F326774

General Info

Members Datasets Scaffolds Average Seq Length
215 122 430 254

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0153755|Ga0466967_0153755_1326_2120
Length 264
Sequence MSSLTSPAPLTLAGAQDHQQVVPVTRETRPHVLIVVASPHEIAPGFVVGFWASELTHPYYEFSQARYRVTVASPRGGKVHLDGFSDPRDPSRWSADDLISMGFLSTPELAALLDDTARLGDLDLDQFDALVVAGGMAPMFTFRQDEDIKRALQHFYQAQKPTAALCHGVAALMDVTLADGRRLIEGKTITGFANVEEDYGRRATGQDHDLWPWRIEDTARQLGANYIQAGLFRAFAVRDGRLITGQQQYSGGEVARLVVQALGV

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
84 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.12
Rhizosphere 74.42
Stem 0
Stem Tuber 0
Unclassified 6.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0153755 3300045976 Bacteria 2153
2 Ga0070680_100377910 3300005336 Unclassified 1206
3 Ga0070709_10016127 3300005434 Bacteria 4259
4 Ga0070714_100010999 3300005435 Bacteria 7168
5 Ga0070714_100121864 3300005435 Bacteria 2320
6 Ga0070714_100366631 3300005435 Unclassified 1355
7 Ga0070713_100183509 3300005436 Bacteria 1881
8 Ga0070713_100255735 3300005436 Bacteria 1599
9 Ga0070710_10007293 3300005437 Bacteria 5349
10 Ga0070710_10101266 3300005437 Unclassified 1716
11 Ga0070710_10442732 3300005437 Bacteria 879
12 Ga0070708_100016923 3300005445 Bacteria 6064
13 Ga0070663_100036938 3300005455 Bacteria 3397
14 Ga0070706_100024569 3300005467 Bacteria 5548
15 Ga0070707_100017198 3300005468 Bacteria 6795
16 Ga0070707_100042301 3300005468 Bacteria 4362
17 Ga0070698_100056194 3300005471 Bacteria 3989
18 Ga0070698_100097659 3300005471 Bacteria 2913
19 Ga0070698_100099572 3300005471 Bacteria 2880
20 Ga0070699_100034678 3300005518 Bacteria 4361
21 Ga0070679_100133388 3300005530 Bacteria 2465
22 Ga0070697_100001998 3300005536 Bacteria 15626
23 Ga0070697_100136858 3300005536 Bacteria 2057
24 Ga0068853_100041278 3300005539 Bacteria 3940
25 Ga0068855_100011101 3300005563 Bacteria 10872
26 Ga0068855_100227848 3300005563 Bacteria 2088
27 Ga0068854_100004373 3300005578 Bacteria 8909
28 Ga0068856_100015473 3300005614 Bacteria 7371
29 Ga0068856_100052251 3300005614 Bacteria 4029
30 Ga0068856_100184293 3300005614 Bacteria 2101
31 Ga0068852_100043688 3300005616 Bacteria 3802
32 Ga0081540_1001012 3300005983 Bacteria 25230
33 Ga0081539_10053611 3300005985 Bacteria 2257
34 Ga0070717_10012105 3300006028 Bacteria 6573
35 Ga0070717_10186522 3300006028 Unclassified 1810
36 Ga0070712_100038891 3300006175 Bacteria 3253
37 Ga0075433_10012129 3300006852 Bacteria 6951
38 Ga0075434_100005724 3300006871 Bacteria 11345
39 Ga0075435_100062954 3300007076 Bacteria 3012
40 Ga0075435_100143094 3300007076 Bacteria 2007
41 Ga0105240_10036597 3300009093 Bacteria 6311
42 Ga0111539_10502662 3300009094 Bacteria 1412
43 Ga0114129_10727800 3300009147 Bacteria 1272
44 Ga0105241_10066688 3300009174 Bacteria 2784
45 Ga0105248_10559822 3300009177 Bacteria 1290
46 Ga0105238_10024119 3300009551 Bacteria 6201
