F327652

General Info

Members Datasets Scaffolds Average Seq Length
216 162 432 165

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10990133|Ga0207671_109901331
Length 190
Sequence MVRRKITLTWSEIKHRSRMGHRAGCENPAVSIEPVRRGHWPDVARIYAEGIATGNATFETDVPTWEQWDASHLAEHRFVALRDGVVAGFAAVSAVSDRCVYGGVVENSVYVAESARGAGLGQLLLERLIASTESAGIWTIQSGIFPENDASLRLHERVGFRVVGRRARLGKLAGVWRDVLLVERRSEAIE

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
162 2643221677 Streptomyces sp. Root1304 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0.46
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.72
Rhizosphere 89.35
Stem 0
Stem Tuber 0
Unclassified 3.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10990133 3300025914 Bacteria 663
2 Ga0070658_10157343 3300005327 Bacteria 1905
3 Ga0070683_100271634 3300005329 Bacteria 1613
4 Ga0070683_101867491 3300005329 Bacteria 577
5 Ga0070690_101133003 3300005330 Archaea 622
6 Ga0070670_100618364 3300005331 Bacteria 970
7 Ga0070660_100397645 3300005339 Bacteria 1139
8 Ga0070669_101359583 3300005353 Bacteria 616
9 Ga0070659_100320877 3300005366 Unclassified 1295
10 Ga0070713_100775814 3300005436 Bacteria 918
11 Ga0070701_10062225 3300005438 Bacteria 1971
12 Ga0070711_100652829 3300005439 Bacteria 882
13 Ga0070708_101149030 3300005445 Bacteria 727
14 Ga0070663_100405873 3300005455 Bacteria 1115
15 Ga0070681_10364247 3300005458 Bacteria 1356
16 Ga0070679_100354027 3300005530 Bacteria 1416
17 Ga0070684_100030780 3300005535 Bacteria 4564
18 Ga0070684_101218809 3300005535 Bacteria 708
19 Ga0068853_101582674 3300005539 Bacteria 635
20 Ga0070686_100054583 3300005544 Bacteria 2556
21 Ga0070695_100972519 3300005545 Bacteria 689
22 Ga0070704_100993110 3300005549 Bacteria 759
23 Ga0070664_100186397 3300005564 Bacteria 1847
24 Ga0068856_100162443 3300005614 Bacteria 2244
25 Ga0070702_100039980 3300005615 Bacteria 2621
26 Ga0068852_100676418 3300005616 Bacteria 1041
27 Ga0068866_10805522 3300005718 Bacteria 653
28 Ga0068861_100063339 3300005719 Bacteria 2842
29 Ga0068858_100579324 3300005842 Unclassified 1087
30 Ga0081540_1019225 3300005983 Bacteria 4161
31 Ga0070716_100704634 3300006173 Bacteria 772
32 Ga0070712_101367898 3300006175 Bacteria 617
33 Ga0070712_101395838 3300006175 Bacteria 611
34 Ga0075434_100100815 3300006871 Bacteria 2894
35 Ga0068865_100107950 3300006881 Bacteria 2048
36 Ga0075435_100024191 3300007076 Bacteria 4709
37 Ga0105240_10247705 3300009093 Bacteria 2062
38 Ga0111539_10009679 3300009094 Bacteria 12165
39 Ga0111539_10590890 3300009094 Unclassified 1293
40 Ga0105245_10273721 3300009098 Bacteria 1648
41 Ga0105245_10696424 3300009098 Bacteria 1049
42 Ga0114129_10000041 3300009147 Bacteria 107656
43 Ga0114129_10850724 3300009147 Bacteria 1160
44 Ga0105243_10099193 3300009148 Bacteria 2414
45 Ga0105242_10486728 3300009176 Unclassified 1170
46 Ga0105242_11262644 3300009176 Bacteria 761
