F327422

General Info

Members Datasets Scaffolds Average Seq Length
216 159 432 116

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100627747|Ga0068860_1006277472
Length 124
Sequence MADRPTVPIVIDPDAPEPPYEQVRLRIAELAADGRLAAGEKLPTVRALAADLGLAANTVARAYRELELAGLVQTRGRLGTVVTARAAGTSRQAQQAATAYADTTRALGVPAEQALALVRAALGL

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
117 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
118 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
155 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 2643221604 Nocardioides sp. Root190 Isolate Unclassified
158 2643221641 Nocardioides sp. Root122 Isolate Unclassified
159 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.44
Nodule 0.46
Rhizoplane 6.02
Rhizosphere 68.98
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100627747 3300005843 Bacteria 1081
2 JGI24738J21930_10024822 3300002075 Bacteria 1232
3 JGI24744J21845_10027260 3300002077 Bacteria 1105
4 Ga0070683_100087699 3300005329 Bacteria 2919
5 Ga0070683_100389619 3300005329 Bacteria 1328
6 Ga0070677_10039875 3300005333 Bacteria 1845
7 Ga0070680_101436359 3300005336 Bacteria 597
8 Ga0070682_100114073 3300005337 Bacteria 1806
9 Ga0068868_100039649 3300005338 Bacteria 3661
10 Ga0070660_100086989 3300005339 Bacteria 2460
11 Ga0070689_100066310 3300005340 Bacteria 2812
12 Ga0070691_10212059 3300005341 Bacteria 1022
13 Ga0070687_100023071 3300005343 Bacteria 2953
14 Ga0070661_101546274 3300005344 Bacteria 560
15 Ga0070692_10000949 3300005345 Bacteria 9852
16 Ga0070668_100001674 3300005347 Bacteria 16057
17 Ga0070669_100131279 3300005353 Bacteria 1922
18 Ga0070675_101509327 3300005354 Bacteria 620
19 Ga0070674_100047623 3300005356 Bacteria 2939
20 Ga0070673_100098055 3300005364 Bacteria 2408
21 Ga0070688_100111479 3300005365 Bacteria 1820
22 Ga0070659_100031853 3300005366 Bacteria 4086
23 Ga0070667_101158693 3300005367 Bacteria 723
24 Ga0070701_10026398 3300005438 Bacteria 2832
25 Ga0070700_100010269 3300005441 Bacteria 5167
26 Ga0070708_101199597 3300005445 Bacteria 710
27 Ga0070662_100113786 3300005457 Bacteria 2065
28 Ga0068867_100009302 3300005459 Bacteria 6931
29 Ga0068867_102230120 3300005459 Bacteria 520
30 Ga0070685_10016217 3300005466 Bacteria 3967
31 Ga0070698_100001623 3300005471 Bacteria 25049
32 Ga0070684_100033872 3300005535 Bacteria 4364
33 Ga0070684_100204504 3300005535 Bacteria 1799
34 Ga0070684_101875474 3300005535 Bacteria 566
35 Ga0070672_100010075 3300005543 Bacteria 6543
36 Ga0070664_100617281 3300005564 Bacteria 1006
37 Ga0070664_101360613 3300005564 Bacteria 671
38 Ga0068854_100039544 3300005578 Bacteria 3324
39 Ga0070702_100009147 3300005615 Bacteria 4835
40 Ga0070702_100571054 3300005615 Bacteria 843
41 Ga0068852_100053681 3300005616 Bacteria 3471
42 Ga0068859_100555972 3300005617 Bacteria 1242
43 Ga0068864_100254947 3300005618 Bacteria 1630
44 Ga0068866_10013382 3300005718 Bacteria 3599
45 Ga0068861_100005937 3300005719 Bacteria 8296