47 Ga0105239_10201542 3300010375 Bacteria 2229
48 Ga0105239_11116261 3300010375 Bacteria 908
49 Ga0157374_10237517 3300013296 Bacteria 1792
50 Ga0157378_10608015 3300013297 Bacteria 1105
51 Ga0213874_10072610 3300021377 Bacteria 1100
52 Ga0213876_10006336 3300021384 Bacteria 6451
53 Ga0213876_10009584 3300021384 Bacteria 5209
54 Ga0213876_10025024 3300021384 Bacteria 3151
55 Ga0213876_10028378 3300021384 Unclassified 2950
56 Ga0213876_10112318 3300021384 Bacteria 1446
57 Ga0213876_10120673 3300021384 Bacteria 1392
58 Ga0213875_10027297 3300021388 Bacteria 2716
59 Ga0213875_10029643 3300021388 Bacteria 2595
60 Ga0213875_10040749 3300021388 Bacteria 2186
61 Ga0213875_10055047 3300021388 Bacteria 1863
62 Ga0213875_10065067 3300021388 Unclassified 1704
63 Ga0207692_10035383 3300025898 Unclassified 2426
64 Ga0207699_10078268 3300025906 Bacteria 2042
65 Ga0207684_10024060 3300025910 Bacteria 5196
66 Ga0207695_10243602 3300025913 Bacteria 1699
67 Ga0207671_10023321 3300025914 Bacteria 4668
68 Ga0207693_10046999 3300025915 Bacteria 3392
69 Ga0207693_10162700 3300025915 Bacteria 1756
70 Ga0207663_10012579 3300025916 Bacteria 4580
71 Ga0207646_10004846 3300025922 Bacteria 14418
72 Ga0207646_10022447 3300025922 Bacteria 5813
73 Ga0207646_10078325 3300025922 Bacteria 2955
74 Ga0207700_10046264 3300025928 Bacteria 3217
75 Ga0207700_10152991 3300025928 Bacteria 1908
76 Ga0207700_10247909 3300025928 Unclassified 1520
77 Ga0207664_10011974 3300025929 Bacteria 6192
78 Ga0207664_10038698 3300025929 Bacteria 3699
79 Ga0207664_10041068 3300025929 Bacteria 3602
80 Ga0207664_10112035 3300025929 Bacteria 2271
81 Ga0207709_10367889 3300025935 Unclassified 1090
82 Ga0207665_10018861 3300025939 Bacteria 4534
83 Ga0207661_10336190 3300025944 Bacteria 1360
84 Ga0207667_10006531 3300025949 Bacteria 14102
85 Ga0207667_10106211 3300025949 Bacteria 2896
86 Ga0207640_10137898 3300025981 Bacteria 1773
87 Ga0207702_10019502 3300026078 Bacteria 5611
88 Ga0207702_10302878 3300026078 Bacteria 1517
89 Ga0207698_10181601 3300026142 Bacteria 1864
90 Ga0207698_10548673 3300026142 Bacteria 1132
91 Ga0268266_10085171 3300028379 Bacteria 2761
92 Ga0265340_10024371 3300031247 Bacteria 3074
93 Ga0373937_0882373 3300036401 Bacteria 843
94 Ga0395900_0103309 3300037418 Bacteria 2927
95 Ga0395898_0167009 3300037466 Bacteria 2104
96 Ga0395905_0100426 3300037471 Bacteria 2717
97 Ga0436364_0065831 3300037853 Bacteria 1232
98 Ga0436364_0175492 3300037853 Bacteria 3012
99 Ga0436364_0409665 3300037853 Bacteria 38199
100 Ga0436364_0539213 3300037853 Plasmid 3821
101 Ga0436364_0585759 3300037853 Bacteria 1872
102 Ga0436364_0667559 3300037853 Bacteria 3645
103 Ga0436364_0778170 3300037853 Bacteria 871
104 Ga0436364_1109347 3300037853 Bacteria 2706
105 Ga0436364_1183013 3300037853 Bacteria 17664
106 Ga0436364_1194811 3300037853 Bacteria 27925