47 Ga0105237_10375234 3300009545 Bacteria 1427
48 Ga0105237_11418116 3300009545 Unclassified 701
49 Ga0105249_10013121 3300009553 Bacteria 7311
50 Ga0105239_10310115 3300010375 Bacteria 1778
51 Ga0157338_1007481 3300012515 Bacteria 1037
52 Ga0157373_10066534 3300013100 Bacteria 2549
53 Ga0157369_10397790 3300013105 Bacteria 1429
54 Ga0163162_10013042 3300013306 Bacteria 8112
55 Ga0157372_10058743 3300013307 Bacteria 4300
56 Ga0182008_10239680 3300014497 Bacteria 933
57 Ga0157377_10275272 3300014745 Bacteria 1101
58 Ga0157376_10179032 3300014969 Bacteria 1936
59 Ga0197907_10775782 3300020069 Bacteria 663
60 Ga0213871_10020734 3300021441 Bacteria 1632
61 Ga0207642_10793557 3300025899 Bacteria 602
62 Ga0207695_10548325 3300025913 Bacteria 1038
63 Ga0207693_10919560 3300025915 Bacteria 671
64 Ga0207657_10308024 3300025919 Bacteria 1254
65 Ga0207652_10519815 3300025921 Bacteria 1071
66 Ga0207646_10020771 3300025922 Bacteria 6081
67 Ga0207700_10913088 3300025928 Bacteria 786
68 Ga0207644_10112970 3300025931 Bacteria 2057
69 Ga0207686_10157429 3300025934 Bacteria 1589
70 Ga0207709_10231196 3300025935 Bacteria 1339
71 Ga0207670_10356147 3300025936 Bacteria 1160
72 Ga0207669_10163061 3300025937 Bacteria 1577
73 Ga0207665_10753716 3300025939 Bacteria 768
74 Ga0207689_10947960 3300025942 Unclassified 726
75 Ga0207661_10267412 3300025944 Bacteria 1525
76 Ga0207661_11329623 3300025944 Bacteria 660
77 Ga0207679_10124573 3300025945 Bacteria 2057
78 Ga0207667_10587263 3300025949 Bacteria 1124
79 Ga0207640_10099640 3300025981 Bacteria 2034
80 Ga0207703_10102504 3300026035 Bacteria 2428
81 Ga0207648_10078113 3300026089 Bacteria 2887
82 Ga0207675_100001437 3300026118 Bacteria 23867
83 Ga0207683_10112676 3300026121 Bacteria 2436
84 Ga0207428_10033909 3300027907 Bacteria 4187
85 Ga0268264_10456091 3300028381 Bacteria 1239
86 Ga0265338_10965980 3300028800 Bacteria 578
87 Ga0307408_100069858 3300031548 Bacteria 2591
88 Ga0316578_10442174 3300031728 Bacteria 769
89 Ga0307405_10104703 3300031731 Bacteria 1904
90 Ga0307413_10003977 3300031824 Bacteria 6344
91 Ga0307410_10285615 3300031852 Bacteria 1296
92 Ga0307406_10009895 3300031901 Bacteria 5367
93 Ga0307407_10000662 3300031903 Bacteria 11078
94 Ga0307409_100004018 3300031995 Bacteria 8163
95 Ga0307416_100002728 3300032002 Bacteria 10236
96 Ga0307416_100206812 3300032002 Bacteria 1868
97 Ga0307414_10050991 3300032004 Bacteria 2870
98 Ga0307411_10068243 3300032005 Bacteria 2396
99 Ga0307415_100077923 3300032126 Bacteria 2355
100 Ga0307415_100733011 3300032126 Bacteria 895
101 Ga0373944_0005782 3300035089 Bacteria 3269
102 Ga0373943_0009851 3300035170 Bacteria 4279
103 Ga0373947_0005231 3300035725 Bacteria 7583
104 Ga0373947_0348603 3300035725 Bacteria 993
105 Ga0373925_0312435 3300037068 Unclassified 1270
106 Ga0436360_0170176 3300039438 Bacteria 10243
107 Ga0466961_0058387 3300044693 Bacteria 2455