46 Ga0068861_101163425 3300005719 Bacteria 744
47 Ga0068870_10006908 3300005840 Bacteria 5035
48 Ga0068863_100715331 3300005841 Bacteria 996
49 Ga0068862_100106583 3300005844 Bacteria 2457
50 Ga0081539_10002805 3300005985 Bacteria 23293
51 Ga0075365_10006555 3300006038 Bacteria 6417
52 Ga0075365_10013599 3300006038 Bacteria 4876
53 Ga0075365_10030973 3300006038 Bacteria 3430
54 Ga0075365_10141275 3300006038 Bacteria 1671
55 Ga0075368_10010385 3300006042 Bacteria 3365
56 Ga0075368_10018174 3300006042 Bacteria 2640
57 Ga0075368_10286130 3300006042 Bacteria 709
58 Ga0075363_100047898 3300006048 Bacteria 2271
59 Ga0075363_100109251 3300006048 Bacteria 1536
60 Ga0075364_10020774 3300006051 Bacteria 4132
61 Ga0075364_10044840 3300006051 Bacteria 2877
62 Ga0075364_10112783 3300006051 Bacteria 1815
63 Ga0075362_10044793 3300006177 Bacteria 1963
64 Ga0075367_10113171 3300006178 Bacteria 1667
65 Ga0075367_10179801 3300006178 Bacteria 1319
66 Ga0075367_10800074 3300006178 Bacteria 600
67 Ga0075367_11042971 3300006178 Bacteria 522
68 Ga0075369_10018985 3300006186 Bacteria 2803
69 Ga0075369_10443514 3300006186 Bacteria 614
70 Ga0097621_100286134 3300006237 Bacteria 1452
71 Ga0075370_10011514 3300006353 Bacteria 4651
72 Ga0075370_10251237 3300006353 Bacteria 1048
73 Ga0068865_100001007 3300006881 Bacteria 16180
74 Ga0097620_100555978 3300006931 Bacteria 1242
75 Ga0105245_10072478 3300009098 Bacteria 3129
76 Ga0105245_11025942 3300009098 Bacteria 870
77 Ga0105243_10028457 3300009148 Bacteria 4290
78 Ga0105242_10576855 3300009176 Bacteria 1083
79 Ga0105248_10014374 3300009177 Bacteria 8712
80 Ga0105238_12894807 3300009551 Bacteria 516
81 Ga0105249_10129870 3300009553 Bacteria 2404
82 Ga0105239_10159752 3300010375 Bacteria 2517
83 Ga0105246_10520140 3300011119 Bacteria 1014
84 Ga0105246_12220493 3300011119 Bacteria 534
85 Ga0157375_10855756 3300013308 Bacteria 1055
86 Ga0163163_10021282 3300014325 Bacteria 6117
87 Ga0163163_11339884 3300014325 Bacteria 778
88 Ga0163163_12515865 3300014325 Bacteria 573
89 Ga0157380_10004780 3300014326 Bacteria 9438
90 Ga0157377_10014606 3300014745 Bacteria 3997
91 Ga0207642_10020759 3300025899 Bacteria 2572
92 Ga0207688_10204816 3300025901 Bacteria 1184
93 Ga0207643_10022410 3300025908 Bacteria 3477
94 Ga0207662_10058917 3300025918 Bacteria 2300
95 Ga0207657_10095629 3300025919 Bacteria 2472
96 Ga0207681_10471368 3300025923 Bacteria 1024
97 Ga0207681_10848857 3300025923 Bacteria 764
98 Ga0207694_11838801 3300025924 Bacteria 509
99 Ga0207687_10099221 3300025927 Bacteria 2140
100 Ga0207644_10992581 3300025931 Bacteria 705
101 Ga0207690_10105420 3300025932 Bacteria 2021
102 Ga0207686_10277839 3300025934 Bacteria 1235
103 Ga0207709_10017193 3300025935 Bacteria 4032
104 Ga0207670_10052032 3300025936 Bacteria 2753
105 Ga0207669_10003700 3300025937 Bacteria 6652
106 Ga0207704_10075540 3300025938 Bacteria 2155
107 Ga0207691_10005138 3300025940 Bacteria 12635
108 Ga0207711_10060356 3300025941 Bacteria 3267