107 Ga0436364_1251028 3300037853 Bacteria 5472
108 Ga0436364_1521382 3300037853 Bacteria 2509
109 Ga0395901_0072743 3300038443 Bacteria 3584
110 Ga0395901_0983191 3300038443 Unclassified 821
111 Ga0436365_0011157 3300039437 Bacteria 2118
112 Ga0436365_0071483 3300039437 Bacteria 10046
113 Ga0436365_0113178 3300039437 Bacteria 7615
114 Ga0436365_0160639 3300039437 Bacteria 4768
115 Ga0436365_0309602 3300039437 Bacteria 12527
116 Ga0436365_0321840 3300039437 Bacteria 4502
117 Ga0436365_1077479 3300039437 Unclassified 867
118 Ga0436365_1113574 3300039437 Bacteria 1781
119 Ga0436365_1354371 3300039437 Bacteria 14263
120 Ga0436365_1515922 3300039437 Bacteria 7052
121 Ga0436365_1658614 3300039437 Bacteria 4958
122 Ga0436360_1044037 3300039438 Bacteria 1444
123 Ga0436360_1291168 3300039438 Bacteria 1458
124 Ga0436361_0825541 3300039447 Bacteria 1167
125 Ga0436361_0968966 3300039447 Unclassified 2153
126 Ga0436363_0046850 3300039450 Bacteria 3061
127 Ga0436363_0176646 3300039450 Bacteria 3654
128 Ga0436363_0191584 3300039450 Unclassified 1145
129 Ga0436363_0771728 3300039450 Bacteria 6908
130 Ga0436363_0965972 3300039450 Bacteria 4515
131 Ga0436363_1413047 3300039450 Unclassified 2253
132 Ga0436363_1435385 3300039450 Bacteria 8667
133 Ga0436363_1674390 3300039450 Bacteria 51173
134 Ga0436362_0055016 3300039453 Bacteria 2317
135 Ga0436362_0060459 3300039453 Bacteria 3018
136 Ga0436362_1077286 3300039453 Bacteria 7046
137 Ga0466969_0012310 3300044656 Bacteria 4513
138 Ga0466965_0033974 3300044683 Bacteria 2494
139 Ga0466961_0021565 3300044693 Bacteria 4145
140 Ga0466963_0001754 3300044694 Bacteria 11820
141 Ga0466963_0002114 3300044694 Bacteria 10986
142 Ga0466963_0232180 3300044694 Unclassified 1293
143 Ga0466971_0018061 3300044719 Bacteria 3124
144 Ga0466971_0114550 3300044719 Bacteria 1246
145 Ga0466968_0033649 3300044735 Bacteria 2136
146 Ga0466968_0086154 3300044735 Bacteria 1386
147 Ga0466968_0101316 3300044735 Bacteria 1286
148 Ga0466970_0014762 3300044765 Bacteria 4014
149 Ga0466970_0021653 3300044765 Bacteria 3350
150 Ga0466957_0001094 3300044842 Bacteria 14003
151 Ga0466957_0081556 3300044842 Bacteria 2015
152 Ga0466960_0011191 3300044901 Bacteria 3745
153 Ga0466960_0012487 3300044901 Bacteria 3586
154 Ga0466959_0001376 3300045049 Bacteria 14845
155 Ga0466959_0002900 3300045049 Bacteria 11066
156 Ga0466959_0023293 3300045049 Bacteria 4583
157 Ga0466959_0096072 3300045049 Bacteria 2125
158 Ga0466958_0001494 3300045836 Bacteria 11170
159 Ga0466958_0008679 3300045836 Bacteria 5643
160 Ga0466958_0014079 3300045836 Bacteria 4562
161 Ga0466958_0021888 3300045836 Bacteria 3739
162 Ga0466958_0080336 3300045836 Bacteria 2006
163 Ga0466958_0124502 3300045836 Bacteria 1616
164 Ga0466967_0000629 3300045976 Bacteria 17661
165 Ga0466967_0001313 3300045976 Bacteria 14204
166 Ga0466967_0005653 3300045976 Bacteria 8706
