F327374

General Info

Members Datasets Scaffolds Average Seq Length
216 127 432 318

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000495|Ga0070665_10000049541
Length 339
Sequence MSDAPERRQLGGTPFTIAPLMLGTNAFGWTADEAASFAILDRFVEAGFNAVDTADVYFKFAPGNKGGESETIIGNWIAKGNGRRDRIMLATKFGMEMEPGEKGLSRDYMMRAVEASLRRLRTDRIDLYQSHHPDESVPIEETLRGYEELIASGKVLAIGASNSSPAQLEAALDTSAAAGLPRYETMQPWYNLYDRKDYEEGTERVCAARGLGVISFFGLASGFLSGKYRSEADLEGRPRAYRVKGYINARGFRILAAIDAVCAELGATPAQVALAWVMARPSITAPIASATTVAQLDEIMGAARLRLGPEQMARLDKASAPADAASTIGEGPPPDVSRA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 1.39
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0.46
Rhizoplane 0.93
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100000495 3300005548 Bacteria 56309
2 Ga0070658_10138117 3300005327 Bacteria 2035
3 Ga0070690_100145677 3300005330 Bacteria 1611
4 Ga0068869_100285473 3300005334 Bacteria 1328
5 Ga0070680_100006777 3300005336 Bacteria 8728
6 Ga0070680_100007442 3300005336 Bacteria 8353
7 Ga0070680_100167113 3300005336 Bacteria 1850
8 Ga0070660_100056726 3300005339 Bacteria 3031
9 Ga0070660_100347485 3300005339 Bacteria 1221
10 Ga0070689_100223716 3300005340 Bacteria 1545
11 Ga0070691_10203211 3300005341 Bacteria 1042
12 Ga0070668_100013515 3300005347 Bacteria 6094
13 Ga0070669_100110541 3300005353 Bacteria 2085
14 Ga0070675_100004484 3300005354 Bacteria 10657
15 Ga0070667_100440196 3300005367 Bacteria 1190
16 Ga0070714_100030299 3300005435 Bacteria 4502
17 Ga0070713_100165016 3300005436 Bacteria 1980
18 Ga0070710_10026955 3300005437 Bacteria 3059
19 Ga0070701_10018619 3300005438 Bacteria 3266
20 Ga0070694_100001881 3300005444 Bacteria 12424
21 Ga0070694_100006823 3300005444 Bacteria 6935
22 Ga0070694_100036266 3300005444 Bacteria 3266
23 Ga0070694_100037739 3300005444 Bacteria 3205
24 Ga0070694_100048753 3300005444 Bacteria 2849
25 Ga0070694_100106376 3300005444 Bacteria 1992
26 Ga0070708_100049842 3300005445 Bacteria 3705
27 Ga0070678_100459809 3300005456 Bacteria 1116
28 Ga0070681_10019097 3300005458 Bacteria 6860
29 Ga0070681_10029561 3300005458 Bacteria 5503
30 Ga0070681_10036814 3300005458 Bacteria 4913
31 Ga0070681_10081768 3300005458 Bacteria 3186
32 Ga0070681_10136951 3300005458 Bacteria 2379
33 Ga0070707_100086256 3300005468 Bacteria 3036
34 Ga0070698_100002474 3300005471 Bacteria 20388
35 Ga0070699_100002410 3300005518 Bacteria 16786
36 Ga0070699_100052651 3300005518 Bacteria 3522
37 Ga0070699_100054312 3300005518 Bacteria 3467
38 Ga0070699_100066401 3300005518 Bacteria 3131
39 Ga0070679_100000803 3300005530 Bacteria 27228
40 Ga0070679_100076989 3300005530 Bacteria 3324
41 Ga0070679_100097426 3300005530 Bacteria 2929
42 Ga0070679_100149871 3300005530 Bacteria 2309
43 Ga0070679_100348546 3300005530 Bacteria 1429
44 Ga0070697_100039353 3300005536 Bacteria 3822
45 Ga0070697_100058457 3300005536 Bacteria 3138
46 Ga0070672_100077398 3300005543 Bacteria 2660
