F327424

General Info

Members Datasets Scaffolds Average Seq Length
216 180 432 333

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10003600|Ga0081455_100036009
Length 396
Sequence VETGDRSRVRPTLRPSEAQPSRTPGMEPTAYSLRFASASGSSSCPAFGSQQITGIRNVSGIEGGVPMSEPNPFQTLLQIAGGYCLPRCLHVVADLGVADVLDEAPRTAAELATAVGADADALGRVLRLLAAHGVFASQGDTFCHSPISRLLRTDHPQSLRAFTRMFGLPSWWAIYGALEHAVRTGRPATDDVLPDGFYAYFAAHPEESAVFNAAMVAKAHGQVAGILATYNFAGFRVIGDIGGGRGHLLRAVLNVVPTARGVLFDLPHVVQEVAGIASERLTLQAGDFFKDALPVCDAYLVMEVIHAWGDEEARAILHAIRRAAPSHAKVLLIEQMVPDAPGPHWSKMLDIHMLALLGGRQRTRQEYEGLFDSAGFAYQRELDTGAGISILEAVPA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
108 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
109 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
110 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 11.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10003600 3300005937 Bacteria 17787
2 JGI25407J50210_10003077 3300003373 Bacteria 3973
3 JGI25407J50210_10012929 3300003373 Unclassified 2142
4 Ga0065712_10079384 3300005290 Bacteria 3221
5 Ga0070676_10140336 3300005328 Bacteria 1537
6 Ga0070683_100023703 3300005329 Bacteria 5493
7 Ga0070683_100067875 3300005329 Bacteria 3322
8 Ga0070677_10073255 3300005333 Bacteria 1446
9 Ga0070689_100155161 3300005340 Unclassified 1848
10 Ga0070669_100087078 3300005353 Bacteria 2335
11 Ga0070671_100002800 3300005355 Bacteria 13551
12 Ga0070674_100233229 3300005356 Bacteria 1437
13 Ga0070673_100303823 3300005364 Bacteria 1405
14 Ga0070667_100327366 3300005367 Bacteria 1383
15 Ga0070714_100009050 3300005435 Bacteria 7803
16 Ga0070711_100131134 3300005439 Unclassified 1867
17 Ga0070694_100071749 3300005444 Unclassified 2387
18 Ga0070708_100019064 3300005445 Bacteria 5755
19 Ga0070678_100038704 3300005456 Bacteria 3359
20 Ga0070706_100003308 3300005467 Bacteria 15914
21 Ga0070706_100079528 3300005467 Unclassified 3034
22 Ga0070707_100054752 3300005468 Bacteria 3825
23 Ga0070698_100001299 3300005471 Bacteria 27844
24 Ga0070698_100195156 3300005471 Unclassified 1961
25 Ga0070699_100001701 3300005518 Bacteria 20042
26 Ga0070684_100218878 3300005535 Bacteria 1737
27 Ga0070697_100002501 3300005536 Bacteria 14144
28 Ga0070672_100003166 3300005543 Bacteria 10639
29 Ga0070695_100198200 3300005545 Bacteria 1433
30 Ga0070696_100001663 3300005546 Bacteria 14577
31 Ga0070696_100134765 3300005546 Unclassified 1800
32 Ga0070704_100080132 3300005549 Bacteria 2401
33 Ga0068857_100164990 3300005577 Bacteria 2011
34 Ga0068856_100244708 3300005614 Bacteria 1809
35 Ga0068864_100411982 3300005618 Unclassified 1286
36 Ga0068863_100392994 3300005841 Bacteria 1355
37 Ga0068858_100008708 3300005842 Bacteria 9744
38 Ga0068860_100325872 3300005843 Unclassified 1508
39 Ga0081538_10001898 3300005981 Bacteria 20986
40 Ga0081538_10002003 3300005981 Bacteria 20344
41 Ga0081538_10035993 3300005981 Bacteria 3240
42 Ga0081538_10036471 3300005981 Unclassified 3207
43 Ga0070712_100005102 3300006175 Bacteria 8128
44 Ga0075430_100193858 3300006846 Bacteria 1688
45 Ga0075433_10023548 3300006852 Bacteria 5185
46 Ga0075436_100130064 3300006914 Bacteria 1765
47 Ga0111539_10076365 3300009094 Bacteria 3944
48 Ga0105247_10163176 3300009101 Bacteria 1477
49 Ga0114129_10089300 3300009147 Bacteria 4272