167 Ga0466967_0173691 3300045976 Bacteria 2029
168 Ga0466967_0261127 3300045976 Bacteria 1657
169 Ga0466967_0589392 3300045976 Bacteria 1096
170 Ga0466967_0674066 3300045976 Bacteria 1023
171 Ga0466967_0924258 3300045976 Bacteria 868
172 Ga0495651_0494586 3300046462 Bacteria 784
173 Ga0495628_0012671 3300046516 Bacteria 7102
174 Ga0495652_0187188 3300046529 Bacteria 1583
175 Ga0495652_0240117 3300046529 Bacteria 1349
176 Ga0495623_0036637 3300046679 Bacteria 3141
177 Ga0495646_0193101 3300046680 Bacteria 1112
178 Ga0495680_0277506 3300047322 Bacteria 1182
179 Ga0495602_0280021 3300048088 Bacteria 1229
180 Ga0496101_0128861 3300048904 Bacteria 1920
181 Ga0496102_0015267 3300048905 Bacteria 6687
182 Ga0496103_0066262 3300048906 Bacteria 2254
183 Ga0496104_0010409 3300048907 Bacteria 8306
184 Ga0496105_0074460 3300048908 Bacteria 2805
185 Ga0496106_0329142 3300048909 Bacteria 1226
186 Ga0496107_0128638 3300048910 Bacteria 1869
187 Ga0496108_0016253 3300048911 Bacteria 6066
188 Ga0496109_0002002 3300048912 Bacteria 16899
189 Ga0496110_0000362 3300048913 Bacteria 30414
190 Ga0496111_0362570 3300048914 Bacteria 1072
191 Ga0501031_0011430 3300049568 Bacteria 5782
192 Ga0501033_0060573 3300049570 Bacteria 2792
193 Ga0501036_0018418 3300049572 Bacteria 5850
194 Ga0501037_0118592 3300049573 Bacteria 1904
195 Ga0501040_0039402 3300049576 Bacteria 3213
196 Ga0501041_0009268 3300049577 Bacteria 5796
197 Ga0501042_0015450 3300049578 Bacteria 5229
198 Ga0501043_0178757 3300049579 Bacteria 1654
199 Ga0501046_0022006 3300049580 Bacteria 5255
200 Ga0501068_0024822 3300049584 Bacteria 3522
201 Ga0501071_0001383 3300049587 Bacteria 13899
202 Ga0501072_0011173 3300049588 Bacteria 6854
203 Ga0501075_0010167 3300049591 Bacteria 6605
204 Ga0501076_0005623 3300049592 Bacteria 9031
205 Ga0501081_0050589 3300049743 Bacteria 2862
206 Ga0501035_0455275 3300049822 Bacteria 1058
207 Ga0501045_0014415 3300049824 Bacteria 5601
208 nmdc:mga08y16_265985_c1 3300050511 Bacteria 1770
209 nmdc:mga0n895_2358_c1 3300050512 Bacteria 14725
210 nmdc:mga0rr50_127014_c1 3300050513 Bacteria 2037
211 nmdc:mga0a205_9156_c1 3300050515 Bacteria 9037
212 Ga0495601_0001404 3300053077 Bacteria 13258
213 Ga0501084_0013650 3300054114 Bacteria 6723
214 Ga0501082_0007184 3300060353 Bacteria 9598
215 2558911488 2558860112 Bacteria 9931328
216 Ga0466967_0153755
217 Ga0070680_100377910
218 Ga0070709_10016127
219 Ga0070714_100010999
220 Ga0070714_100121864
221 Ga0070714_100366631
222 Ga0070713_100183509
223 Ga0070713_100255735
224 Ga0070710_10007293
225 Ga0070710_10101266
226 Ga0070710_10442732
227 Ga0070708_100016923
228 Ga0070663_100036938
229 Ga0070706_100024569
230 Ga0070707_100017198
231 Ga0070707_100042301
232 Ga0070698_100056194
233 Ga0070698_100097659
234 Ga0070698_100099572
235 Ga0070699_100034678
236 Ga0070679_100133388
237 Ga0070697_100001998
238 Ga0070697_100136858