109 Ga0207661_10066438 3300025944 Bacteria 2930
110 Ga0207661_10146984 3300025944 Bacteria 2035
111 Ga0207661_10287851 3300025944 Bacteria 1470
112 Ga0207661_10610762 3300025944 Bacteria 1001
113 Ga0207651_10072882 3300025960 Bacteria 2440
114 Ga0207712_10234435 3300025961 Bacteria 1475
115 Ga0207668_10002013 3300025972 Bacteria 11856
116 Ga0207678_10107024 3300026067 Bacteria 2385
117 Ga0207708_10000180 3300026075 Bacteria 49555
118 Ga0207641_10881711 3300026088 Bacteria 888
119 Ga0207648_10016593 3300026089 Bacteria 6723
120 Ga0207675_100004600 3300026118 Bacteria 13296
121 Ga0207698_10013086 3300026142 Bacteria 5462
122 Ga0209813_10037077 3300027866 Bacteria 1468
123 Ga0209813_10198643 3300027866 Bacteria 741
124 Ga0268265_10089250 3300028380 Bacteria 2458
125 Ga0307515_10000042 3300028794 Bacteria 309141
126 Ga0314311_1057706 3300030733 Bacteria 526
127 Ga0307509_10423247 3300031507 Bacteria 1032
128 Ga0307509_10715757 3300031507 Bacteria 667
129 Ga0307508_10000835 3300031616 Bacteria 35847
130 Ga0307508_10315702 3300031616 Bacteria 1155
131 Ga0307514_10347275 3300031649 Bacteria 794
132 Ga0307516_10073889 3300031730 Bacteria 3266
133 Ga0307516_10087661 3300031730 Bacteria 2946
134 Ga0307413_11297814 3300031824 Bacteria 637
135 Ga0307410_10479195 3300031852 Bacteria 1020
136 Ga0307410_10812620 3300031852 Bacteria 796
137 Ga0307410_11103896 3300031852 Bacteria 688
138 Ga0307406_10541823 3300031901 Bacteria 951
139 Ga0307407_11018106 3300031903 Bacteria 641
140 Ga0307412_10558610 3300031911 Bacteria 963
141 Ga0307412_11270293 3300031911 Bacteria 662
142 Ga0307409_100190253 3300031995 Bacteria 1826
143 Ga0307409_100349825 3300031995 Bacteria 1394
144 Ga0307416_100851324 3300032002 Bacteria 1010
145 Ga0307411_10110925 3300032005 Bacteria 1963
146 Ga0307415_100102102 3300032126 Bacteria 2106
147 Ga0307415_100954147 3300032126 Bacteria 794
148 Ga0307415_102123623 3300032126 Bacteria 549
149 Ga0395899_0260874 3300037312 Bacteria 1185
150 Ga0395900_0051649 3300037418 Bacteria 4234
151 Ga0395900_0313318 3300037418 Bacteria 1552
152 Ga0395898_0183064 3300037466 Bacteria 2002
153 Ga0395898_0234068 3300037466 Bacteria 1752
154 Ga0395901_0097818 3300038443 Bacteria 3077
155 Ga0439465_0224919 3300041413 Bacteria 689
156 Ga0451789_1037354 3300041443 Bacteria 517
157 Ga0451791_1201934 3300041451 Bacteria 869
158 Ga0451843_0878721 3300041509 Bacteria 1198
159 Ga0451577_0709099 3300042876 Bacteria 911
160 Ga0466972_0007716 3300044658 Bacteria 5403
161 Ga0466965_0073192 3300044683 Bacteria 1725
162 Ga0466965_0671083 3300044683 Unclassified 593
163 Ga0466966_0065742 3300044684 Bacteria 2280
164 Ga0466961_0024907 3300044693 Bacteria 3850
165 Ga0466961_0071446 3300044693 Bacteria 2202
166 Ga0466961_0347730 3300044693 Bacteria 903
167 Ga0466971_0198801 3300044719 Bacteria 946
168 Ga0466970_0002406 3300044765 Bacteria 9042
169 Ga0466970_0104470 3300044765 Bacteria 1544
170 Ga0466970_0123082 3300044765 Bacteria 1421
171 Ga0466960_0547553 3300044901 Bacteria 682