50 Ga0114129_10284120 3300009147 Bacteria 2210
51 Ga0105243_10107024 3300009148 Viruses 2332
52 Ga0105239_10679748 3300010375 Unclassified 1176
53 Ga0157375_10116769 3300013308 Bacteria 2773
54 Ga0157375_10430906 3300013308 Bacteria 1485
55 Ga0163163_10053881 3300014325 Bacteria 3972
56 Ga0157380_10046862 3300014326 Bacteria 3397
57 Ga0157380_10213339 3300014326 Viruses 1722
58 Ga0157380_10442430 3300014326 Bacteria 1246
59 Ga0182008_10077809 3300014497 Bacteria 1632
60 Ga0207697_10008548 3300025315 Bacteria 4472
61 Ga0207653_10005755 3300025885 Unclassified 3865
62 Ga0207682_10021666 3300025893 Bacteria 2529
63 Ga0207645_10151076 3300025907 Unclassified 1516
64 Ga0207684_10042482 3300025910 Bacteria 3854
65 Ga0207693_10014788 3300025915 Bacteria 6269
66 Ga0207646_10003276 3300025922 Bacteria 18444
67 Ga0207681_10090829 3300025923 Bacteria 2180
68 Ga0207650_10010611 3300025925 Bacteria 6326
69 Ga0207659_10028966 3300025926 Bacteria 3768
70 Ga0207664_10011247 3300025929 Bacteria 6349
71 Ga0207664_10051219 3300025929 Bacteria 3259
72 Ga0207644_10002837 3300025931 Bacteria 11179
73 Ga0207670_10083047 3300025936 Bacteria 2246
74 Ga0207669_10008147 3300025937 Bacteria 4904
75 Ga0207665_10249277 3300025939 Bacteria 1311
76 Ga0207691_10075645 3300025940 Bacteria 3036
77 Ga0207689_10175360 3300025942 Bacteria 1768
78 Ga0207661_10074697 3300025944 Bacteria 2779
79 Ga0207661_10086026 3300025944 Bacteria 2608
80 Ga0207651_10009631 3300025960 Bacteria 5305
81 Ga0207658_10092548 3300025986 Bacteria 2349
82 Ga0207702_10167384 3300026078 Unclassified 2012
83 Ga0207641_10104229 3300026088 Bacteria 2504
84 Ga0207676_10188155 3300026095 Bacteria 1814
85 Ga0207674_10079067 3300026116 Unclassified 3294
86 Ga0207683_10017762 3300026121 Bacteria 6067
87 Ga0209995_1005020 3300027471 Bacteria 2123
88 Ga0209974_10004176 3300027876 Bacteria 5164
89 Ga0268264_10263528 3300028381 Unclassified 1607
90 Ga0307405_10008450 3300031731 Bacteria 5220
91 Ga0307405_10365034 3300031731 Bacteria 1119
92 Ga0307413_10124600 3300031824 Bacteria 1752
93 Ga0307406_10127359 3300031901 Bacteria 1781
94 Ga0307407_10049636 3300031903 Bacteria 2396
95 Ga0307409_100003718 3300031995 Bacteria 8377
96 Ga0307409_100018017 3300031995 Bacteria 4729
97 Ga0307409_100110998 3300031995 Bacteria 2299
98 Ga0307409_100633570 3300031995 Unclassified 1061
99 Ga0307416_100002512 3300032002 Bacteria 10549
100 Ga0307416_100035859 3300032002 Bacteria 3795
101 Ga0307416_100047831 3300032002 Bacteria 3389
102 Ga0307416_100353308 3300032002 Bacteria 1489
103 Ga0307416_100356069 3300032002 Unclassified 1483
104 Ga0307414_10087369 3300032004 Bacteria 2304
105 Ga0307415_100001480 3300032126 Bacteria 11254
106 Ga0307415_100010681 3300032126 Bacteria 5212
107 Ga0307415_100043397 3300032126 Bacteria 3000
108 Ga0307415_100052322 3300032126 Bacteria 2776
109 Ga0307415_100328275 3300032126 Bacteria 1279
110 Ga0373926_0002673 3300035083 Bacteria 5677
111 Ga0373934_0030448 3300035086 Bacteria 2110
112 Ga0373944_0003039 3300035089 Bacteria 4313
113 Ga0373923_0000123 3300035111 Bacteria 14220
114 Ga0373936_0000212 3300035113 Bacteria 19143
115 Ga0373945_0002489 3300035116 Bacteria 5778
116 Ga0373953_0002527 3300035117 Bacteria 5526
117 Ga0373954_0139886 3300035118 Bacteria 1180
