F326474

General Info

Members Datasets Scaffolds Average Seq Length
215 179 430 140

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10025698|Ga0213875_100256984
Length 152
Sequence MRAVVQRVTEASVTVDGETVGKITSSGLCVLVGVTHDDTPEKAAALARKLWSLRIFKNPHSKDQDSPGGEQSCSDIAAPLLVISQFTLYGDARKGRRPTWNAAAPGPVAEPLVEEVVAQLRALGAHVETGRFGAQMQVSLTNDGPFTVLLEI

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
45 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
46 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
51 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
52 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
58 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
59 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
60 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
61 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
85 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
145 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
146 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
147 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
148 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
151 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
152 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
155 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
156 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
157 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
160 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
164 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
165 2643221670 Streptomyces sp. Root431 Isolate Unclassified
166 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
167 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
168 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
169 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
170 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
171 2867475112 Streptomyces sp. TM32 Isolate Unclassified
172 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
173 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
174 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
175 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
176 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
177 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
178 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
179 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0
Isolates 7.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.91
Nodule 0
Rhizoplane 13.49
Rhizosphere 68.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10025698 3300021388 Bacteria 2804
2 Ga0070683_101279008 3300005329 Bacteria 705
3 Ga0068868_102182568 3300005338 Bacteria 527
4 Ga0070668_101287192 3300005347 Bacteria 664
5 Ga0070659_100412289 3300005366 Bacteria 1142
6 Ga0070667_100000840 3300005367 Bacteria 28497
7 Ga0070662_101279759 3300005457 Bacteria 631
8 Ga0068867_100321106 3300005459 Bacteria 1283
9 Ga0070685_10712394 3300005466 Bacteria 733
10 Ga0070684_100047079 3300005535 Bacteria 3737
11 Ga0068853_100578785 3300005539 Bacteria 1065
12 Ga0068855_101983650 3300005563 Bacteria 588
13 Ga0068852_100332688 3300005616 Bacteria 1478
14 Ga0068866_10332933 3300005718 Bacteria 959
15 Ga0068860_100180849 3300005843 Bacteria 2038
16 Ga0068860_100883796 3300005843 Bacteria 909
17 Ga0105245_10088815 3300009098 Bacteria 2840
18 Ga0105247_10226073 3300009101 Bacteria 1269
19 Ga0105248_10295358 3300009177 Bacteria 1824
20 Ga0105237_11262266 3300009545 Bacteria 745
21 Ga0105238_10294330 3300009551 Bacteria 1606
22 Ga0105238_10668838 3300009551 Bacteria 1049
23 Ga0105249_10197398 3300009553 Bacteria 1967
