 1634
2 Ga0070714_100083015 3300005435 Bacteria 2793
3 Ga0070714_100489040 3300005435 Bacteria 1172
4 Ga0070713_100086314 3300005436 Bacteria 2691
5 Ga0070713_100139290 3300005436 Bacteria 2147
6 Ga0070710_10005494 3300005437 Bacteria 6023
7 Ga0070711_100467147 3300005439 Bacteria 1035
8 Ga0068856_100077476 3300005614 Bacteria 3294
9 Ga0070717_10007369 3300006028 Bacteria 8170
10 Ga0070717_10010026 3300006028 Bacteria 7131
11 Ga0070717_10039093 3300006028 Bacteria 3859
12 Ga0070717_10644232 3300006028 Bacteria 962
13 Ga0070712_100018303 3300006175 Bacteria 4548
14 Ga0075428_100238343 3300006844 Bacteria 1963
15 Ga0075431_100008031 3300006847 Bacteria 10528
16 Ga0075434_100047780 3300006871 Bacteria 4246
17 Ga0075435_100078582 3300007076 Bacteria 2706
18 Ga0075435_100487819 3300007076 Bacteria 1065
19 Ga0111539_10132777 3300009094 Bacteria 2915
20 Ga0213873_10037218 3300021358 Bacteria 1239
21 Ga0213874_10000133 3300021377 Bacteria 12605
22 Ga0213874_10118455 3300021377 Bacteria 897
23 Ga0213876_10011762 3300021384 Bacteria 4668
24 Ga0213876_10024394 3300021384 Bacteria 3193
25 Ga0213876_10042130 3300021384 Bacteria 2413
26 Ga0213876_10045191 3300021384 Bacteria 2329
27 Ga0213876_10050498 3300021384 Bacteria 2198
28 Ga0213876_10053480 3300021384 Bacteria 2133
29 Ga0213876_10119088 3300021384 Bacteria 1401
30 Ga0213875_10000919 3300021388 Bacteria 21303
31 Ga0213875_10014661 3300021388 Bacteria 3823
32 Ga0213875_10027836 3300021388 Bacteria 2689
33 Ga0213875_10168165 3300021388 Bacteria 1029
34 Ga0207692_10001597 3300025898 Bacteria 8540
35 Ga0207693_10001908 3300025915 Bacteria 18240
36 Ga0207700_10135992 3300025928 Bacteria 2013
37 Ga0207700_10621860 3300025928 Bacteria 962
38 Ga0207664_10026706 3300025929 Bacteria 4366
39 Ga0207664_10038395 3300025929 Bacteria 3713
40 Ga0207702_10031262 3300026078 Bacteria 4437
41 Ga0207428_10013763 3300027907 Bacteria 7052
42 Ga0373934_0194273 3300035086 Bacteria 835
43 Ga0373923_0166148 3300035111 Bacteria 1009
44 Ga0373953_0016407 3300035117 Bacteria 2703
45 Ga0373954_0048151 3300035118 Bacteria 1997
46 Ga0373943_0209987 3300035170 Bacteria 1081
47 Ga0373955_0120816 3300035172 Bacteria 1523
48 Ga0373935_0575103 3300035692 Bacteria 823
49 Ga0373927_0506304 3300035695 Bacteria 798
50 Ga0373933_0280360 3300035724 Bacteria 1077
51 Ga0373947_0387337 3300035725 Unclassified 942
52 Ga0373937_0135996 3300036401 Bacteria 2298
53 Ga0373937_0507399 3300036401 Bacteria 1146
54 Ga0395900_0009968 3300037418 Bacteria 9726
55 Ga0395898_0002006 3300037466 Bacteria 25548
56 Ga0436364_0127444 3300037853 Bacteria 1352
57 Ga0436364_0260630 3300037853 Bacteria 18389
58 Ga0436364_0399660 3300037853 Bacteria 3791
59 Ga0436364_0784998 3300037853 Bacteria 9739
60 Ga0436364_0922110 3300037853 Bacteria 5002
61 Ga0436364_0930394 3300037853 Bacteria 22678
62 Ga0436364_1235831 3300037853 Bacteria 2891
63 Ga0436365_0112986 3300039437 Unclassified 1071
64 Ga0436365_0422673 3300039437 Bacteria 5482
65 Ga0436365_0483303 3300039437 Bacteria 2617
66 Ga0436365_0577751 3300039437 Bacteria 985
67 Ga0436365_0887741 3300039437 Bacteria 34339
68 Ga0436365_1003668 3300039437 Bacteria 2548