47 Ga0070695_100060952 3300005545 Bacteria 2446
48 Ga0070695_100061329 3300005545 Bacteria 2440
49 Ga0070695_100071665 3300005545 Bacteria 2270
50 Ga0070696_100002141 3300005546 Bacteria 12991
51 Ga0070696_100015276 3300005546 Bacteria 5154
52 Ga0070696_100036162 3300005546 Bacteria 3403
53 Ga0070696_100038778 3300005546 Bacteria 3289
54 Ga0070696_100050431 3300005546 Bacteria 2893
55 Ga0070665_100000736 3300005548 Bacteria 43644
56 Ga0070665_100007724 3300005548 Bacteria 10919
57 Ga0070704_100004373 3300005549 Bacteria 8161
58 Ga0070704_100006945 3300005549 Bacteria 6712
59 Ga0070704_100068930 3300005549 Bacteria 2561
60 Ga0068855_100010671 3300005563 Bacteria 11084
61 Ga0068855_100032019 3300005563 Bacteria 6278
62 Ga0068855_100208547 3300005563 Bacteria 2197
63 Ga0070664_100017651 3300005564 Bacteria 5860
64 Ga0070664_100197646 3300005564 Bacteria 1793
65 Ga0068856_100308169 3300005614 Bacteria 1601
66 Ga0070702_100004461 3300005615 Bacteria 6393
67 Ga0068863_100022652 3300005841 Bacteria 5999
68 Ga0068863_100245116 3300005841 Bacteria 1730
69 Ga0068863_100280442 3300005841 Bacteria 1614
70 Ga0068862_100095862 3300005844 Bacteria 2589
71 Ga0081539_10000123 3300005985 Bacteria 181245
72 Ga0075428_100555453 3300006844 Bacteria 1227
73 Ga0075433_10025351 3300006852 Bacteria 5011
74 Ga0075433_10172233 3300006852 Bacteria 1926
75 Ga0075434_100022070 3300006871 Bacteria 6198
76 Ga0075434_100139818 3300006871 Bacteria 2441
77 Ga0075436_100030920 3300006914 Bacteria 3685
78 Ga0075436_100072614 3300006914 Bacteria 2381
79 Ga0075435_100020420 3300007076 Bacteria 5076
80 Ga0075435_100050434 3300007076 Bacteria 3349
81 Ga0099794_10003904 3300007265 Bacteria 5775
82 Ga0099794_10099889 3300007265 Bacteria 1448
83 Ga0105240_10001392 3300009093 Bacteria 41566
84 Ga0105240_10017311 3300009093 Bacteria 9717
85 Ga0105237_10197095 3300009545 Bacteria 2014
86 Ga0105238_10000754 3300009551 Bacteria 33646
87 Ga0105238_10046094 3300009551 Bacteria 4401
88 Ga0157373_10001592 3300013100 Bacteria 17340
89 Ga0157373_10113398 3300013100 Bacteria 1905
90 Ga0157370_10000843 3300013104 Bacteria 38906
91 Ga0157370_10007661 3300013104 Bacteria 11720
92 Ga0157370_10011301 3300013104 Bacteria 9355
93 Ga0157370_10159045 3300013104 Bacteria 2102
94 Ga0157369_10004495 3300013105 Bacteria 16434
95 Ga0157369_10008798 3300013105 Bacteria 11569
96 Ga0157369_10275673 3300013105 Bacteria 1752
97 Ga0157378_10020449 3300013297 Bacteria 5820
98 Ga0157372_10118397 3300013307 Bacteria 3039
99 Ga0163163_10191358 3300014325 Bacteria 2094
100 Ga0157380_10273563 3300014326 Bacteria 1541
101 Ga0157379_10202092 3300014968 Bacteria 1797
102 Ga0206356_10842854 3300020070 Bacteria 2438
103 Ga0213871_10007079 3300021441 Bacteria 2407
104 Ga0224712_10067048 3300022467 Bacteria 1447
105 Ga0207653_10022348 3300025885 Bacteria 2008
106 Ga0207680_10224839 3300025903 Bacteria 1288