108 Ga0466963_0003090 3300044694 Bacteria 9438
109 Ga0466963_0152564 3300044694 Bacteria 1605
110 Ga0466964_0000962 3300044706 Bacteria 9518
111 Ga0466959_0142154 3300045049 Bacteria 1695
112 Ga0466967_0044757 3300045976 Bacteria 3841
113 Ga0466967_0053241 3300045976 Bacteria 3556
114 Ga0466967_0285365 3300045976 Bacteria 1585
115 Ga0495603_0000295 3300046455 Bacteria 26481
116 Ga0495641_0002427 3300046461 Bacteria 14724
117 Ga0495582_0166798 3300046473 Bacteria 1253
118 Ga0495594_0000171 3300046499 Bacteria 31144
119 Ga0495630_0009471 3300046517 Bacteria 7008
120 Ga0495666_0082882 3300046526 Bacteria 1516
121 Ga0495665_0085493 3300046531 Bacteria 1658
122 Ga0495622_0084444 3300046557 Bacteria 1460
123 Ga0495634_0604982 3300046642 Bacteria 636
124 Ga0495588_0000386 3300046674 Bacteria 25212
125 Ga0495658_0171636 3300046683 Bacteria 1342
126 Ga0495604_0745181 3300047317 Bacteria 620
127 Ga0495676_0003527 3300047321 Bacteria 14179
128 Ga0495626_0098912 3300048091 Bacteria 1274
129 Ga0496100_0154218 3300048903 Bacteria 1641
130 Ga0496100_0705411 3300048903 Archaea 788
131 Ga0496102_0209874 3300048905 Bacteria 1836
132 Ga0496103_0109389 3300048906 Bacteria 1755
133 Ga0496104_0041098 3300048907 Bacteria 4335
134 Ga0496104_0135391 3300048907 Bacteria 2367
135 Ga0496104_1030129 3300048907 Bacteria 727
136 Ga0496106_0317856 3300048909 Bacteria 1250
137 Ga0496107_0077739 3300048910 Bacteria 2417
138 Ga0496108_0002868 3300048911 Bacteria 13837
139 Ga0496108_0412613 3300048911 Bacteria 1179
140 Ga0496110_0004610 3300048913 Bacteria 10705
141 Ga0496110_0191378 3300048913 Bacteria 1858
142 Ga0496111_0000101 3300048914 Bacteria 37061
143 Ga0496111_0020125 3300048914 Bacteria 4642
144 Ga0496112_0915005 3300048915 Bacteria 799
145 Ga0496113_0208566 3300048916 Bacteria 1555
146 Ga0496113_0302737 3300048916 Bacteria 1280
147 Ga0496114_0297077 3300048917 Bacteria 1426
148 Ga0496115_0023092 3300048918 Bacteria 4825
149 Ga0496115_0811027 3300048918 Bacteria 728
150 Ga0501031_0102395 3300049568 Bacteria 1868
151 Ga0501033_0028901 3300049570 Bacteria 4166
152 Ga0501034_0194870 3300049571 Bacteria 1987
153 Ga0501036_0004106 3300049572 Bacteria 11716
154 Ga0501036_0433403 3300049572 Bacteria 1096
155 Ga0501036_0645342 3300049572 Bacteria 876
156 Ga0501037_0036810 3300049573 Bacteria 3606
157 Ga0501037_0281552 3300049573 Bacteria 1158
158 Ga0501038_0000446 3300049574 Bacteria 36005
159 Ga0501038_0034834 3300049574 Bacteria 4424
160 Ga0501039_0565526 3300049575 Bacteria 892
161 Ga0501039_0729156 3300049575 Bacteria 774
162 Ga0501040_0024153 3300049576 Bacteria 4078
163 Ga0501040_0109709 3300049576 Bacteria 1929
164 Ga0501041_0196484 3300049577 Bacteria 1264
165 Ga0501041_0535420 3300049577 Bacteria 746
166 Ga0501041_0662233 3300049577 Bacteria 667
167 Ga0501043_0659343 3300049579 Bacteria 768
168 Ga0501043_0915069 3300049579 Bacteria 628
169 Ga0501046_0004564 3300049580 Bacteria 12535