69 Ga0436365_1054346 3300039437 Bacteria 2349
70 Ga0436365_1121654 3300039437 Bacteria 1503
71 Ga0436365_1133939 3300039437 Bacteria 4275
72 Ga0436365_1279901 3300039437 Bacteria 1029
73 Ga0436365_1681994 3300039437 Bacteria 5002
74 Ga0436365_1702970 3300039437 Bacteria 5677
75 Ga0436365_1822920 3300039437 Bacteria 1946
76 Ga0436363_0117281 3300039450 Bacteria 1846
77 Ga0436363_0362249 3300039450 Bacteria 1302
78 Ga0436363_0452637 3300039450 Bacteria 3231
79 Ga0436363_0530695 3300039450 Bacteria 8499
80 Ga0436363_0734208 3300039450 Bacteria 1438
81 Ga0436363_0768115 3300039450 Bacteria 912
82 Ga0436363_1301125 3300039450 Bacteria 33245
83 Ga0436363_1713166 3300039450 Bacteria 4258
84 Ga0436362_0094959 3300039453 Bacteria 2977
85 Ga0436362_0107746 3300039453 Bacteria 1594
86 Ga0436362_0156364 3300039453 Bacteria 2198
87 Ga0436362_0366096 3300039453 Bacteria 3346
88 Ga0436362_0427775 3300039453 Bacteria 1162
89 Ga0436362_0924859 3300039453 Bacteria 863
90 Ga0466969_0063193 3300044656 Bacteria 1795
91 Ga0466966_0072203 3300044684 Bacteria 2162
92 Ga0466966_0072841 3300044684 Bacteria 2150
93 Ga0466966_0100417 3300044684 Bacteria 1790
94 Ga0466966_0107237 3300044684 Bacteria 1724
95 Ga0466966_0200900 3300044684 Bacteria 1206
96 Ga0466966_0230761 3300044684 Bacteria 1117
97 Ga0466966_0266186 3300044684 Bacteria 1032
98 Ga0466961_0067519 3300044693 Bacteria 2271
99 Ga0466963_0003247 3300044694 Bacteria 9262
100 Ga0466963_0034824 3300044694 Bacteria 3278
101 Ga0466963_0107241 3300044694 Bacteria 1916
102 Ga0466963_0120030 3300044694 Bacteria 1808
103 Ga0466963_0342850 3300044694 Bacteria 1052
104 Ga0466964_0270095 3300044706 Bacteria 846
105 Ga0466971_0015969 3300044719 Bacteria 3308
106 Ga0466971_0020737 3300044719 Bacteria 2921
107 Ga0466971_0049210 3300044719 Bacteria 1896
108 Ga0466971_0132634 3300044719 Bacteria 1157
109 Ga0466971_0189964 3300044719 Bacteria 967
110 Ga0466968_0046122 3300044735 Bacteria 1851
111 Ga0466968_0093445 3300044735 Bacteria 1336
112 Ga0466968_0099112 3300044735 Bacteria 1299
113 Ga0466970_0168550 3300044765 Bacteria 1213
114 Ga0466970_0423505 3300044765 Bacteria 761
115 Ga0466970_0482023 3300044765 Bacteria 713
116 Ga0466957_0079250 3300044842 Bacteria 2044
117 Ga0466957_0090399 3300044842 Bacteria 1917
118 Ga0466957_0521670 3300044842 Bacteria 825
119 Ga0466959_0003996 3300045049 Bacteria 9801
120 Ga0466959_0014287 3300045049 Bacteria 5763
121 Ga0466959_0048907 3300045049 Bacteria 3107
122 Ga0466959_0066771 3300045049 Bacteria 2609
123 Ga0466959_0138960 3300045049 Bacteria 1718
124 Ga0466959_0145169 3300045049 Bacteria 1675
125 Ga0466959_0158914 3300045049 Bacteria 1589
126 Ga0466959_0308783 3300045049 Bacteria 1082
127 Ga0466959_0321340 3300045049 Bacteria 1058
128 Ga0466959_0424798 3300045049 Bacteria 902
129 Ga0466959_0687068 3300045049 Bacteria 686
130 Ga0466958_0003618 3300045836 Bacteria 8057
131 Ga0466958_0004697 3300045836 Bacteria 7251
132 Ga0466958_0016801 3300045836 Bacteria 4220
133 Ga0466958_0026659 3300045836 Bacteria 3416
134 Ga0466958_0094506 3300045836 Bacteria 1852
135 Ga0466958_0200038 3300045836 Bacteria 1271
