F326937

General Info

Members Datasets Scaffolds Average Seq Length
215 170 430 121

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0009041|Ga0501067_0009041_2899_3324
Length 141
Sequence VRVPPAFEIPSKNSEEIKRTMPQLITAPTIIQAAGHPPKRIEEYFGRVNSKHDSVSIARMVSPEGWQEPGQRPEFEELTVVLQGMVRVEHEGGALEVRAGQAVVSQPGEWIRYSSPEPGGAEYIAVCLPAFSPEIVHRDAD

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
115 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
116 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
117 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0
Rhizoplane 8.37
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 18.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0009041 3300049583 Bacteria 5517
2 rootH1_10318368 3300003323 Bacteria 2540
3 Ga0058862_12786542 3300004803 Bacteria 1294
4 Ga0065715_10790347 3300005293 Bacteria 614
5 Ga0070658_10029559 3300005327 Bacteria 4402
6 Ga0070676_10300011 3300005328 Bacteria 1089
7 Ga0070683_100262254 3300005329 Bacteria 1644
8 Ga0070690_100664318 3300005330 Unclassified 797
9 Ga0070670_100063030 3300005331 Bacteria 3182
10 Ga0070666_10194236 3300005335 Bacteria 1427
11 Ga0068868_100062348 3300005338 Bacteria 2955
12 Ga0070689_100309867 3300005340 Unclassified 1316
13 Ga0070691_10680542 3300005341 Unclassified 615
14 Ga0070675_100181809 3300005354 Bacteria 1818
15 Ga0070671_101210152 3300005355 Unclassified 665
16 Ga0070674_100484039 3300005356 Bacteria 1027
17 Ga0070667_100156291 3300005367 Bacteria 2006
18 Ga0070700_100263183 3300005441 Bacteria 1243
19 Ga0070700_100454150 3300005441 Bacteria 976
20 Ga0070679_100845886 3300005530 Bacteria 858
21 Ga0070686_100919698 3300005544 Bacteria 713
22 Ga0070686_101015084 3300005544 Bacteria 681
23 Ga0070695_101297445 3300005545 Unclassified 601
24 Ga0070695_101714154 3300005545 Bacteria 526
25 Ga0070696_100684843 3300005546 Unclassified 834
26 Ga0070665_100003254 3300005548 Bacteria 17447
27 Ga0070704_102051948 3300005549 Unclassified 531
28 Ga0068854_100317500 3300005578 Bacteria 1265
29 Ga0068852_100557062 3300005616 Bacteria 1147
30 Ga0068852_100867645 3300005616 Bacteria 919
31 Ga0068859_100059940 3300005617 Bacteria 3835
32 Ga0068859_100773762 3300005617 Bacteria 1048
33 Ga0068859_101999645 3300005617 Bacteria 640
34 Ga0068864_102179527 3300005618 Bacteria 561
35 Ga0068870_10209004 3300005840 Bacteria 1188
36 Ga0068863_100999662 3300005841 Bacteria 839
37 Ga0068860_100062950 3300005843 Bacteria 3525
38 Ga0068862_102435540 3300005844 Bacteria 535
39 Ga0081455_10309335 3300005937 Bacteria 1130
40 Ga0081539_10035682 3300005985 Bacteria 2984
41 Ga0075368_10208046 3300006042 Bacteria 829
42 Ga0075364_10021942 3300006051 Bacteria 4028
43 Ga0075432_10011564 3300006058 Bacteria 3000
44 Ga0070715_10152806 3300006163 Bacteria 1133
45 Ga0075366_10065827 3300006195 Bacteria 2156
46 Ga0097621_100222301 3300006237 Bacteria 1646