172 Ga0466959_0763519 3300045049 Unclassified 647
173 Ga0466958_0373576 3300045836 Unclassified 919
174 Ga0466967_0378113 3300045976 Bacteria 1375
175 Ga0466967_0503901 3300045976 Bacteria 1188
176 Ga0496100_1484314 3300048903 Unclassified 535
177 Ga0496104_1530996 3300048907 Bacteria 570
178 Ga0496106_0836185 3300048909 Bacteria 729
179 Ga0496107_0602837 3300048910 Bacteria 812
180 Ga0496108_0044729 3300048911 Bacteria 3696
181 Ga0496109_0204119 3300048912 Bacteria 1858
182 Ga0496110_0184250 3300048913 Bacteria 1896
183 Ga0496110_0932604 3300048913 Bacteria 775
184 Ga0496111_0218823 3300048914 Bacteria 1415
185 Ga0496113_0904067 3300048916 Bacteria 698
186 Ga0496114_0178164 3300048917 Bacteria 1855
187 Ga0501036_0176962 3300049572 Bacteria 1797
188 Ga0501039_0467135 3300049575 Bacteria 991
189 Ga0501041_0887760 3300049577 Bacteria 573
190 Ga0501067_0065444 3300049583 Bacteria 2012
191 Ga0501035_0317053 3300049822 Bacteria 1311
192 Ga0501045_0408208 3300049824 Bacteria 1011
193 Ga0501045_0742288 3300049824 Bacteria 724
194 nmdc:mga03683_25111_c1 3300050489 Bacteria 2337
195 nmdc:mga03n38_118422_c1 3300050490 Bacteria 1299
196 nmdc:mga00v17_148628_c1 3300050491 Bacteria 1505
197 nmdc:mga00v17_279953_c1 3300050491 Bacteria 1083
198 nmdc:mga00v17_53136_c1 3300050491 Bacteria 2468
199 nmdc:mga0yw44_176231_c1 3300050492 Bacteria 1406
200 nmdc:mga0yw44_24136_c1 3300050492 Bacteria 3437
201 nmdc:mga0yw44_438649_c1 3300050492 Bacteria 885
202 nmdc:mga0yw44_79942_c1 3300050492 Bacteria 2047
203 nmdc:mga06z11_282203_c1 3300050494 Bacteria 984
204 nmdc:mga06z11_935122_c1 3300050494 Bacteria 528
205 nmdc:mga04h51_198523_c1 3300050495 Bacteria 787
206 nmdc:mga04h51_229095_c1 3300050495 Bacteria 739
207 nmdc:mga04h51_54319_c1 3300050495 Bacteria 1354
208 nmdc:mga07m45_51998_c1 3300050496 Bacteria 2312
209 nmdc:mga0sz30_12615_c1 3300050516 Bacteria 3291
210 nmdc:mga0sz30_400968_c1 3300050516 Bacteria 614
211 Ga0500554_026456 3300053102 Bacteria 1667
212 Ga0500600_0219864 3300053149 Bacteria 877
213 Ga0466962_0534610 3300061719 Bacteria 595
214 2644032916 2643221604 Bacteria 5014917
215 2644230100 2643221641 Bacteria 4490190
216 8054610931 8054609563 Bacteria 5170090
217 Ga0068860_100627747
218 JGI24738J21930_10024822
219 JGI24744J21845_10027260
220 Ga0070683_100087699
221 Ga0070683_100389619
222 Ga0070677_10039875
223 Ga0070680_101436359
224 Ga0070682_100114073
225 Ga0068868_100039649
226 Ga0070660_100086989
227 Ga0070689_100066310
228 Ga0070691_10212059
229 Ga0070687_100023071
230 Ga0070661_101546274
231 Ga0070692_10000949
232 Ga0070668_100001674
233 Ga0070669_100131279
234 Ga0070675_101509327
235 Ga0070674_100047623
236 Ga0070673_100098055
237 Ga0070688_100111479
238 Ga0070659_100031853
239 Ga0070667_101158693
240 Ga0070701_10026398
241 Ga0070700_100010269
242 Ga0070708_101199597
243 Ga0070662_100113786
244 Ga0068867_100009302
245 Ga0068867_102230120
246 Ga0070685_10016217
247 Ga0070698_100001623
248 Ga0070684_100033872