136 Ga0466958_0271276 3300045836 Bacteria 1086
137 Ga0466958_0363866 3300045836 Bacteria 932
138 Ga0466958_0581902 3300045836 Bacteria 728
139 Ga0466967_0036059 3300045976 Bacteria 4219
140 Ga0466967_0128466 3300045976 Bacteria 2350
141 Ga0466967_0255221 3300045976 Bacteria 1676
142 Ga0466967_0261026 3300045976 Bacteria 1657
143 Ga0466967_0309485 3300045976 Bacteria 1521
144 Ga0466967_0607957 3300045976 Bacteria 1079
145 Ga0466967_0617863 3300045976 Bacteria 1070
146 Ga0466967_0923132 3300045976 Bacteria 868
147 Ga0495592_0460656 3300046454 Bacteria 795
148 Ga0495641_0000262 3300046461 Bacteria 41503
149 Ga0495641_0035861 3300046461 Bacteria 2334
150 Ga0495651_0115836 3300046462 Bacteria 1975
151 Ga0495653_0140107 3300046463 Bacteria 1702
152 Ga0495653_0434611 3300046463 Unclassified 828
153 Ga0495662_0100151 3300046476 Bacteria 1417
154 Ga0495664_0195018 3300046477 Bacteria 1228
155 Ga0495664_0287191 3300046477 Bacteria 994
156 Ga0495596_0020254 3300046500 Unclassified 2725
157 Ga0495608_0088029 3300046511 Bacteria 2010
158 Ga0495616_0160359 3300046513 Bacteria 1012
159 Ga0495628_0077850 3300046516 Bacteria 2579
160 Ga0495631_0010425 3300046518 Bacteria 4597
161 Ga0495644_0059374 3300046523 Bacteria 1438
162 Ga0495652_0138686 3300046529 Bacteria 1915
163 Ga0495652_0143345 3300046529 Bacteria 1876
164 Ga0495640_0291918 3300046533 Bacteria 1014
165 Ga0495667_0010760 3300046559 Bacteria 6184
166 Ga0495656_0004320 3300046615 Bacteria 4859
167 Ga0495635_0063916 3300046663 Bacteria 2527
168 Ga0495657_0074527 3300046675 Bacteria 2208
169 Ga0495599_0097560 3300046678 Bacteria 1832
170 Ga0495613_0135933 3300046689 Bacteria 1759
171 Ga0495624_0561321 3300046690 Bacteria 681
172 Ga0495589_0097086 3300046794 Bacteria 1428
173 Ga0495600_0018890 3300046809 Bacteria 4398
174 Ga0495604_0105933 3300047317 Bacteria 2057
175 Ga0495674_0069789 3300047319 Bacteria 3038
176 Ga0495674_0403420 3300047319 Bacteria 1103
177 Ga0495674_0427710 3300047319 Bacteria 1066
178 Ga0495680_0051601 3300047322 Bacteria 3210
179 Ga0495673_0023810 3300047469 Bacteria 2970
180 Ga0495684_0023182 3300047471 Bacteria 4772
181 Ga0495684_0693146 3300047471 Unclassified 676
182 Ga0495686_0000008 3300047472 Bacteria 727479
183 Ga0495686_0012560 3300047472 Bacteria 5920
184 Ga0495602_0404855 3300048088 Bacteria 972
185 Ga0496104_0049736 3300048907 Bacteria 3953
186 Ga0496104_0119632 3300048907 Bacteria 2529
187 Ga0496104_0342006 3300048907 Bacteria 1409
188 Ga0496104_0633906 3300048907 Bacteria 978
189 Ga0496105_0158820 3300048908 Bacteria 1856
190 Ga0496110_0432124 3300048913 Bacteria 1200
191 Ga0496111_0164818 3300048914 Bacteria 1646
192 Ga0496112_0050974 3300048915 Bacteria 4060
193 Ga0496113_0095221 3300048916 Bacteria 2301
194 Ga0496114_0041704 3300048917 Bacteria 3804
195 Ga0496114_1240341 3300048917 Bacteria 632
196 Ga0496115_0093658 3300048918 Bacteria 2457
197 nmdc:mga05p37_101229_c1 3300050507 Bacteria 3548
198 nmdc:mga09592_104496_c1 3300050508 Bacteria 2427
199 nmdc:mga06r32_27570_c1 3300050510 Bacteria 5309
200 nmdc:mga08y16_117430_c1 3300050511 Bacteria 2769
201 nmdc:mga0n895_39917_c1 3300050512 Bacteria 4558