107 Ga0207707_10000094 3300025912 Bacteria 89818
108 Ga0207707_10065983 3300025912 Bacteria 3152
109 Ga0207707_10123132 3300025912 Bacteria 2268
110 Ga0207707_10161529 3300025912 Bacteria 1958
111 Ga0207707_10214387 3300025912 Bacteria 1676
112 Ga0207695_10001793 3300025913 Bacteria 33891
113 Ga0207663_10248632 3300025916 Bacteria 1308
114 Ga0207660_10011334 3300025917 Bacteria 5800
115 Ga0207660_10013712 3300025917 Bacteria 5318
116 Ga0207660_10058372 3300025917 Bacteria 2767
117 Ga0207660_10313969 3300025917 Bacteria 1250
118 Ga0207657_10150512 3300025919 Bacteria 1896
119 Ga0207657_10168710 3300025919 Bacteria 1774
120 Ga0207649_10220954 3300025920 Bacteria 1349
121 Ga0207649_10267968 3300025920 Bacteria 1237
122 Ga0207652_10000807 3300025921 Bacteria 29901
123 Ga0207652_10043282 3300025921 Bacteria 3835
124 Ga0207652_10046432 3300025921 Bacteria 3706
125 Ga0207646_10112743 3300025922 Bacteria 2441
126 Ga0207646_10131259 3300025922 Bacteria 2255
127 Ga0207694_10041091 3300025924 Bacteria 3563
128 Ga0207694_10041881 3300025924 Bacteria 3530
129 Ga0207694_10425719 3300025924 Bacteria 1106
130 Ga0207650_10035456 3300025925 Bacteria 3623
131 Ga0207659_10008287 3300025926 Bacteria 6443
132 Ga0207700_10124707 3300025928 Bacteria 2093
133 Ga0207664_10061350 3300025929 Bacteria 3000
134 Ga0207691_10351869 3300025940 Bacteria 1260
135 Ga0207689_10116371 3300025942 Bacteria 2197
136 Ga0207679_10011024 3300025945 Bacteria 5836
137 Ga0207667_10001315 3300025949 Bacteria 31172
138 Ga0207667_10018223 3300025949 Bacteria 7878
139 Ga0207651_10249662 3300025960 Bacteria 1451
140 Ga0207668_10007950 3300025972 Bacteria 6310
141 Ga0207678_10167070 3300026067 Bacteria 1879
142 Ga0207708_10070236 3300026075 Bacteria 2681
143 Ga0207702_10042091 3300026078 Bacteria 3831
144 Ga0207641_10067354 3300026088 Bacteria 3067
145 Ga0207641_10206553 3300026088 Bacteria 1814
146 Ga0207641_10516711 3300026088 Bacteria 1161
147 Ga0207648_10227115 3300026089 Bacteria 1660
148 Ga0207675_100318105 3300026118 Bacteria 1519
149 Ga0209588_1000165 3300027671 Bacteria 18478
150 Ga0209588_1000545 3300027671 Bacteria 9684
151 Ga0268266_10000187 3300028379 Bacteria 110229
152 Ga0268266_10000370 3300028379 Bacteria 69264
153 Ga0268266_10010272 3300028379 Bacteria 8196
154 Ga0268265_10151403 3300028380 Bacteria 1957
155 Ga0265338_10008955 3300028800 Bacteria 12039
156 Ga0265338_10019479 3300028800 Bacteria 7194
157 Ga0265338_10023846 3300028800 Bacteria 6273
158 Ga0265338_10039386 3300028800 Bacteria 4458
159 Ga0265338_10057774 3300028800 Bacteria 3430
160 Ga0265338_10143449 3300028800 Bacteria 1867
161 Ga0265314_10014952 3300031711 Bacteria 6181
162 Ga0265314_10021986 3300031711 Bacteria 4892
163 Ga0373934_0017604 3300035086 Bacteria 2730
164 Ga0373935_0226879 3300035692 Bacteria 1299
165 Ga0373933_0001370 3300035724 Bacteria 14350
166 Ga0373933_0059289 3300035724 Bacteria 2305