170 Ga0501046_0107061 3300049580 Bacteria 2139
171 Ga0501048_0310534 3300049582 Bacteria 1122
172 Ga0501067_0000495 3300049583 Bacteria 21600
173 Ga0501067_0280663 3300049583 Bacteria 927
174 Ga0501069_0012727 3300049585 Bacteria 4478
175 Ga0501069_0024070 3300049585 Bacteria 3322
176 Ga0501069_0068692 3300049585 Bacteria 1983
177 Ga0501070_0083022 3300049586 Bacteria 2652
178 Ga0501072_0072363 3300049588 Bacteria 2724
179 Ga0501072_0691988 3300049588 Bacteria 801
180 Ga0501074_0047000 3300049590 Bacteria 3120
181 Ga0501075_0002256 3300049591 Bacteria 12770
182 Ga0501075_0446747 3300049591 Bacteria 986
183 Ga0501076_0001348 3300049592 Bacteria 16417
184 Ga0501076_0094408 3300049592 Bacteria 2408
185 Ga0501076_0113919 3300049592 Bacteria 2188
186 Ga0501077_0010996 3300049593 Bacteria 5641
187 Ga0501077_0041717 3300049593 Bacteria 2920
188 Ga0501079_0014553 3300049741 Bacteria 5999
189 Ga0501079_1000991 3300049741 Bacteria 658
190 Ga0501080_0182853 3300049742 Bacteria 1928
191 Ga0501081_0006008 3300049743 Bacteria 7860
192 Ga0501081_0349082 3300049743 Bacteria 1090
193 Ga0501081_0603899 3300049743 Bacteria 821
194 Ga0501083_0133569 3300049744 Bacteria 1627
195 Ga0501083_0137625 3300049744 Bacteria 1599
196 Ga0501035_0036231 3300049822 Bacteria 4472
197 Ga0501035_0690019 3300049822 Bacteria 824
198 Ga0501044_0073211 3300049823 Bacteria 3483
199 Ga0501044_0080846 3300049823 Bacteria 3291
200 Ga0501045_0031005 3300049824 Bacteria 3871
201 Ga0501045_0609159 3300049824 Bacteria 808
202 nmdc:mga05p37_661240_c1 3300050507 Bacteria 1168
203 nmdc:mga05p37_93664_c1 3300050507 Bacteria 3702
204 nmdc:mga06r32_418386_c1 3300050510 Bacteria 1321
205 nmdc:mga08y16_48474_c1 3300050511 Bacteria 4446
206 nmdc:mga0n895_421125_c1 3300050512 Bacteria 1350
207 nmdc:mga0rr50_3884_c1 3300050513 Bacteria 8694
208 Ga0501084_0004599 3300054114 Bacteria 11278
209 Ga0501084_0069592 3300054114 Bacteria 2946
210 Ga0501084_0137410 3300054114 Bacteria 2057
211 Ga0501084_0161799 3300054114 Bacteria 1888
212 Ga0501082_0003737 3300060353 Bacteria 13299
213 Ga0501082_0100476 3300060353 Bacteria 2502
214 Ga0501082_0594156 3300060353 Bacteria 968
215 2643945824 2643221587 Bacteria 7586415
216 2644432613 2643221677 Bacteria 7584031
217 Ga0207671_10990133
218 Ga0070658_10157343
219 Ga0070683_100271634
220 Ga0070683_101867491
221 Ga0070690_101133003
222 Ga0070670_100618364
223 Ga0070660_100397645
224 Ga0070669_101359583
225 Ga0070659_100320877
226 Ga0070713_100775814
227 Ga0070701_10062225
228 Ga0070711_100652829
229 Ga0070708_101149030
230 Ga0070663_100405873
231 Ga0070681_10364247
232 Ga0070679_100354027
233 Ga0070684_100030780
234 Ga0070684_101218809
235 Ga0068853_101582674
236 Ga0070686_100054583
237 Ga0070695_100972519
238 Ga0070704_100993110
239 Ga0070664_100186397
240 Ga0068856_100162443
241 Ga0070702_100039980
242 Ga0068852_100676418
243 Ga0068866_10805522