118 Ga0373956_0012204 3300035119 Bacteria 3555
119 Ga0373957_0003506 3300035120 Bacteria 4648
120 Ga0373943_0000159 3300035170 Bacteria 26500
121 Ga0373943_0143001 3300035170 Bacteria 1290
122 Ga0373946_0000115 3300035171 Bacteria 23229
123 Ga0373955_0000305 3300035172 Bacteria 20352
124 Ga0316574_0056564 3300035398 Bacteria 2454
125 Ga0373924_0000259 3300035410 Bacteria 16207
126 Ga0373935_0000483 3300035692 Bacteria 20591
127 Ga0373927_0001255 3300035695 Bacteria 19246
128 Ga0373933_0000792 3300035724 Bacteria 19312
129 Ga0373947_0000799 3300035725 Bacteria 18976
130 Ga0373947_0228358 3300035725 Bacteria 1225
131 Ga0373937_0002957 3300036401 Bacteria 14219
132 Ga0316584_0075093 3300036712 Bacteria 2534
133 Ga0373925_0001495 3300037068 Bacteria 20063
134 Ga0373925_0007736 3300037068 Bacteria 7824
135 Ga0439448_0025471 3300042005 Unclassified 1855
136 Ga0439450_005012 3300042008 Bacteria 2300
137 Ga0439450_058794 3300042008 Bacteria 926
138 Ga0439455_0004719 3300042012 Bacteria 2718
139 Ga0439463_023314 3300042016 Bacteria 1550
140 Ga0439464_0009299 3300042439 Bacteria 2585
141 Ga0439460_0005032 3300042461 Bacteria 3232
142 Ga0466966_0012276 3300044684 Bacteria 5677
143 Ga0466960_0032222 3300044901 Bacteria 2425
144 Ga0466959_0023322 3300045049 Bacteria 4579
145 Ga0466967_0228227 3300045976 Unclassified 1772
146 Ga0466967_0315422 3300045976 Unclassified 1507
147 Ga0466967_0434961 3300045976 Bacteria 1280
148 Ga0495592_0000970 3300046454 Bacteria 19877
149 Ga0495603_0000347 3300046455 Bacteria 24826
150 Ga0495629_0002044 3300046459 Bacteria 15678
151 Ga0495641_0001047 3300046461 Bacteria 23774
152 Ga0495651_0001208 3300046462 Bacteria 19935
153 Ga0495653_0001201 3300046463 Bacteria 20097
154 Ga0495580_0001933 3300046472 Bacteria 18204
155 Ga0495580_0002494 3300046472 Bacteria 16053
156 Ga0495582_0000627 3300046473 Bacteria 19445
157 Ga0495639_0001192 3300046475 Bacteria 11734
158 Ga0495662_0000372 3300046476 Bacteria 19792
159 Ga0495664_0000326 3300046477 Bacteria 22948
160 Ga0495608_0001527 3300046511 Bacteria 16473
161 Ga0495618_0000923 3300046514 Bacteria 20176
162 Ga0495628_0001438 3300046516 Bacteria 21852
163 Ga0495630_0000840 3300046517 Bacteria 21681
164 Ga0495666_0000532 3300046526 Bacteria 16952
165 Ga0495652_0004010 3300046529 Bacteria 14242
166 Ga0495665_0000535 3300046531 Bacteria 19237
167 Ga0495640_0003553 3300046533 Bacteria 12520
168 Ga0495586_0001681 3300046535 Bacteria 12140
169 Ga0495587_0000938 3300046536 Bacteria 19178
170 Ga0495645_0000927 3300046543 Bacteria 19945
171 Ga0495667_0000876 3300046559 Bacteria 19440
172 Ga0495634_0001008 3300046642 Bacteria 26523
173 Ga0495635_0001517 3300046663 Bacteria 15545
174 Ga0495657_0001688 3300046675 Bacteria 18905
175 Ga0495599_0000387 3300046678 Bacteria 25344
176 Ga0495623_0018334 3300046679 Bacteria 4522
177 Ga0495646_0000258 3300046680 Bacteria 26803
178 Ga0495658_0006396 3300046683 Bacteria 5787
179 Ga0495613_0001144 3300046689 Bacteria 20228
180 Ga0495624_0001175 3300046690 Bacteria 20752
181 Ga0495600_0000442 3300046809 Bacteria 21366
182 Ga0495581_0003817 3300047315 Bacteria 8664
183 Ga0495604_0001447 3300047317 Bacteria 19501
184 Ga0495674_0003364 3300047319 Bacteria 15524
185 Ga0495676_0001687 3300047321 Bacteria 19283