202 nmdc:mga0rr50_413747_c1 3300050513 Bacteria 1140
203 nmdc:mga0rr50_67092_c1 3300050513 Bacteria 2724
204 nmdc:mga0a205_13148_c1 3300050515 Bacteria 7320
205 Ga0495601_0083769 3300053077 Bacteria 2048
206 Ga0495612_0053582 3300053078 Bacteria 1661
207 Ga0495612_0197859 3300053078 Bacteria 886
208 Ga0495595_0038047 3300053084 Bacteria 2190
209 Ga0495619_0127798 3300053085 Bacteria 1745
210 Ga0500628_012374 3300053129 Bacteria 1570
211 Ga0587083_0001606 3300059505 Bacteria 2592
212 Ga0587115_002400 3300059626 Bacteria 1859
213 Ga0587114_000543 3300059655 Bacteria 2617
214 Ga0466962_0013244 3300061719 Bacteria 3965
215 Ga0466962_0152462 3300061719 Bacteria 1121
216 Ga0466962_0304478 3300061719 Bacteria 789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1054346 Ga0436365_1054346_1182_1778 160
2 3300021384 Ga0213876_10050498 Ga0213876_100504982 161
3 3300039453 Ga0436362_0094959 Ga0436362_0094959_2023_2619 161
4 3300044684 Ga0466966_0230761 Ga0466966_0230761_384_974 161
5 3300045049 Ga0466959_0687068 Ga0466959_0687068_22_612 161
6 3300045836 Ga0466958_0581902 Ga0466958_0581902_58_648 161
7 3300047471 Ga0495684_0693146 Ga0495684_0693146_18_509 161
8 3300045836 Ga0466958_0026659 Ga0466958_0026659_1594_2184 165
9 3300044719 Ga0466971_0189964 Ga0466971_0189964_293_883 173
10 3300044765 Ga0466970_0482023 Ga0466970_0482023_80_670 173
11 3300044842 Ga0466957_0079250 Ga0466957_0079250_63_653 173
12 3300061719 Ga0466962_0304478 Ga0466962_0304478_71_661 173
13 3300039450 Ga0436363_0452637 Ga0436363_0452637_1334_1924 174
14 3300036401 Ga0373937_0507399 Ga0373937_0507399_460_1056 176
15 3300039450 Ga0436363_0117281 Ga0436363_0117281_524_1114 176
16 3300046454 Ga0495592_0460656 Ga0495592_0460656_41_637 176
17 3300053077 Ga0495601_0083769 Ga0495601_0083769_168_764 176
18 3300021388 Ga0213875_10168165 Ga0213875_101681652 177
19 3300037853 Ga0436364_1235831 Ga0436364_1235831_964_1554 177
20 3300039437 Ga0436365_1822920 Ga0436365_1822920_383_973 177
21 3300037853 Ga0436364_0399660 Ga0436364_0399660_1487_2077 178
22 3300044684 Ga0466966_0100417 Ga0466966_0100417_1172_1762 178
23 3300044735 Ga0466968_0093445 Ga0466968_0093445_637_1227 178
24 3300045049 Ga0466959_0003996 Ga0466959_0003996_7966_8556 178
25 3300045836 Ga0466958_0003618 Ga0466958_0003618_7041_7631 178
26 3300046529 Ga0495652_0143345 Ga0495652_0143345_369_959 178
27 3300039437 Ga0436365_1681994 Ga0436365_1681994_2787_3386 179
28 3300039450 Ga0436363_1301125 Ga0436363_1301125_22577_23176 179
29 3300021377 Ga0213874_10000133 Ga0213874_100001333 180
30 3300021384 Ga0213876_10053480 Ga0213876_100534803 180
31 3300039450 Ga0436363_0768115 Ga0436363_0768115_201_791 180
32 3300046500 Ga0495596_0020254 Ga0495596_0020254_1075_1749 180
33 3300046513 Ga0495616_0160359 Ga0495616_0160359_70_675 180
34 3300046518 Ga0495631_0010425 Ga0495631_0010425_1388_1993 180
35 3300046523 Ga0495644_0059374 Ga0495644_0059374_540_1145 180
36 3300046615 Ga0495656_0004320 Ga0495656_0004320_1821_2426 180
37 3300046794 Ga0495589_0097086 Ga0495589_0097086_70_744 180
38 3300047469 Ga0495673_0023810 Ga0495673_0023810_398_1072 180