167 Ga0373937_0000051 3300036401 Bacteria 104818
168 Ga0373937_0267379 3300036401 Bacteria 1613
169 Ga0373937_0511553 3300036401 Bacteria 1141
170 Ga0395899_0013735 3300037312 Bacteria 6192
171 Ga0395898_0008747 3300037466 Bacteria 10676
172 Ga0395898_0064304 3300037466 Bacteria 3558
173 Ga0395905_0005815 3300037471 Bacteria 12532
174 Ga0395905_0013137 3300037471 Bacteria 7949
175 Ga0395905_0025563 3300037471 Bacteria 5568
176 Ga0395901_0013872 3300038443 Bacteria 8197
177 Ga0395901_0180110 3300038443 Bacteria 2216
178 Ga0436360_0003314 3300039438 Bacteria 12065
179 Ga0439441_004233 3300042001 Bacteria 2162
180 Ga0466963_0015274 3300044694 Bacteria 4751
181 Ga0451576_0014967 3300045051 Bacteria 8616
182 Ga0451576_0061439 3300045051 Bacteria 3917
183 Ga0451576_0143129 3300045051 Bacteria 2493
184 Ga0495603_0220431 3300046455 Bacteria 1095
185 Ga0495629_0147995 3300046459 Bacteria 1633
186 Ga0495651_0001582 3300046462 Bacteria 17593
187 Ga0495653_0039678 3300046463 Bacteria 3687
188 Ga0495630_0147766 3300046517 Bacteria 1788
189 Ga0495652_0081369 3300046529 Bacteria 2671
190 Ga0495652_0147651 3300046529 Bacteria 1841
191 Ga0495587_0000167 3300046536 Bacteria 47833
192 Ga0495635_0242239 3300046663 Bacteria 1217
193 Ga0495623_0019813 3300046679 Bacteria 4349
194 Ga0495613_0275808 3300046689 Bacteria 1169
195 Ga0495675_0001194 3300047444 Bacteria 15733
196 Ga0495602_0000048 3300048088 Bacteria 116248
197 Ga0496102_0013007 3300048905 Bacteria 7207
198 Ga0496112_0021374 3300048915 Bacteria 6153
199 Ga0501033_0235429 3300049570 Bacteria 1300
200 Ga0501034_0122373 3300049571 Bacteria 2588
201 Ga0501042_0245611 3300049578 Bacteria 1292
202 Ga0501070_0061577 3300049586 Bacteria 3109
203 Ga0501044_0093660 3300049823 Bacteria 3029
204 nmdc:mga0k408_71095_c1 3300050493 Bacteria 2031
205 nmdc:mga0n895_134146_c1 3300050512 Bacteria 2502
206 nmdc:mga0n895_566224_c1 3300050512 Bacteria 1141
207 nmdc:mga0n895_58408_c1 3300050512 Bacteria 3804
208 nmdc:mga0rr50_127883_c1 3300050513 Bacteria 2031
209 nmdc:mga0rr50_40097_c1 3300050513 Bacteria 3402
210 nmdc:mga08x19_394871_c1 3300050514 Bacteria 970
211 nmdc:mga0a205_10823_c2 3300050515 Bacteria 4733
212 nmdc:mga0a205_208015_c1 3300050515 Bacteria 1846
213 nmdc:mga0a205_461495_c1 3300050515 Bacteria 1130
214 Ga0500643_004560 3300053087 Bacteria 6208
215 Ga0587107_005899 3300059652 Bacteria 1317
216 643603473 643348564 Bacteria 8839022
217 Ga0070665_100000495
218 Ga0070658_10138117
219 Ga0070690_100145677
220 Ga0068869_100285473
221 Ga0070680_100006777
222 Ga0070680_100007442
223 Ga0070680_100167113
224 Ga0070660_100056726
225 Ga0070660_100347485
226 Ga0070689_100223716
227 Ga0070691_10203211
228 Ga0070668_100013515
229 Ga0070669_100110541
230 Ga0070675_100004484
231 Ga0070667_100440196
232 Ga0070714_100030299
233 Ga0070713_100165016
234 Ga0070710_10026955
235 Ga0070701_10018619
236 Ga0070694_100001881