186 Ga0495680_0001897 3300047322 Bacteria 21958
187 Ga0495675_0007205 3300047444 Bacteria 6849
188 Ga0495684_0001506 3300047471 Bacteria 18644
189 Ga0495593_0001110 3300047673 Bacteria 15721
190 Ga0495602_0003507 3300048088 Bacteria 16224
191 Ga0495614_0025665 3300048089 Unclassified 2541
192 Ga0501034_0146561 3300049571 Bacteria 2338
193 Ga0501046_0015674 3300049580 Bacteria 6362
194 Ga0501047_0019340 3300049581 Bacteria 6534
195 Ga0501070_0025312 3300049586 Bacteria 4976
196 Ga0501071_0019560 3300049587 Bacteria 4699
197 Ga0501073_0201437 3300049589 Bacteria 1376
198 Ga0501074_0003118 3300049590 Bacteria 11688
199 Ga0501075_0018977 3300049591 Bacteria 4986
200 Ga0501077_0017072 3300049593 Bacteria 4578
201 Ga0501079_0184115 3300049741 Bacteria 1630
202 Ga0501080_0009513 3300049742 Bacteria 8868
203 Ga0501035_0110623 3300049822 Bacteria 2408
204 Ga0501044_0488442 3300049823 Bacteria 1134
205 nmdc:mga05p37_148809_c1 3300050507 Unclassified 2866
206 nmdc:mga05p37_80204_c1 3300050507 Bacteria 4020
207 nmdc:mga08y16_213307_c1 3300050511 Unclassified 1999
208 nmdc:mga0n895_36399_c1 3300050512 Bacteria 4752
209 nmdc:mga0n895_427677_c1 3300050512 Unclassified 1338
210 nmdc:mga0a205_17476_c1 3300050515 Bacteria 6725
211 nmdc:mga0a205_487175_c1 3300050515 Bacteria 1091
212 Ga0495601_0000542 3300053077 Bacteria 19949
213 Ga0495612_0000556 3300053078 Bacteria 14972
214 Ga0495595_0012500 3300053084 Bacteria 3571
215 Ga0495619_0011977 3300053085 Bacteria 5464
216 Ga0530510_0012175 3300061734 Bacteria 6038
217 Ga0081455_10003600
218 JGI25407J50210_10003077
219 JGI25407J50210_10012929
220 Ga0065712_10079384
221 Ga0070676_10140336
222 Ga0070683_100023703
223 Ga0070683_100067875
224 Ga0070677_10073255
225 Ga0070689_100155161
226 Ga0070669_100087078
227 Ga0070671_100002800
228 Ga0070674_100233229
229 Ga0070673_100303823
230 Ga0070667_100327366
231 Ga0070714_100009050
232 Ga0070711_100131134
233 Ga0070694_100071749
234 Ga0070708_100019064
235 Ga0070678_100038704
236 Ga0070706_100003308
237 Ga0070706_100079528
238 Ga0070707_100054752
239 Ga0070698_100001299
240 Ga0070698_100195156
241 Ga0070699_100001701
242 Ga0070684_100218878
243 Ga0070697_100002501
244 Ga0070672_100003166
245 Ga0070695_100198200
246 Ga0070696_100001663
247 Ga0070696_100134765
248 Ga0070704_100080132
249 Ga0068857_100164990
250 Ga0068856_100244708
251 Ga0068864_100411982
252 Ga0068863_100392994
253 Ga0068858_100008708
254 Ga0068860_100325872
255 Ga0081538_10001898
256 Ga0081538_10002003
257 Ga0081538_10035993
258 Ga0081538_10036471
259 Ga0070712_100005102
260 Ga0075430_100193858
261 Ga0075433_10023548
262 Ga0075436_100130064
263 Ga0111539_10076365
264 Ga0105247_10163176
265 Ga0114129_10089300
266 Ga0114129_10284120
267 Ga0105243_10107024
268 Ga0105239_10679748
269 Ga0157375_10116769
270 Ga0157375_10430906
271 Ga0163163_10053881
272 Ga0157380_10046862
273 Ga0157380_10213339
274 Ga0157380_10442430
275 Ga0182008_10077809
276 Ga0207697_10008548
277 Ga0207653_10005755
278 Ga0207682_10021666
279 Ga0207645_10151076
280 Ga0207684_10042482
281 Ga0207693_10014788
282 Ga0207646_10003276
283 Ga0207681_10090829
284 Ga0207650_10010611
285 Ga0207659_10028966
286 Ga0207664_10011247
287 Ga0207664_10051219
288 Ga0207644_10002837
289 Ga0207670_10083047
290 Ga0207669_10008147