39 3300053129 Ga0500628_012374 Ga0500628_012374_772_1377 180
40 3300039437 Ga0436365_1279901 Ga0436365_1279901_83_682 181
41 3300045049 Ga0466959_0321340 Ga0466959_0321340_307_852 181
42 3300046461 Ga0495641_0000262 Ga0495641_0000262_31040_31645 181
43 3300046476 Ga0495662_0100151 Ga0495662_0100151_546_1151 181
44 3300046477 Ga0495664_0195018 Ga0495664_0195018_423_1013 181
45 3300045976 Ga0466967_0255221 Ga0466967_0255221_647_1237 182
46 3300021358 Ga0213873_10037218 Ga0213873_100372182 183
47 3300039453 Ga0436362_0107746 Ga0436362_0107746_306_896 183
48 3300005435 Ga0070714_100083015 Ga0070714_1000830154 184
49 3300025929 Ga0207664_10038395 Ga0207664_100383952 184
50 3300044684 Ga0466966_0072203 Ga0466966_0072203_1092_1682 184
51 3300044694 Ga0466963_0342850 Ga0466963_0342850_324_914 185
52 3300039450 Ga0436363_0362249 Ga0436363_0362249_160_750 186
53 3300005436 Ga0070713_100086314 Ga0070713_1000863143 187
54 3300005439 Ga0070711_100467147 Ga0070711_1004671472 187
55 3300006028 Ga0070717_10010026 Ga0070717_100100265 187
56 3300039450 Ga0436363_1713166 Ga0436363_1713166_1912_2502 187
57 3300045836 Ga0466958_0271276 Ga0466958_0271276_166_756 190
58 3300045976 Ga0466967_0261026 Ga0466967_0261026_693_1283 190
59 3300006844 Ga0075428_100238343 Ga0075428_1002383432 195
60 3300006847 Ga0075431_100008031 Ga0075431_1000080318 195
61 3300006871 Ga0075434_100047780 Ga0075434_1000477807 195
62 3300007076 Ga0075435_100078582 Ga0075435_1000785823 195
63 3300009094 Ga0111539_10132777 Ga0111539_101327773 195
64 3300021388 Ga0213875_10000919 Ga0213875_1000091914 195
65 3300027907 Ga0207428_10013763 Ga0207428_100137633 195
66 3300037853 Ga0436364_0127444 Ga0436364_0127444_711_1307 195
67 3300037853 Ga0436364_0930394 Ga0436364_0930394_10118_10738 195
68 3300048915 Ga0496112_0050974 Ga0496112_0050974_3309_3899 195
69 3300050507 nmdc:mga05p37_101229_c1 nmdc:mga05p37_101229_c1_1689_2276 195
70 3300050508 nmdc:mga09592_104496_c1 nmdc:mga09592_104496_c1_1088_1675 195
71 3300050510 nmdc:mga06r32_27570_c1 nmdc:mga06r32_27570_c1_2423_3010 195
72 3300050511 nmdc:mga08y16_117430_c1 nmdc:mga08y16_117430_c1_1002_1589 195
73 3300050512 nmdc:mga0n895_39917_c1 nmdc:mga0n895_39917_c1_1566_2153 195
74 3300050513 nmdc:mga0rr50_67092_c1 nmdc:mga0rr50_67092_c1_1052_1639 195
75 3300050515 nmdc:mga0a205_13148_c1 nmdc:mga0a205_13148_c1_2861_3448 195
76 3300005434 Ga0070709_10145239 Ga0070709_101452392 196
77 3300005435 Ga0070714_100489040 Ga0070714_1004890401 196
78 3300005436 Ga0070713_100139290 Ga0070713_1001392902 196
79 3300005437 Ga0070710_10005494 Ga0070710_100054943 196
80 3300005614 Ga0068856_100077476 Ga0068856_1000774762 196
81 3300006028 Ga0070717_10007369 Ga0070717_100073695 196
82 3300006028 Ga0070717_10039093 Ga0070717_100390936 196
83 3300006028 Ga0070717_10644232 Ga0070717_106442321 196
84 3300006175 Ga0070712_100018303 Ga0070712_1000183036 196
85 3300007076 Ga0075435_100487819 Ga0075435_1004878192 196
86 3300021377 Ga0213874_10118455 Ga0213874_101184551 196
87 3300021384 Ga0213876_10011762 Ga0213876_100117626 196
88 3300021384 Ga0213876_10024394 Ga0213876_100243942 196