237 Ga0070694_100006823
238 Ga0070694_100036266
239 Ga0070694_100037739
240 Ga0070694_100048753
241 Ga0070694_100106376
242 Ga0070708_100049842
243 Ga0070678_100459809
244 Ga0070681_10019097
245 Ga0070681_10029561
246 Ga0070681_10036814
247 Ga0070681_10081768
248 Ga0070681_10136951
249 Ga0070707_100086256
250 Ga0070698_100002474
251 Ga0070699_100002410
252 Ga0070699_100052651
253 Ga0070699_100054312
254 Ga0070699_100066401
255 Ga0070679_100000803
256 Ga0070679_100076989
257 Ga0070679_100097426
258 Ga0070679_100149871
259 Ga0070679_100348546
260 Ga0070697_100039353
261 Ga0070697_100058457
262 Ga0070672_100077398
263 Ga0070695_100060952
264 Ga0070695_100061329
265 Ga0070695_100071665
266 Ga0070696_100002141
267 Ga0070696_100015276
268 Ga0070696_100036162
269 Ga0070696_100038778
270 Ga0070696_100050431
271 Ga0070665_100000736
272 Ga0070665_100007724
273 Ga0070704_100004373
274 Ga0070704_100006945
275 Ga0070704_100068930
276 Ga0068855_100010671
277 Ga0068855_100032019
278 Ga0068855_100208547
279 Ga0070664_100017651
280 Ga0070664_100197646
281 Ga0068856_100308169
282 Ga0070702_100004461
283 Ga0068863_100022652
284 Ga0068863_100245116
285 Ga0068863_100280442
286 Ga0068862_100095862
287 Ga0081539_10000123
288 Ga0075428_100555453
289 Ga0075433_10025351
290 Ga0075433_10172233
291 Ga0075434_100022070
292 Ga0075434_100139818
293 Ga0075436_100030920
294 Ga0075436_100072614
295 Ga0075435_100020420
296 Ga0075435_100050434
297 Ga0099794_10003904
298 Ga0099794_10099889
299 Ga0105240_10001392
300 Ga0105240_10017311
301 Ga0105237_10197095
302 Ga0105238_10000754
303 Ga0105238_10046094
304 Ga0157373_10001592
305 Ga0157373_10113398
306 Ga0157370_10000843
307 Ga0157370_10007661
308 Ga0157370_10011301
309 Ga0157370_10159045
310 Ga0157369_10004495
311 Ga0157369_10008798
312 Ga0157369_10275673
313 Ga0157378_10020449
314 Ga0157372_10118397
315 Ga0163163_10191358
316 Ga0157380_10273563
317 Ga0157379_10202092
318 Ga0206356_10842854
319 Ga0213871_10007079
320 Ga0224712_10067048
321 Ga0207653_10022348
322 Ga0207680_10224839
323 Ga0207707_10000094
324 Ga0207707_10065983
325 Ga0207707_10123132
326 Ga0207707_10161529
327 Ga0207707_10214387
328 Ga0207695_10001793
329 Ga0207663_10248632
330 Ga0207660_10011334
331 Ga0207660_10013712
332 Ga0207660_10058372
333 Ga0207660_10313969
334 Ga0207657_10150512
335 Ga0207657_10168710
336 Ga0207649_10220954
337 Ga0207649_10267968
338 Ga0207652_10000807
339 Ga0207652_10043282
340 Ga0207652_10046432
341 Ga0207646_10112743
342 Ga0207646_10131259
343 Ga0207694_10041091
344 Ga0207694_10041881
345 Ga0207694_10425719
346 Ga0207650_10035456
347 Ga0207659_10008287
348 Ga0207700_10124707
349 Ga0207664_10061350
350 Ga0207691_10351869
351 Ga0207689_10116371
352 Ga0207679_10011024
353 Ga0207667_10001315
354 Ga0207667_10018223
355 Ga0207651_10249662
356 Ga0207668_10007950
357 Ga0207678_10167070
358 Ga0207708_10070236
359 Ga0207702_10042091
360 Ga0207641_10067354