47 Ga0097621_101436441 3300006237 Bacteria 654
48 Ga0075370_10626952 3300006353 Bacteria 652
49 Ga0075428_100058368 3300006844 Bacteria 4225
50 Ga0075428_101087848 3300006844 Bacteria 845
51 Ga0075430_100364956 3300006846 Unclassified 1192
52 Ga0075431_100501451 3300006847 Bacteria 1205
53 Ga0075431_101607830 3300006847 Unclassified 607
54 Ga0075433_10439955 3300006852 Bacteria 1149
55 Ga0075433_10907941 3300006852 Unclassified 768
56 Ga0075433_11731436 3300006852 Unclassified 538
57 Ga0075434_100020658 3300006871 Bacteria 6392
58 Ga0075434_100096574 3300006871 Bacteria 2960
59 Ga0075429_100078196 3300006880 Bacteria 2883
60 Ga0068865_100210501 3300006881 Bacteria 1515
61 Ga0075436_100269893 3300006914 Bacteria 1215
62 Ga0097620_100059943 3300006931 Bacteria 3835
63 Ga0097620_100773671 3300006931 Bacteria 1048
64 Ga0097620_102000281 3300006931 Bacteria 640
65 Ga0111539_10281447 3300009094 Bacteria 1935
66 Ga0105245_11016562 3300009098 Bacteria 874
67 Ga0114129_10005584 3300009147 Bacteria 17793
68 Ga0114129_10031429 3300009147 Bacteria 7505
69 Ga0114129_10043154 3300009147 Bacteria 6346
70 Ga0114129_10174490 3300009147 Bacteria 2928
71 Ga0114129_10211566 3300009147 Unclassified 2621
72 Ga0105241_10890940 3300009174 Bacteria 826
73 Ga0105242_10006512 3300009176 Bacteria 8992
74 Ga0105248_10593167 3300009177 Bacteria 1250
75 Ga0105248_11859014 3300009177 Bacteria 683
76 Ga0105237_10129043 3300009545 Unclassified 2523
77 Ga0105237_10756122 3300009545 Bacteria 978
78 Ga0105249_10818192 3300009553 Bacteria 996
79 Ga0105239_10225551 3300010375 Unclassified 2102
80 Ga0157374_10401671 3300013296 Bacteria 1367
81 Ga0157374_10871965 3300013296 Bacteria 917
82 Ga0163162_10290404 3300013306 Bacteria 1767
83 Ga0163163_10865765 3300014325 Bacteria 967
84 Ga0157380_10999587 3300014326 Bacteria 870
85 Ga0157380_11359232 3300014326 Unclassified 759
86 Ga0157379_10074724 3300014968 Bacteria 3034
87 Ga0157376_10913183 3300014969 Bacteria 897
88 Ga0207688_10013150 3300025901 Bacteria 4499
89 Ga0207645_10065812 3300025907 Bacteria 2316
90 Ga0207643_10292665 3300025908 Bacteria 1012
91 Ga0207705_10058611 3300025909 Bacteria 2778
92 Ga0207671_10170409 3300025914 Unclassified 1690
93 Ga0207662_11169107 3300025918 Bacteria 547
94 Ga0207652_10759134 3300025921 Bacteria 863
95 Ga0207644_11181729 3300025931 Bacteria 643
96 Ga0207686_10004739 3300025934 Bacteria 7296
97 Ga0207686_10429229 3300025934 Bacteria 1012
98 Ga0207669_10093548 3300025937 Bacteria 1965
99 Ga0207704_10327187 3300025938 Bacteria 1185
100 Ga0207691_10538389 3300025940 Bacteria 991
101 Ga0207711_11008604 3300025941 Bacteria 772
102 Ga0207711_11492671 3300025941 Bacteria 619
103 Ga0207661_10697348 3300025944 Bacteria 934
104 Ga0207712_10907425 3300025961 Bacteria 779
105 Ga0207668_10643197 3300025972 Bacteria 928
106 Ga0207658_10077170 3300025986 Bacteria 2541