249 Ga0070684_100204504
250 Ga0070684_101875474
251 Ga0070672_100010075
252 Ga0070664_100617281
253 Ga0070664_101360613
254 Ga0068854_100039544
255 Ga0070702_100009147
256 Ga0070702_100571054
257 Ga0068852_100053681
258 Ga0068859_100555972
259 Ga0068864_100254947
260 Ga0068866_10013382
261 Ga0068861_100005937
262 Ga0068861_101163425
263 Ga0068870_10006908
264 Ga0068863_100715331
265 Ga0068862_100106583
266 Ga0081539_10002805
267 Ga0075365_10006555
268 Ga0075365_10013599
269 Ga0075365_10030973
270 Ga0075365_10141275
271 Ga0075368_10010385
272 Ga0075368_10018174
273 Ga0075368_10286130
274 Ga0075363_100047898
275 Ga0075363_100109251
276 Ga0075364_10020774
277 Ga0075364_10044840
278 Ga0075364_10112783
279 Ga0075362_10044793
280 Ga0075367_10113171
281 Ga0075367_10179801
282 Ga0075367_10800074
283 Ga0075367_11042971
284 Ga0075369_10018985
285 Ga0075369_10443514
286 Ga0097621_100286134
287 Ga0075370_10011514
288 Ga0075370_10251237
289 Ga0068865_100001007
290 Ga0097620_100555978
291 Ga0105245_10072478
292 Ga0105245_11025942
293 Ga0105243_10028457
294 Ga0105242_10576855
295 Ga0105248_10014374
296 Ga0105238_12894807
297 Ga0105249_10129870
298 Ga0105239_10159752
299 Ga0105246_10520140
300 Ga0105246_12220493
301 Ga0157375_10855756
302 Ga0163163_10021282
303 Ga0163163_11339884
304 Ga0163163_12515865
305 Ga0157380_10004780
306 Ga0157377_10014606
307 Ga0207642_10020759
308 Ga0207688_10204816
309 Ga0207643_10022410
310 Ga0207662_10058917
311 Ga0207657_10095629
312 Ga0207681_10471368
313 Ga0207681_10848857
314 Ga0207694_11838801
315 Ga0207687_10099221
316 Ga0207644_10992581
317 Ga0207690_10105420
318 Ga0207686_10277839
319 Ga0207709_10017193
320 Ga0207670_10052032
321 Ga0207669_10003700
322 Ga0207704_10075540
323 Ga0207691_10005138
324 Ga0207711_10060356
325 Ga0207661_10066438
326 Ga0207661_10146984
327 Ga0207661_10287851
328 Ga0207661_10610762
329 Ga0207651_10072882
330 Ga0207712_10234435
331 Ga0207668_10002013
332 Ga0207678_10107024
333 Ga0207708_10000180
334 Ga0207641_10881711
335 Ga0207648_10016593
336 Ga0207675_100004600
337 Ga0207698_10013086
338 Ga0209813_10037077
339 Ga0209813_10198643
340 Ga0268265_10089250
341 Ga0307515_10000042
342 Ga0314311_1057706
343 Ga0307509_10423247
344 Ga0307509_10715757
345 Ga0307508_10000835
346 Ga0307508_10315702
347 Ga0307514_10347275
348 Ga0307516_10073889
349 Ga0307516_10087661
350 Ga0307413_11297814
351 Ga0307410_10479195
352 Ga0307410_10812620
353 Ga0307410_11103896
354 Ga0307406_10541823
355 Ga0307407_11018106
356 Ga0307412_10558610
357 Ga0307412_11270293
358 Ga0307409_100190253
359 Ga0307409_100349825
360 Ga0307416_100851324
361 Ga0307411_10110925
362 Ga0307415_100102102
363 Ga0307415_100954147
364 Ga0307415_102123623
365 Ga0395899_0260874
366 Ga0395900_0051649
367 Ga0395900_0313318
368 Ga0395898_0183064
369 Ga0395898_0234068
370 Ga0395901_0097818
371 Ga0439465_0224919
372 Ga0451789_1037354
373 Ga0451791_1201934
374 Ga0451843_0878721
375 Ga0451577_0709099
376 Ga0466972_0007716
377 Ga0466965_0073192