244 Ga0068861_100063339
245 Ga0068858_100579324
246 Ga0081540_1019225
247 Ga0070716_100704634
248 Ga0070712_101367898
249 Ga0070712_101395838
250 Ga0075434_100100815
251 Ga0068865_100107950
252 Ga0075435_100024191
253 Ga0105240_10247705
254 Ga0111539_10009679
255 Ga0111539_10590890
256 Ga0105245_10273721
257 Ga0105245_10696424
258 Ga0114129_10000041
259 Ga0114129_10850724
260 Ga0105243_10099193
261 Ga0105242_10486728
262 Ga0105242_11262644
263 Ga0105237_10375234
264 Ga0105237_11418116
265 Ga0105249_10013121
266 Ga0105239_10310115
267 Ga0157338_1007481
268 Ga0157373_10066534
269 Ga0157369_10397790
270 Ga0163162_10013042
271 Ga0157372_10058743
272 Ga0182008_10239680
273 Ga0157377_10275272
274 Ga0157376_10179032
275 Ga0197907_10775782
276 Ga0213871_10020734
277 Ga0207642_10793557
278 Ga0207695_10548325
279 Ga0207693_10919560
280 Ga0207657_10308024
281 Ga0207652_10519815
282 Ga0207646_10020771
283 Ga0207700_10913088
284 Ga0207644_10112970
285 Ga0207686_10157429
286 Ga0207709_10231196
287 Ga0207670_10356147
288 Ga0207669_10163061
289 Ga0207665_10753716
290 Ga0207689_10947960
291 Ga0207661_10267412
292 Ga0207661_11329623
293 Ga0207679_10124573
294 Ga0207667_10587263
295 Ga0207640_10099640
296 Ga0207703_10102504
297 Ga0207648_10078113
298 Ga0207675_100001437
299 Ga0207683_10112676
300 Ga0207428_10033909
301 Ga0268264_10456091
302 Ga0265338_10965980
303 Ga0307408_100069858
304 Ga0316578_10442174
305 Ga0307405_10104703
306 Ga0307413_10003977
307 Ga0307410_10285615
308 Ga0307406_10009895
309 Ga0307407_10000662
310 Ga0307409_100004018
311 Ga0307416_100002728
312 Ga0307416_100206812
313 Ga0307414_10050991
314 Ga0307411_10068243
315 Ga0307415_100077923
316 Ga0307415_100733011
317 Ga0373944_0005782
318 Ga0373943_0009851
319 Ga0373947_0005231
320 Ga0373947_0348603
321 Ga0373925_0312435
322 Ga0436360_0170176
323 Ga0466961_0058387
324 Ga0466963_0003090
325 Ga0466963_0152564
326 Ga0466964_0000962
327 Ga0466959_0142154
328 Ga0466967_0044757
329 Ga0466967_0053241
330 Ga0466967_0285365
331 Ga0495603_0000295
332 Ga0495641_0002427
333 Ga0495582_0166798
334 Ga0495594_0000171
335 Ga0495630_0009471
336 Ga0495666_0082882
337 Ga0495665_0085493
338 Ga0495622_0084444
339 Ga0495634_0604982
340 Ga0495588_0000386
341 Ga0495658_0171636
342 Ga0495604_0745181
343 Ga0495676_0003527
344 Ga0495626_0098912
345 Ga0496100_0154218
346 Ga0496100_0705411
347 Ga0496102_0209874
348 Ga0496103_0109389
349 Ga0496104_0041098
350 Ga0496104_0135391
351 Ga0496104_1030129
352 Ga0496106_0317856
353 Ga0496107_0077739
354 Ga0496108_0002868
355 Ga0496108_0412613
356 Ga0496110_0004610
357 Ga0496110_0191378
358 Ga0496111_0000101
359 Ga0496111_0020125
360 Ga0496112_0915005
361 Ga0496113_0208566
362 Ga0496113_0302737
363 Ga0496114_0297077
364 Ga0496115_0023092
365 Ga0496115_0811027
366 Ga0501031_0102395
367 Ga0501033_0028901
368 Ga0501034_0194870
369 Ga0501036_0004106
370 Ga0501036_0433403