24 Ga0105249_11241354 3300009553 Bacteria 816
25 Ga0105249_11383389 3300009553 Bacteria 776
26 Ga0105239_12876939 3300010375 Bacteria 562
27 Ga0105246_10445279 3300011119 Bacteria 1087
28 Ga0157369_10112655 3300013105 Bacteria 2890
29 Ga0157372_10413300 3300013307 Bacteria 1572
30 Ga0157372_10923638 3300013307 Bacteria 1012
31 Ga0157372_11396592 3300013307 Bacteria 807
32 Ga0157375_10096992 3300013308 Bacteria 3022
33 Ga0157375_10475981 3300013308 Bacteria 1414
34 Ga0157375_10863802 3300013308 Bacteria 1051
35 Ga0163163_10298694 3300014325 Bacteria 1663
36 Ga0157380_10166767 3300014326 Bacteria 1920
37 Ga0182008_10104914 3300014497 Bacteria 1398
38 Ga0207642_10517200 3300025899 Bacteria 733
39 Ga0207652_10707145 3300025921 Bacteria 899
40 Ga0207652_11232012 3300025921 Bacteria 650
41 Ga0207686_11271916 3300025934 Bacteria 603
42 Ga0207651_11364427 3300025960 Bacteria 638
43 Ga0207712_10791731 3300025961 Bacteria 833
44 Ga0207640_10454753 3300025981 Bacteria 1056
45 Ga0207658_10001083 3300025986 Bacteria 22062
46 Ga0207676_10325971 3300026095 Bacteria 1412
47 Ga0207675_101339950 3300026118 Bacteria 736
48 Ga0207698_10383279 3300026142 Bacteria 1338
49 Ga0268266_10430185 3300028379 Bacteria 1252
50 Ga0268264_10396921 3300028381 Bacteria 1324
51 Ga0307517_10066520 3300028786 Bacteria 3314
52 Ga0307508_10206622 3300031616 Bacteria 1564
53 Ga0307514_10186601 3300031649 Bacteria 1328
54 Ga0316579_10003551 3300031691 Bacteria 6103
55 Ga0316578_10025293 3300031728 Bacteria 3336
56 Ga0307516_10070273 3300031730 Bacteria 3365
57 Ga0316577_10007430 3300031733 Bacteria 5848
58 Ga0307409_100209133 3300031995 Bacteria 1752
59 Ga0307411_10260217 3300032005 Bacteria 1370
60 Ga0316585_10021439 3300032137 Bacteria 1984
61 Ga0316580_10023657 3300032139 Bacteria 1898
62 Ga0316574_0035508 3300035398 Bacteria 3047
63 Ga0316584_0104949 3300036712 Bacteria 2114
64 Ga0395905_0333660 3300037471 Bacteria 1407
65 Ga0436364_1516570 3300037853 Bacteria 2932
66 Ga0451793_1172451 3300041452 Bacteria 743
67 Ga0451797_0196194 3300041453 Bacteria 870
68 Ga0451853_2998127 3300041512 Bacteria 1520
69 Ga0439446_0098653 3300042156 Bacteria 922
70 Ga0439446_0329384 3300042156 Bacteria 541
71 Ga0466969_0270594 3300044656 Bacteria 769
72 Ga0466966_0426016 3300044684 Bacteria 797
73 Ga0466961_0134781 3300044693 Bacteria 1547
74 Ga0466963_0143507 3300044694 Bacteria 1655
75 Ga0466963_0216195 3300044694 Bacteria 1342
76 Ga0466971_0145580 3300044719 Bacteria 1104
77 Ga0466970_0194066 3300044765 Bacteria 1129
78 Ga0466960_0054547 3300044901 Bacteria 1941
79 Ga0466960_0339337 3300044901 Bacteria 855
80 Ga0466959_0118012 3300045049 Bacteria 1888
81 Ga0466967_0632059 3300045976 Bacteria 1058
82 Ga0495627_096448 3300046453 Bacteria 847
83 Ga0495592_0015509 3300046454 Bacteria 5782
84 Ga0495629_0464024 3300046459 Bacteria 857
85 Ga0495629_1032025 3300046459 Bacteria 534
86 Ga0495638_0003924 3300046460 Bacteria 11491
87 Ga0495638_0070167 3300046460 Bacteria 2146
88 Ga0495651_0087822 3300046462 Bacteria 2337
89 Ga0495653_0007500 3300046463 Bacteria 8921
90 Ga0495653_0049941 3300046463 Bacteria 3219
91 Ga0495580_0037077 3300046472 Bacteria 3500
92 Ga0495662_0011121 3300046476 Bacteria 4397
93 Ga0495664_0005267 3300046477 Bacteria 7098
94 Ga0495585_0023101 3300046492 Bacteria 3569
95 Ga0495608_0000757 3300046511 Bacteria 22606
96 Ga0495608_0464439 3300046511 Bacteria 769
97 Ga0495610_0162746 3300046512 Bacteria 942
98 Ga0495628_0040683 3300046516 Bacteria 3712
99 Ga0495630_0038539 3300046517 Bacteria 3574
100 Ga0495643_0011931 3300046522 Bacteria 5263
101 Ga0495666_0001361 3300046526 Bacteria 11840
102 Ga0495652_0025662 3300046529 Bacteria 5209