89 3300021384 Ga0213876_10042130 Ga0213876_100421302 196
90 3300021384 Ga0213876_10045191 Ga0213876_100451913 196
91 3300021384 Ga0213876_10119088 Ga0213876_101190883 196
92 3300021388 Ga0213875_10014661 Ga0213875_100146614 196
93 3300021388 Ga0213875_10027836 Ga0213875_100278363 196
94 3300025898 Ga0207692_10001597 Ga0207692_100015978 196
95 3300025915 Ga0207693_10001908 Ga0207693_100019085 196
96 3300025928 Ga0207700_10135992 Ga0207700_101359922 196
97 3300025928 Ga0207700_10621860 Ga0207700_106218602 196
98 3300025929 Ga0207664_10026706 Ga0207664_100267063 196
99 3300026078 Ga0207702_10031262 Ga0207702_100312624 196
100 3300035086 Ga0373934_0194273 Ga0373934_0194273_108_698 196
101 3300035111 Ga0373923_0166148 Ga0373923_0166148_53_655 196
102 3300035117 Ga0373953_0016407 Ga0373953_0016407_1300_1890 196
103 3300035118 Ga0373954_0048151 Ga0373954_0048151_394_984 196
104 3300035170 Ga0373943_0209987 Ga0373943_0209987_378_968 196
105 3300035172 Ga0373955_0120816 Ga0373955_0120816_598_1188 196
106 3300035692 Ga0373935_0575103 Ga0373935_0575103_16_606 196
107 3300035695 Ga0373927_0506304 Ga0373927_0506304_101_691 196
108 3300035724 Ga0373933_0280360 Ga0373933_0280360_53_643 196
109 3300035725 Ga0373947_0387337 Ga0373947_0387337_342_932 196
110 3300036401 Ga0373937_0135996 Ga0373937_0135996_1644_2234 196
111 3300037418 Ga0395900_0009968 Ga0395900_0009968_366_956 196
112 3300037466 Ga0395898_0002006 Ga0395898_0002006_1852_2442 196
113 3300037853 Ga0436364_0260630 Ga0436364_0260630_3389_3979 196
114 3300037853 Ga0436364_0784998 Ga0436364_0784998_724_1314 196
115 3300037853 Ga0436364_0922110 Ga0436364_0922110_349_939 196
116 3300039437 Ga0436365_0112986 Ga0436365_0112986_212_802 196
117 3300039437 Ga0436365_0422673 Ga0436365_0422673_2167_2757 196
118 3300039437 Ga0436365_0483303 Ga0436365_0483303_152_751 196
119 3300039437 Ga0436365_0577751 Ga0436365_0577751_349_939 196
120 3300039437 Ga0436365_0887741 Ga0436365_0887741_17967_18557 196
121 3300039437 Ga0436365_1003668 Ga0436365_1003668_1766_2356 196
122 3300039437 Ga0436365_1121654 Ga0436365_1121654_411_1001 196
123 3300039437 Ga0436365_1133939 Ga0436365_1133939_724_1314 196
124 3300039437 Ga0436365_1702970 Ga0436365_1702970_2135_2725 196
125 3300039450 Ga0436363_0530695 Ga0436363_0530695_6177_6767 196
126 3300039450 Ga0436363_0734208 Ga0436363_0734208_590_1180 196
127 3300039453 Ga0436362_0156364 Ga0436362_0156364_1220_1810 196
128 3300039453 Ga0436362_0366096 Ga0436362_0366096_826_1416 196
129 3300039453 Ga0436362_0427775 Ga0436362_0427775_334_933 196
130 3300039453 Ga0436362_0924859 Ga0436362_0924859_128_718 196
131 3300044656 Ga0466969_0063193 Ga0466969_0063193_210_800 196
132 3300044684 Ga0466966_0072841 Ga0466966_0072841_1304_1894 196
133 3300044684 Ga0466966_0107237 Ga0466966_0107237_252_842 196
134 3300044684 Ga0466966_0200900 Ga0466966_0200900_570_1160 196
135 3300044684 Ga0466966_0266186 Ga0466966_0266186_43_633 196
136 3300044693 Ga0466961_0067519 Ga0466961_0067519_1414_2004 196
137 3300044694 Ga0466963_0003247 Ga0466963_0003247_2972_3562 196
138 3300044694 Ga0466963_0034824 Ga0466963_0034824_2406_2996 196