107 Ga0207677_10029461 3300026023 Bacteria 3489
108 Ga0207708_10445178 3300026075 Bacteria 1078
109 Ga0207708_10483241 3300026075 Bacteria 1036
110 Ga0207641_11037598 3300026088 Bacteria 817
111 Ga0207648_10852178 3300026089 Bacteria 850
112 Ga0207676_10098804 3300026095 Bacteria 2414
113 Ga0207675_100640384 3300026118 Bacteria 1068
114 Ga0207683_10656975 3300026121 Bacteria 971
115 Ga0207698_10387350 3300026142 Bacteria 1332
116 Ga0207428_10061356 3300027907 Bacteria 2977
117 Ga0268266_10027659 3300028379 Bacteria 4821
118 Ga0268264_10062988 3300028381 Bacteria 3116
119 Ga0265316_10833210 3300031344 Unclassified 646
120 Ga0307509_10580167 3300031507 Bacteria 796
121 Ga0307405_12041185 3300031731 Bacteria 514
122 Ga0307413_11772700 3300031824 Bacteria 552
123 Ga0307410_10193342 3300031852 Bacteria 1549
124 Ga0307416_101815076 3300032002 Bacteria 714
125 Ga0307411_11607740 3300032005 Unclassified 600
126 Ga0373959_0000170 3300034820 Bacteria 14689
127 Ga0373936_0176330 3300035113 Bacteria 936
128 Ga0373936_0203778 3300035113 Bacteria 874
129 Ga0373945_0311282 3300035116 Unclassified 676
130 Ga0373956_0295471 3300035119 Unclassified 771
131 Ga0373955_0184142 3300035172 Unclassified 1240
132 Ga0373961_0002068 3300035241 Bacteria 5346
133 Ga0373924_0324169 3300035410 Bacteria 685
134 Ga0373935_0090407 3300035692 Bacteria 2003
135 Ga0373935_0812769 3300035692 Unclassified 690
136 Ga0373935_1477853 3300035692 Unclassified 509
137 Ga0373927_0457210 3300035695 Bacteria 843
138 Ga0373927_0464293 3300035695 Bacteria 836
139 Ga0373947_0026945 3300035725 Bacteria 3362
140 Ga0373947_0854523 3300035725 Unclassified 621
141 Ga0373937_0065479 3300036401 Bacteria 3345
142 Ga0373937_0204613 3300036401 Bacteria 1856
143 Ga0373937_0558300 3300036401 Bacteria 1088
144 Ga0316584_0773277 3300036712 Bacteria 654
145 Ga0373925_0012245 3300037068 Bacteria 6207
146 Ga0373925_0050530 3300037068 Bacteria 3101
147 Ga0373925_0271953 3300037068 Bacteria 1363
148 Ga0400489_34886 3300039093 Unclassified 1262
149 Ga0451789_1288434 3300041443 Bacteria 542
150 Ga0451807_2400420 3300041486 Bacteria 523
151 Ga0451839_1320792 3300041496 Unclassified 655
152 Ga0439460_0345642 3300042461 Bacteria 524
153 Ga0451577_0099736 3300042876 Bacteria 2594
154 Ga0466963_0496508 3300044694 Bacteria 862
155 Ga0453684_0032636 3300044712 Bacteria 7281
156 Ga0495641_0178446 3300046461 Bacteria 951
157 Ga0495580_0002581 3300046472 Bacteria 15754
158 Ga0495582_0277226 3300046473 Bacteria 963
159 Ga0495594_0639461 3300046499 Bacteria 602
160 Ga0495630_0574158 3300046517 Bacteria 865
161 Ga0495643_0001409 3300046522 Bacteria 22295
162 Ga0495652_0892939 3300046529 Unclassified 587
163 Ga0495665_0563941 3300046531 Unclassified 571
164 Ga0495640_0279497 3300046533 Bacteria 1040
165 Ga0495656_0169791 3300046615 Unclassified 1066
166 Ga0495658_0283638 3300046683 Bacteria 1045