291 Ga0207665_10249277
292 Ga0207691_10075645
293 Ga0207689_10175360
294 Ga0207661_10074697
295 Ga0207661_10086026
296 Ga0207651_10009631
297 Ga0207658_10092548
298 Ga0207702_10167384
299 Ga0207641_10104229
300 Ga0207676_10188155
301 Ga0207674_10079067
302 Ga0207683_10017762
303 Ga0209995_1005020
304 Ga0209974_10004176
305 Ga0268264_10263528
306 Ga0307405_10008450
307 Ga0307405_10365034
308 Ga0307413_10124600
309 Ga0307406_10127359
310 Ga0307407_10049636
311 Ga0307409_100003718
312 Ga0307409_100018017
313 Ga0307409_100110998
314 Ga0307409_100633570
315 Ga0307416_100002512
316 Ga0307416_100035859
317 Ga0307416_100047831
318 Ga0307416_100353308
319 Ga0307416_100356069
320 Ga0307414_10087369
321 Ga0307415_100001480
322 Ga0307415_100010681
323 Ga0307415_100043397
324 Ga0307415_100052322
325 Ga0307415_100328275
326 Ga0373926_0002673
327 Ga0373934_0030448
328 Ga0373944_0003039
329 Ga0373923_0000123
330 Ga0373936_0000212
331 Ga0373945_0002489
332 Ga0373953_0002527
333 Ga0373954_0139886
334 Ga0373956_0012204
335 Ga0373957_0003506
336 Ga0373943_0000159
337 Ga0373943_0143001
338 Ga0373946_0000115
339 Ga0373955_0000305
340 Ga0316574_0056564
341 Ga0373924_0000259
342 Ga0373935_0000483
343 Ga0373927_0001255
344 Ga0373933_0000792
345 Ga0373947_0000799
346 Ga0373947_0228358
347 Ga0373937_0002957
348 Ga0316584_0075093
349 Ga0373925_0001495
350 Ga0373925_0007736
351 Ga0439448_0025471
352 Ga0439450_005012
353 Ga0439450_058794
354 Ga0439455_0004719
355 Ga0439463_023314
356 Ga0439464_0009299
357 Ga0439460_0005032
358 Ga0466966_0012276
359 Ga0466960_0032222
360 Ga0466959_0023322
361 Ga0466967_0228227
362 Ga0466967_0315422
363 Ga0466967_0434961
364 Ga0495592_0000970
365 Ga0495603_0000347
366 Ga0495629_0002044
367 Ga0495641_0001047
368 Ga0495651_0001208
369 Ga0495653_0001201
370 Ga0495580_0001933
371 Ga0495580_0002494
372 Ga0495582_0000627
373 Ga0495639_0001192
374 Ga0495662_0000372
375 Ga0495664_0000326
376 Ga0495608_0001527
377 Ga0495618_0000923
378 Ga0495628_0001438
379 Ga0495630_0000840
380 Ga0495666_0000532
381 Ga0495652_0004010
382 Ga0495665_0000535
383 Ga0495640_0003553
384 Ga0495586_0001681
385 Ga0495587_0000938
386 Ga0495645_0000927
387 Ga0495667_0000876
388 Ga0495634_0001008
389 Ga0495635_0001517
390 Ga0495657_0001688
391 Ga0495599_0000387
392 Ga0495623_0018334
393 Ga0495646_0000258
394 Ga0495658_0006396
395 Ga0495613_0001144
396 Ga0495624_0001175
397 Ga0495600_0000442
398 Ga0495581_0003817
399 Ga0495604_0001447
400 Ga0495674_0003364
401 Ga0495676_0001687
402 Ga0495680_0001897
403 Ga0495675_0007205
404 Ga0495684_0001506
405 Ga0495593_0001110
406 Ga0495602_0003507
407 Ga0495614_0025665
408 Ga0501034_0146561
409 Ga0501046_0015674
410 Ga0501047_0019340
411 Ga0501070_0025312
412 Ga0501071_0019560
413 Ga0501073_0201437
414 Ga0501074_0003118
415 Ga0501075_0018977
416 Ga0501077_0017072
417 Ga0501079_0184115
418 Ga0501080_0009513
419 Ga0501035_0110623
420 Ga0501044_0488442
421 nmdc:mga05p37_148809_c1
422 nmdc:mga05p37_80204_c1
423 nmdc:mga08y16_213307_c1
424 nmdc:mga0n895_36399_c1
425 nmdc:mga0n895_427677_c1
426 nmdc:mga0a205_17476_c1
427 nmdc:mga0a205_487175_c1
428 Ga0495601_0000542
429 Ga0495612_0000556
430 Ga0495595_0012500
431 Ga0495619_0011977
432 Ga0530510_0012175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00891