139 3300044694 Ga0466963_0107241 Ga0466963_0107241_218_808 196
140 3300044694 Ga0466963_0120030 Ga0466963_0120030_460_1050 196
141 3300044706 Ga0466964_0270095 Ga0466964_0270095_187_777 196
142 3300044719 Ga0466971_0015969 Ga0466971_0015969_29_619 196
143 3300044719 Ga0466971_0020737 Ga0466971_0020737_128_718 196
144 3300044719 Ga0466971_0049210 Ga0466971_0049210_848_1438 196
145 3300044719 Ga0466971_0132634 Ga0466971_0132634_262_852 196
146 3300044735 Ga0466968_0046122 Ga0466968_0046122_1231_1821 196
147 3300044735 Ga0466968_0099112 Ga0466968_0099112_390_980 196
148 3300044765 Ga0466970_0168550 Ga0466970_0168550_438_1028 196
149 3300044765 Ga0466970_0423505 Ga0466970_0423505_92_682 196
150 3300044842 Ga0466957_0090399 Ga0466957_0090399_522_1112 196
151 3300044842 Ga0466957_0521670 Ga0466957_0521670_162_752 196
152 3300045049 Ga0466959_0014287 Ga0466959_0014287_1678_2268 196
153 3300045049 Ga0466959_0048907 Ga0466959_0048907_1366_1956 196
154 3300045049 Ga0466959_0066771 Ga0466959_0066771_1399_1995 196
155 3300045049 Ga0466959_0138960 Ga0466959_0138960_316_906 196
156 3300045049 Ga0466959_0145169 Ga0466959_0145169_37_627 196
157 3300045049 Ga0466959_0158914 Ga0466959_0158914_293_883 196
158 3300045049 Ga0466959_0308783 Ga0466959_0308783_55_645 196
159 3300045049 Ga0466959_0424798 Ga0466959_0424798_178_768 196
160 3300045836 Ga0466958_0004697 Ga0466958_0004697_1564_2154 196
161 3300045836 Ga0466958_0016801 Ga0466958_0016801_900_1490 196
162 3300045836 Ga0466958_0094506 Ga0466958_0094506_986_1576 196
163 3300045836 Ga0466958_0200038 Ga0466958_0200038_223_813 196
164 3300045836 Ga0466958_0363866 Ga0466958_0363866_309_899 196
165 3300045976 Ga0466967_0036059 Ga0466967_0036059_2853_3443 196
166 3300045976 Ga0466967_0128466 Ga0466967_0128466_1465_2055 196
167 3300045976 Ga0466967_0309485 Ga0466967_0309485_609_1199 196
168 3300045976 Ga0466967_0607957 Ga0466967_0607957_72_662 196
169 3300045976 Ga0466967_0617863 Ga0466967_0617863_407_997 196
170 3300045976 Ga0466967_0923132 Ga0466967_0923132_145_735 196
171 3300046461 Ga0495641_0035861 Ga0495641_0035861_561_1151 196
172 3300046462 Ga0495651_0115836 Ga0495651_0115836_359_949 196
173 3300046463 Ga0495653_0140107 Ga0495653_0140107_862_1452 196
174 3300046463 Ga0495653_0434611 Ga0495653_0434611_166_756 196
175 3300046477 Ga0495664_0287191 Ga0495664_0287191_112_702 196
176 3300046511 Ga0495608_0088029 Ga0495608_0088029_436_1026 196
177 3300046516 Ga0495628_0077850 Ga0495628_0077850_1265_1855 196
178 3300046529 Ga0495652_0138686 Ga0495652_0138686_424_1014 196
179 3300046533 Ga0495640_0291918 Ga0495640_0291918_53_643 196
180 3300046559 Ga0495667_0010760 Ga0495667_0010760_53_643 196
181 3300046663 Ga0495635_0063916 Ga0495635_0063916_1113_1703 196
182 3300046675 Ga0495657_0074527 Ga0495657_0074527_1051_1641 196
183 3300046678 Ga0495599_0097560 Ga0495599_0097560_907_1497 196
184 3300046689 Ga0495613_0135933 Ga0495613_0135933_829_1419 196
185 3300046690 Ga0495624_0561321 Ga0495624_0561321_56_646 196
186 3300046809 Ga0495600_0018890 Ga0495600_0018890_3669_4259 196
187 3300047317 Ga0495604_0105933 Ga0495604_0105933_372_962 196