167 Ga0495613_0334400 3300046689 Bacteria 1043
168 Ga0495600_0290702 3300046809 Bacteria 1033
169 Ga0495604_0579763 3300047317 Unclassified 721
170 Ga0495680_0994901 3300047322 Unclassified 536
171 Ga0496100_0408218 3300048903 Bacteria 1036
172 Ga0496101_0042662 3300048904 Unclassified 3239
173 Ga0496102_0017306 3300048905 Bacteria 6312
174 Ga0496104_0102347 3300048907 Bacteria 2743
175 Ga0496104_0705385 3300048907 Bacteria 917
176 Ga0496106_0125394 3300048909 Bacteria 2010
177 Ga0496107_0091708 3300048910 Unclassified 2221
178 Ga0496108_1295947 3300048911 Bacteria 613
179 Ga0496109_0266333 3300048912 Bacteria 1614
180 Ga0496110_0025577 3300048913 Bacteria 5046
181 Ga0496111_0166065 3300048914 Unclassified 1639
182 Ga0496111_0350591 3300048914 Bacteria 1093
183 Ga0496112_0204796 3300048915 Bacteria 1931
184 Ga0496113_0141963 3300048916 Bacteria 1890
185 Ga0496114_0441244 3300048917 Bacteria 1153
186 Ga0496114_0514899 3300048917 Bacteria 1058
187 Ga0501067_0456061 3300049583 Unclassified 714
188 Ga0501068_0075640 3300049584 Bacteria 2060
189 Ga0501068_0828945 3300049584 Bacteria 607
190 Ga0501075_0002066 3300049591 Bacteria 13264
191 Ga0501076_1763982 3300049592 Bacteria 507
192 Ga0501077_0000828 3300049593 Bacteria 18771
193 Ga0501079_1002750 3300049741 Bacteria 658
194 Ga0501080_0061608 3300049742 Unclassified 3492
195 Ga0501080_1702844 3300049742 Bacteria 532
196 Ga0501035_1154830 3300049822 Bacteria 603
197 Ga0501045_0516034 3300049824 Bacteria 887
198 nmdc:mga00v17_13765_c1 3300050491 Bacteria 4497
199 nmdc:mga0k408_115329_c1 3300050493 Bacteria 1589
200 nmdc:mga06z11_2452_c1 3300050494 Bacteria 7079
201 nmdc:mga05p37_1101874_c1 3300050507 Unclassified 831
202 nmdc:mga05p37_159970_c1 3300050507 Bacteria 2751
203 nmdc:mga05p37_25032_c1 3300050507 Bacteria 7256
204 nmdc:mga09592_504748_c1 3300050508 Unclassified 1041
205 nmdc:mga06r32_62418_c1 3300050510 Unclassified 3590
206 nmdc:mga08y16_201005_c1 3300050511 Bacteria 2065
207 nmdc:mga08y16_230207_c1 3300050511 Bacteria 1917
208 nmdc:mga0n895_133336_c1 3300050512 Bacteria 2510
209 nmdc:mga0n895_82882_c1 3300050512 Bacteria 3197
210 nmdc:mga08x19_249524_c1 3300050514 Bacteria 1225
211 nmdc:mga08x19_864335_c1 3300050514 Unclassified 642
212 Ga0495601_0208827 3300053077 Bacteria 1276
213 Ga0500616_0000234 3300053153 Bacteria 86819
214 Ga0501082_0000634 3300060353 Bacteria 31010
215 Ga0530510_0520285 3300061734 Bacteria 902
216 Ga0501067_0009041
217 rootH1_10318368
218 Ga0058862_12786542
219 Ga0065715_10790347
220 Ga0070658_10029559
221 Ga0070676_10300011
222 Ga0070683_100262254
223 Ga0070690_100664318
224 Ga0070670_100063030
225 Ga0070666_10194236
226 Ga0068868_100062348
227 Ga0070689_100309867
228 Ga0070691_10680542
229 Ga0070675_100181809
230 Ga0070671_101210152
231 Ga0070674_100484039
232 Ga0070667_100156291
233 Ga0070700_100263183