Methyltransf_2

O-methyltransferase domain

175

377

0.95

PF08100

Dimerisation

Dimerisation domain

68

154

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i2h-assembly1.cif.gz_B crystal structure of o-methyltransferase family 2 protein plim_1147 from planctomyces limnophilus dsm 3776 complex with apigenin 0.8385 14 333
1wsu-assembly1.cif.gz_B c-terminal domain of elongation factor selb complexed with secis rna 0.8267 31 81
8g2f-assembly1.cif.gz_A-2 crystal structure of prmt3 with compound ii710 0.826 168 237
5i2h-assembly1.cif.gz_A crystal structure of o-methyltransferase family 2 protein plim_1147 from planctomyces limnophilus dsm 3776 complex with apigenin 0.8242 14 333
4qqn-assembly1.cif.gz_A-2 protein arginine methyltransferase 3 in complex with compound mtv044246 0.824 168 237
ID Description Score Start End Superfamily
af_Q54FP4_67_150_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9712 8 86 1.10.10.10
6c5bB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9552 9 86 1.10.10.10
6clwA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9394 150 331 3.40.50.150
3i53A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9284 24 99 1.10.10.10
2g7uD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9257 41 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A536RCX4-F1-model_v4 O-methyltransferase domain-containing protein 0.9667 228 331 GO:0008171
AF-A0A6P0QW95-F1-model_v4 deleted 0.9612 137 331
AF-A0A0T9T0Y3-F1-model_v4 Hydroxyneurosporene-O-methyltransferase 0.9579 149 305 GO:0008171
GO:0032259
AF-A0A7Y5GJN3-F1-model_v4 SAM-dependent methyltransferase 0.9571 131 337 GO:0008171
GO:0032259
AF-A0A7V8W312-F1-model_v4 O-methyltransferase domain-containing protein 0.9568 170 334 GO:0008171
GO:0032259

Map