188 3300047319 Ga0495674_0069789 Ga0495674_0069789_978_1568 196
189 3300047319 Ga0495674_0403420 Ga0495674_0403420_402_992 196
190 3300047319 Ga0495674_0427710 Ga0495674_0427710_381_971 196
191 3300047322 Ga0495680_0051601 Ga0495680_0051601_1096_1686 196
192 3300047471 Ga0495684_0023182 Ga0495684_0023182_2292_2882 196
193 3300047472 Ga0495686_0000008 Ga0495686_0000008_11549_12154 196
194 3300047472 Ga0495686_0012560 Ga0495686_0012560_3495_4091 196
195 3300048088 Ga0495602_0404855 Ga0495602_0404855_144_734 196
196 3300048907 Ga0496104_0049736 Ga0496104_0049736_2283_2873 196
197 3300048907 Ga0496104_0119632 Ga0496104_0119632_1734_2324 196
198 3300048907 Ga0496104_0342006 Ga0496104_0342006_509_1108 196
199 3300048907 Ga0496104_0633906 Ga0496104_0633906_151_741 196
200 3300048908 Ga0496105_0158820 Ga0496105_0158820_920_1510 196
201 3300048913 Ga0496110_0432124 Ga0496110_0432124_124_714 196
202 3300048914 Ga0496111_0164818 Ga0496111_0164818_745_1335 196
203 3300048916 Ga0496113_0095221 Ga0496113_0095221_1301_1891 196
204 3300048917 Ga0496114_0041704 Ga0496114_0041704_2533_3123 196
205 3300048917 Ga0496114_1240341 Ga0496114_1240341_24_614 196
206 3300048918 Ga0496115_0093658 Ga0496115_0093658_1718_2308 196
207 3300050513 nmdc:mga0rr50_413747_c1 nmdc:mga0rr50_413747_c1_231_821 196
208 3300053078 Ga0495612_0053582 Ga0495612_0053582_1042_1632 196
209 3300053078 Ga0495612_0197859 Ga0495612_0197859_120_710 196
210 3300053084 Ga0495595_0038047 Ga0495595_0038047_283_873 196
211 3300053085 Ga0495619_0127798 Ga0495619_0127798_770_1360 196
212 3300059505 Ga0587083_0001606 Ga0587083_0001606_155_745 196
213 3300059626 Ga0587115_002400 Ga0587115_002400_519_1109 196
214 3300059655 Ga0587114_000543 Ga0587114_000543_1797_2387 196
215 3300061719 Ga0466962_0013244 Ga0466962_0013244_3032_3622 196
216 3300061719 Ga0466962_0152462 Ga0466962_0152462_37_627 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

35

178

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9818 3 183
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9793 1 185
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9789 1 185
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.975 3 182
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9741 1 185
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.986 3 89 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9761 91 180 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9756 1 89 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9681 91 183 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9643 91 178 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A534WID5-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9957 2 107 GO:0000105
GO:0004424
AF-A0A353XU77-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9946 1 99 GO:0000105
GO:0004424
AF-W4TS96-F1-model_v4 deleted 0.9932 3 92
AF-A0A3M2A4Z6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.993 3 107 GO:0000105
GO:0004424
AF-A0A3C0Y201-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.993 1 99 GO:0000105
GO:0004424

Feature Viewer

pLDDT pTM Quality
92.52 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map