234 Ga0070700_100454150
235 Ga0070679_100845886
236 Ga0070686_100919698
237 Ga0070686_101015084
238 Ga0070695_101297445
239 Ga0070695_101714154
240 Ga0070696_100684843
241 Ga0070665_100003254
242 Ga0070704_102051948
243 Ga0068854_100317500
244 Ga0068852_100557062
245 Ga0068852_100867645
246 Ga0068859_100059940
247 Ga0068859_100773762
248 Ga0068859_101999645
249 Ga0068864_102179527
250 Ga0068870_10209004
251 Ga0068863_100999662
252 Ga0068860_100062950
253 Ga0068862_102435540
254 Ga0081455_10309335
255 Ga0081539_10035682
256 Ga0075368_10208046
257 Ga0075364_10021942
258 Ga0075432_10011564
259 Ga0070715_10152806
260 Ga0075366_10065827
261 Ga0097621_100222301
262 Ga0097621_101436441
263 Ga0075370_10626952
264 Ga0075428_100058368
265 Ga0075428_101087848
266 Ga0075430_100364956
267 Ga0075431_100501451
268 Ga0075431_101607830
269 Ga0075433_10439955
270 Ga0075433_10907941
271 Ga0075433_11731436
272 Ga0075434_100020658
273 Ga0075434_100096574
274 Ga0075429_100078196
275 Ga0068865_100210501
276 Ga0075436_100269893
277 Ga0097620_100059943
278 Ga0097620_100773671
279 Ga0097620_102000281
280 Ga0111539_10281447
281 Ga0105245_11016562
282 Ga0114129_10005584
283 Ga0114129_10031429
284 Ga0114129_10043154
285 Ga0114129_10174490
286 Ga0114129_10211566
287 Ga0105241_10890940
288 Ga0105242_10006512
289 Ga0105248_10593167
290 Ga0105248_11859014
291 Ga0105237_10129043
292 Ga0105237_10756122
293 Ga0105249_10818192
294 Ga0105239_10225551
295 Ga0157374_10401671
296 Ga0157374_10871965
297 Ga0163162_10290404
298 Ga0163163_10865765
299 Ga0157380_10999587
300 Ga0157380_11359232
301 Ga0157379_10074724
302 Ga0157376_10913183
303 Ga0207688_10013150
304 Ga0207645_10065812
305 Ga0207643_10292665
306 Ga0207705_10058611
307 Ga0207671_10170409
308 Ga0207662_11169107
309 Ga0207652_10759134
310 Ga0207644_11181729
311 Ga0207686_10004739
312 Ga0207686_10429229
313 Ga0207669_10093548
314 Ga0207704_10327187
315 Ga0207691_10538389
316 Ga0207711_11008604
317 Ga0207711_11492671
318 Ga0207661_10697348
319 Ga0207712_10907425
320 Ga0207668_10643197
321 Ga0207658_10077170
322 Ga0207677_10029461
323 Ga0207708_10445178
324 Ga0207708_10483241
325 Ga0207641_11037598
326 Ga0207648_10852178
327 Ga0207676_10098804
328 Ga0207675_100640384
329 Ga0207683_10656975
330 Ga0207698_10387350
331 Ga0207428_10061356
332 Ga0268266_10027659
333 Ga0268264_10062988
334 Ga0265316_10833210
335 Ga0307509_10580167
336 Ga0307405_12041185
337 Ga0307413_11772700
338 Ga0307410_10193342
339 Ga0307416_101815076
340 Ga0307411_11607740
341 Ga0373959_0000170
342 Ga0373936_0176330
343 Ga0373936_0203778
344 Ga0373945_0311282
345 Ga0373956_0295471
346 Ga0373955_0184142
347 Ga0373961_0002068
348 Ga0373924_0324169
349 Ga0373935_0090407
350 Ga0373935_0812769
351 Ga0373935_1477853
352 Ga0373927_0457210
353 Ga0373927_0464293
354 Ga0373947_0026945
355 Ga0373947_0854523
356 Ga0373937_0065479
357 Ga0373937_0204613