378 Ga0466965_0671083
379 Ga0466966_0065742
380 Ga0466961_0024907
381 Ga0466961_0071446
382 Ga0466961_0347730
383 Ga0466971_0198801
384 Ga0466970_0002406
385 Ga0466970_0104470
386 Ga0466970_0123082
387 Ga0466960_0547553
388 Ga0466959_0763519
389 Ga0466958_0373576
390 Ga0466967_0378113
391 Ga0466967_0503901
392 Ga0496100_1484314
393 Ga0496104_1530996
394 Ga0496106_0836185
395 Ga0496107_0602837
396 Ga0496108_0044729
397 Ga0496109_0204119
398 Ga0496110_0184250
399 Ga0496110_0932604
400 Ga0496111_0218823
401 Ga0496113_0904067
402 Ga0496114_0178164
403 Ga0501036_0176962
404 Ga0501039_0467135
405 Ga0501041_0887760
406 Ga0501067_0065444
407 Ga0501035_0317053
408 Ga0501045_0408208
409 Ga0501045_0742288
410 nmdc:mga03683_25111_c1
411 nmdc:mga03n38_118422_c1
412 nmdc:mga00v17_148628_c1
413 nmdc:mga00v17_279953_c1
414 nmdc:mga00v17_53136_c1
415 nmdc:mga0yw44_176231_c1
416 nmdc:mga0yw44_24136_c1
417 nmdc:mga0yw44_438649_c1
418 nmdc:mga0yw44_79942_c1
419 nmdc:mga06z11_282203_c1
420 nmdc:mga06z11_935122_c1
421 nmdc:mga04h51_198523_c1
422 nmdc:mga04h51_229095_c1
423 nmdc:mga04h51_54319_c1
424 nmdc:mga07m45_51998_c1
425 nmdc:mga0sz30_12615_c1
426 nmdc:mga0sz30_400968_c1
427 Ga0500554_026456
428 Ga0500600_0219864
429 Ga0466962_0534610
430 2644032916
431 2644230100
432 8054610931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

19

82

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tv7-assembly1.cif.gz_A crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution 0.9801 3 77
4mgr-assembly1.cif.gz_B the crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt 0.9682 1 77
7pq9-assembly7.cif.gz_KKK crystal structure of bacillus clausii pdxr at 2.8 angstroms resolution 0.9592 1 77
4n0b-assembly1.cif.gz_B crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt 0.958 1 77
4n0b-assembly2.cif.gz_C crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt 0.9557 1 77
ID Description Score Start End Superfamily
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9819 34 77 1.10.10.10
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9719 4 78 1.10.10.10
af_P39389_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9612 14 77 1.10.10.10
af_Q2G1P1_1_44_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9607 34 77 1.10.10.10
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9582 14 77 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7K0ZZT4-F1-model_v4 GntR family transcriptional regulator 1.003 2 77 GO:0003677
GO:0003700
AF-A0A7K2X9J2-F1-model_v4 GntR family transcriptional regulator 1.001 1 78 GO:0003677
GO:0003700
AF-A0A3D0PSI9-F1-model_v4 PLP-dependent aminotransferase family protein 1.001 3 78 GO:0003677
GO:0003700
GO:0008483
GO:0009058
GO:0030170
AF-A0A2V7YL19-F1-model_v4 PLP-dependent aminotransferase family protein 0.9999 2 77 GO:0003677
GO:0003700
GO:0008483
GO:0009058
GO:0030170
AF-A0A2V7WNM2-F1-model_v4 HTH gntR-type domain-containing protein 0.9998 2 77 GO:0003677
GO:0003700
GO:0009058
GO:0030170

Map