239 Ga0068853_100041278
240 Ga0068855_100011101
241 Ga0068855_100227848
242 Ga0068854_100004373
243 Ga0068856_100015473
244 Ga0068856_100052251
245 Ga0068856_100184293
246 Ga0068852_100043688
247 Ga0081540_1001012
248 Ga0081539_10053611
249 Ga0070717_10012105
250 Ga0070717_10186522
251 Ga0070712_100038891
252 Ga0075433_10012129
253 Ga0075434_100005724
254 Ga0075435_100062954
255 Ga0075435_100143094
256 Ga0105240_10036597
257 Ga0111539_10502662
258 Ga0114129_10727800
259 Ga0105241_10066688
260 Ga0105248_10559822
261 Ga0105238_10024119
262 Ga0105239_10201542
263 Ga0105239_11116261
264 Ga0157374_10237517
265 Ga0157378_10608015
266 Ga0213874_10072610
267 Ga0213876_10006336
268 Ga0213876_10009584
269 Ga0213876_10025024
270 Ga0213876_10028378
271 Ga0213876_10112318
272 Ga0213876_10120673
273 Ga0213875_10027297
274 Ga0213875_10029643
275 Ga0213875_10040749
276 Ga0213875_10055047
277 Ga0213875_10065067
278 Ga0207692_10035383
279 Ga0207699_10078268
280 Ga0207684_10024060
281 Ga0207695_10243602
282 Ga0207671_10023321
283 Ga0207693_10046999
284 Ga0207693_10162700
285 Ga0207663_10012579
286 Ga0207646_10004846
287 Ga0207646_10022447
288 Ga0207646_10078325
289 Ga0207700_10046264
290 Ga0207700_10152991
291 Ga0207700_10247909
292 Ga0207664_10011974
293 Ga0207664_10038698
294 Ga0207664_10041068
295 Ga0207664_10112035
296 Ga0207709_10367889
297 Ga0207665_10018861
298 Ga0207661_10336190
299 Ga0207667_10006531
300 Ga0207667_10106211
301 Ga0207640_10137898
302 Ga0207702_10019502
303 Ga0207702_10302878
304 Ga0207698_10181601
305 Ga0207698_10548673
306 Ga0268266_10085171
307 Ga0265340_10024371
308 Ga0373937_0882373
309 Ga0395900_0103309
310 Ga0395898_0167009
311 Ga0395905_0100426
312 Ga0436364_0065831
313 Ga0436364_0175492
314 Ga0436364_0409665
315 Ga0436364_0539213
316 Ga0436364_0585759
317 Ga0436364_0667559
318 Ga0436364_0778170
319 Ga0436364_1109347
320 Ga0436364_1183013
321 Ga0436364_1194811
322 Ga0436364_1251028
323 Ga0436364_1521382
324 Ga0395901_0072743
325 Ga0395901_0983191
326 Ga0436365_0011157
327 Ga0436365_0071483
328 Ga0436365_0113178
329 Ga0436365_0160639
330 Ga0436365_0309602
331 Ga0436365_0321840
332 Ga0436365_1077479
333 Ga0436365_1113574
334 Ga0436365_1354371
335 Ga0436365_1515922
336 Ga0436365_1658614
337 Ga0436360_1044037
338 Ga0436360_1291168
339 Ga0436361_0825541
340 Ga0436361_0968966
341 Ga0436363_0046850
342 Ga0436363_0176646
343 Ga0436363_0191584
344 Ga0436363_0771728
345 Ga0436363_0965972
346 Ga0436363_1413047
347 Ga0436363_1435385
348 Ga0436363_1674390
349 Ga0436362_0055016
350 Ga0436362_0060459
351 Ga0436362_1077286
352 Ga0466969_0012310
353 Ga0466965_0033974
354 Ga0466961_0021565
355 Ga0466963_0001754
356 Ga0466963_0002114
357 Ga0466963_0232180
358 Ga0466971_0018061
359 Ga0466971_0114550
360 Ga0466968_0033649
361 Ga0466968_0086154
362 Ga0466968_0101316
363 Ga0466970_0014762
364 Ga0466970_0021653