358 Ga0373937_0558300
359 Ga0316584_0773277
360 Ga0373925_0012245
361 Ga0373925_0050530
362 Ga0373925_0271953
363 Ga0400489_34886
364 Ga0451789_1288434
365 Ga0451807_2400420
366 Ga0451839_1320792
367 Ga0439460_0345642
368 Ga0451577_0099736
369 Ga0466963_0496508
370 Ga0453684_0032636
371 Ga0495641_0178446
372 Ga0495580_0002581
373 Ga0495582_0277226
374 Ga0495594_0639461
375 Ga0495630_0574158
376 Ga0495643_0001409
377 Ga0495652_0892939
378 Ga0495665_0563941
379 Ga0495640_0279497
380 Ga0495656_0169791
381 Ga0495658_0283638
382 Ga0495613_0334400
383 Ga0495600_0290702
384 Ga0495604_0579763
385 Ga0495680_0994901
386 Ga0496100_0408218
387 Ga0496101_0042662
388 Ga0496102_0017306
389 Ga0496104_0102347
390 Ga0496104_0705385
391 Ga0496106_0125394
392 Ga0496107_0091708
393 Ga0496108_1295947
394 Ga0496109_0266333
395 Ga0496110_0025577
396 Ga0496111_0166065
397 Ga0496111_0350591
398 Ga0496112_0204796
399 Ga0496113_0141963
400 Ga0496114_0441244
401 Ga0496114_0514899
402 Ga0501067_0456061
403 Ga0501068_0075640
404 Ga0501068_0828945
405 Ga0501075_0002066
406 Ga0501076_1763982
407 Ga0501077_0000828
408 Ga0501079_1002750
409 Ga0501080_0061608
410 Ga0501080_1702844
411 Ga0501035_1154830
412 Ga0501045_0516034
413 nmdc:mga00v17_13765_c1
414 nmdc:mga0k408_115329_c1
415 nmdc:mga06z11_2452_c1
416 nmdc:mga05p37_1101874_c1
417 nmdc:mga05p37_159970_c1
418 nmdc:mga05p37_25032_c1
419 nmdc:mga09592_504748_c1
420 nmdc:mga06r32_62418_c1
421 nmdc:mga08y16_201005_c1
422 nmdc:mga08y16_230207_c1
423 nmdc:mga0n895_133336_c1
424 nmdc:mga0n895_82882_c1
425 nmdc:mga08x19_249524_c1
426 nmdc:mga08x19_864335_c1
427 Ga0495601_0208827
428 Ga0500616_0000234
429 Ga0501082_0000634
430 Ga0530510_0520285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9207 33 109
4ysf-assembly1.cif.gz_A resting state of rat cysteine dioxygenase h155n variant 0.9176 33 111
6u4v-assembly1.cif.gz_A non-crosslinked wild type cysteine dioxygenase 0.9168 33 111
5ezw-assembly1.cif.gz_A thiosulfate bound rat cysteine dioxygenase y157h variant 0.9087 33 111
6n43-assembly1.cif.gz_A crystal structure of cysteine, nitric oxide-bound ferrous form of the crosslinked human cysteine dioxygenase in the anaerobic condition 0.905 33 111
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9383 34 108 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9322 33 120 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9221 33 109 2.60.120.10
af_Q2G1P7_1_117_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8891 52 108 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8819 3 121 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8UH96-F1-model_v4 Cupin 0.9955 11 121
AF-A0A7V1UML9-F1-model_v4 Cupin 0.9952 1 120
AF-A0A3B8YZF2-F1-model_v4 Cupin 0.9949 1 121
AF-A0A2U3L9B5-F1-model_v4 Cupin 2, conserved barrel domain protein 0.9935 1 120
AF-A0A3C0AUA2-F1-model_v4 Cupin 0.9935 25 109

Map