371 Ga0501036_0645342
372 Ga0501037_0036810
373 Ga0501037_0281552
374 Ga0501038_0000446
375 Ga0501038_0034834
376 Ga0501039_0565526
377 Ga0501039_0729156
378 Ga0501040_0024153
379 Ga0501040_0109709
380 Ga0501041_0196484
381 Ga0501041_0535420
382 Ga0501041_0662233
383 Ga0501043_0659343
384 Ga0501043_0915069
385 Ga0501046_0004564
386 Ga0501046_0107061
387 Ga0501048_0310534
388 Ga0501067_0000495
389 Ga0501067_0280663
390 Ga0501069_0012727
391 Ga0501069_0024070
392 Ga0501069_0068692
393 Ga0501070_0083022
394 Ga0501072_0072363
395 Ga0501072_0691988
396 Ga0501074_0047000
397 Ga0501075_0002256
398 Ga0501075_0446747
399 Ga0501076_0001348
400 Ga0501076_0094408
401 Ga0501076_0113919
402 Ga0501077_0010996
403 Ga0501077_0041717
404 Ga0501079_0014553
405 Ga0501079_1000991
406 Ga0501080_0182853
407 Ga0501081_0006008
408 Ga0501081_0349082
409 Ga0501081_0603899
410 Ga0501083_0133569
411 Ga0501083_0137625
412 Ga0501035_0036231
413 Ga0501035_0690019
414 Ga0501044_0073211
415 Ga0501044_0080846
416 Ga0501045_0031005
417 Ga0501045_0609159
418 nmdc:mga05p37_661240_c1
419 nmdc:mga05p37_93664_c1
420 nmdc:mga06r32_418386_c1
421 nmdc:mga08y16_48474_c1
422 nmdc:mga0n895_421125_c1
423 nmdc:mga0rr50_3884_c1
424 Ga0501084_0004599
425 Ga0501084_0069592
426 Ga0501084_0137410
427 Ga0501084_0161799
428 Ga0501082_0003737
429 Ga0501082_0100476
430 Ga0501082_0594156
431 2643945824
432 2644432613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

90

169

0.89

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

160

0.87

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

42

181

0.86

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

74

162

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t7d-assembly1.cif.gz_A crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a 0.9095 7 163
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9083 5 162
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.907 5 161
1yvo-assembly1.cif.gz_A hypothetical acetyltransferase from p.aeruginosa pa01 0.9034 7 161
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9021 7 161
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9491 114 162 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9262 87 162 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9185 5 162 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9038 53 140 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9007 7 161 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1W1VF75-F1-model_v4 GCN5-related N-acetyltransferase 0.9985 7 162 GO:0016747
AF-A0A538HZM2-F1-model_v4 N-acetyltransferase family protein 0.9979 4 162 GO:0016747
AF-A0A6I4I7J3-F1-model_v4 GNAT family N-acetyltransferase 0.9973 6 162 GO:0016747
GO:0046685
AF-A0A538BWD3-F1-model_v4 N-acetyltransferase family protein 0.9969 7 162 GO:0016747
AF-A0A4Z0PW60-F1-model_v4 N-acetyltransferase family protein 0.9965 7 163 GO:0016747

Map