365 Ga0466957_0001094
366 Ga0466957_0081556
367 Ga0466960_0011191
368 Ga0466960_0012487
369 Ga0466959_0001376
370 Ga0466959_0002900
371 Ga0466959_0023293
372 Ga0466959_0096072
373 Ga0466958_0001494
374 Ga0466958_0008679
375 Ga0466958_0014079
376 Ga0466958_0021888
377 Ga0466958_0080336
378 Ga0466958_0124502
379 Ga0466967_0000629
380 Ga0466967_0001313
381 Ga0466967_0005653
382 Ga0466967_0173691
383 Ga0466967_0261127
384 Ga0466967_0589392
385 Ga0466967_0674066
386 Ga0466967_0924258
387 Ga0495651_0494586
388 Ga0495628_0012671
389 Ga0495652_0187188
390 Ga0495652_0240117
391 Ga0495623_0036637
392 Ga0495646_0193101
393 Ga0495680_0277506
394 Ga0495602_0280021
395 Ga0496101_0128861
396 Ga0496102_0015267
397 Ga0496103_0066262
398 Ga0496104_0010409
399 Ga0496105_0074460
400 Ga0496106_0329142
401 Ga0496107_0128638
402 Ga0496108_0016253
403 Ga0496109_0002002
404 Ga0496110_0000362
405 Ga0496111_0362570
406 Ga0501031_0011430
407 Ga0501033_0060573
408 Ga0501036_0018418
409 Ga0501037_0118592
410 Ga0501040_0039402
411 Ga0501041_0009268
412 Ga0501042_0015450
413 Ga0501043_0178757
414 Ga0501046_0022006
415 Ga0501068_0024822
416 Ga0501071_0001383
417 Ga0501072_0011173
418 Ga0501075_0010167
419 Ga0501076_0005623
420 Ga0501081_0050589
421 Ga0501035_0455275
422 Ga0501045_0014415
423 nmdc:mga08y16_265985_c1
424 nmdc:mga0n895_2358_c1
425 nmdc:mga0rr50_127014_c1
426 nmdc:mga0a205_9156_c1
427 Ga0495601_0001404
428 Ga0501084_0013650
429 Ga0501082_0007184
430 2558911488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

46

261

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9505 16 247
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9342 16 247
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9183 14 248
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9023 14 248
4hcj-assembly1.cif.gz_A crystal structure of thij/pfpi domain protein from brachyspira murdochii 0.8803 14 248
ID Description Score Start End Superfamily
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9502 16 247 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9338 16 247 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.924 17 245 3.40.50.880
1u9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9167 14 248 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9121 17 245 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A355EU82-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9902 13 138 GO:0016740
AF-A0A6J4U423-F1-model_v4 Intracellular protease 0.9869 43 249 GO:0005737
GO:0006508
GO:0008233
GO:0019172
GO:0019243
AF-A0A7Y8M1T9-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9857 14 192 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-B0C7N2-F1-model_v4 DJ-1/PfpI family protein 0.9832 14 248 GO:0005737
GO:0019172
GO:0019243
AF-V7FN47-F1-model_v4 Thimanine synthesis protein ThiJ 0.9831 14 249 GO:0005737
GO:0019172
GO:0019243

Map