361 Ga0207641_10206553
362 Ga0207641_10516711
363 Ga0207648_10227115
364 Ga0207675_100318105
365 Ga0209588_1000165
366 Ga0209588_1000545
367 Ga0268266_10000187
368 Ga0268266_10000370
369 Ga0268266_10010272
370 Ga0268265_10151403
371 Ga0265338_10008955
372 Ga0265338_10019479
373 Ga0265338_10023846
374 Ga0265338_10039386
375 Ga0265338_10057774
376 Ga0265338_10143449
377 Ga0265314_10014952
378 Ga0265314_10021986
379 Ga0373934_0017604
380 Ga0373935_0226879
381 Ga0373933_0001370
382 Ga0373933_0059289
383 Ga0373937_0000051
384 Ga0373937_0267379
385 Ga0373937_0511553
386 Ga0395899_0013735
387 Ga0395898_0008747
388 Ga0395898_0064304
389 Ga0395905_0005815
390 Ga0395905_0013137
391 Ga0395905_0025563
392 Ga0395901_0013872
393 Ga0395901_0180110
394 Ga0436360_0003314
395 Ga0439441_004233
396 Ga0466963_0015274
397 Ga0451576_0014967
398 Ga0451576_0061439
399 Ga0451576_0143129
400 Ga0495603_0220431
401 Ga0495629_0147995
402 Ga0495651_0001582
403 Ga0495653_0039678
404 Ga0495630_0147766
405 Ga0495652_0081369
406 Ga0495652_0147651
407 Ga0495587_0000167
408 Ga0495635_0242239
409 Ga0495623_0019813
410 Ga0495613_0275808
411 Ga0495675_0001194
412 Ga0495602_0000048
413 Ga0496102_0013007
414 Ga0496112_0021374
415 Ga0501033_0235429
416 Ga0501034_0122373
417 Ga0501042_0245611
418 Ga0501070_0061577
419 Ga0501044_0093660
420 nmdc:mga0k408_71095_c1
421 nmdc:mga0n895_134146_c1
422 nmdc:mga0n895_566224_c1
423 nmdc:mga0n895_58408_c1
424 nmdc:mga0rr50_127883_c1
425 nmdc:mga0rr50_40097_c1
426 nmdc:mga08x19_394871_c1
427 nmdc:mga0a205_10823_c2
428 nmdc:mga0a205_208015_c1
429 nmdc:mga0a205_461495_c1
430 Ga0500643_004560
431 Ga0587107_005899
432 643603473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

19

320

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9416 1 302
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9411 1 302
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9367 1 302
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9366 1 302
4xk2-assembly1.cif.gz_C crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9274 1 302
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.927 1 302 3.20.20.100
1lqaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9256 1 302 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9241 1 302 3.20.20.100
1lqaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9198 1 302 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9182 1 302 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A1Y2T1F3-F1-model_v4 Aldo/keto reductase 0.98 1 207 GO:0005829
GO:0016491
AF-A0A7C4YQS2-F1-model_v4 Aldo/keto reductase 0.9788 1 212 GO:0016020
GO:0016491
AF-A0A538E6N8-F1-model_v4 Aldo/keto reductase 0.9781 1 213 GO:0005829
GO:0016491
AF-A0A382HMM6-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9755 1 198 GO:0005829
GO:0016491
AF-A0A381ZS10-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9754 11 174

Map