103 Ga0495665_0002446 3300046531 Bacteria 10027
104 Ga0495640_0084730 3300046533 Bacteria 2101
105 Ga0495640_0164144 3300046533 Bacteria 1422
106 Ga0495586_0007769 3300046535 Bacteria 5718
107 Ga0495587_0018866 3300046536 Bacteria 4275
108 Ga0495597_0080055 3300046542 Bacteria 1398
109 Ga0495645_0013430 3300046543 Bacteria 5789
110 Ga0495645_0014278 3300046543 Bacteria 5631
111 Ga0495645_0975059 3300046543 Bacteria 500
112 Ga0495667_0004012 3300046559 Bacteria 9889
113 Ga0495634_0026037 3300046642 Bacteria 4085
114 Ga0495611_0492171 3300046648 Bacteria 557
115 Ga0495635_0067056 3300046663 Bacteria 2461
116 Ga0495661_0247978 3300046665 Bacteria 910
117 Ga0495657_0019389 3300046675 Bacteria 4906
118 Ga0495623_0013109 3300046679 Bacteria 5373
119 Ga0495646_0025130 3300046680 Bacteria 3747
120 Ga0495613_0009861 3300046689 Bacteria 7102
121 Ga0495670_0187760 3300046691 Bacteria 1092
122 Ga0495589_0076883 3300046794 Bacteria 1627
123 Ga0495600_0302622 3300046809 Bacteria 1008
124 Ga0495660_0136283 3300046810 Bacteria 1226
125 Ga0495581_0068457 3300047315 Bacteria 2052
126 Ga0495604_0001436 3300047317 Bacteria 19549
127 Ga0495636_0524361 3300047318 Bacteria 574
128 Ga0495674_0121074 3300047319 Bacteria 2210
129 Ga0495687_050750 3300047443 Bacteria 1765
130 Ga0495675_0004791 3300047444 Bacteria 8222
131 Ga0495675_0039772 3300047444 Bacteria 2995
132 Ga0495685_000371 3300047447 Bacteria 14362
133 Ga0495684_0185460 3300047471 Bacteria 1540
134 Ga0495602_0053440 3300048088 Bacteria 3577
135 Ga0496101_0645069 3300048904 Bacteria 837
136 Ga0496102_0036577 3300048905 Bacteria 4423
137 Ga0496102_0049641 3300048905 Bacteria 3818
138 Ga0496103_0000228 3300048906 Bacteria 54634
139 Ga0496103_0869786 3300048906 Bacteria 566
140 Ga0496104_0128169 3300048907 Bacteria 2437
141 Ga0496104_0164890 3300048907 Bacteria 2125
142 Ga0496105_0235827 3300048908 Bacteria 1486
143 Ga0496105_0483553 3300048908 Bacteria 974
144 Ga0496108_0416618 3300048911 Bacteria 1173
145 Ga0496108_0453163 3300048911 Bacteria 1121
146 Ga0496108_0724215 3300048911 Bacteria 862
147 Ga0496108_0815815 3300048911 Bacteria 804
148 Ga0496109_0314443 3300048912 Bacteria 1478
149 Ga0496109_0443154 3300048912 Bacteria 1227
150 Ga0496109_0489344 3300048912 Bacteria 1161
151 Ga0496110_0073590 3300048913 Bacteria 3032
152 Ga0496111_0357193 3300048914 Bacteria 1081
153 Ga0496112_0389673 3300048915 Bacteria 1334
154 Ga0496113_0796841 3300048916 Bacteria 751
155 Ga0496114_0044913 3300048917 Bacteria 3668
156 Ga0496114_0052324 3300048917 Bacteria 3402
157 Ga0496114_0091783 3300048917 Bacteria 2579
158 Ga0496114_0160248 3300048917 Bacteria 1956
159 Ga0496114_0256992 3300048917 Bacteria 1537
160 Ga0496114_0522431 3300048917 Bacteria 1050
161 Ga0496115_0559473 3300048918 Bacteria 913
162 Ga0496118_0001227 3300048921 Bacteria 39393
163 Ga0496119_0001211 3300048922 Bacteria 32228
164 Ga0496122_0001313 3300048925 Bacteria 40783
165 Ga0496125_0000212 3300048928 Bacteria 120753
166 Ga0496126_0000039 3300048929 Bacteria 347353
167 Ga0501034_0026275 3300049571 Bacteria 5929
168 Ga0501034_0468226 3300049571 Bacteria 1176
169 Ga0501039_0489260 3300049575 Bacteria 966
170 Ga0501041_0197467 3300049577 Bacteria 1261
171 Ga0501042_0440584 3300049578 Bacteria 945
172 Ga0501046_0017749 3300049580 Bacteria 5936
173 Ga0501048_0236247 3300049582 Bacteria 1297
174 Ga0501073_0022204 3300049589 Bacteria 4573
175 Ga0501035_0021531 3300049822 Bacteria 5927
176 Ga0501045_0214858 3300049824 Bacteria 1432
177 Ga0495601_0060305 3300053077 Bacteria 2407
178 Ga0495619_0024807 3300053085 Bacteria 3847
179 Ga0495619_0478157 3300053085 Bacteria 858
180 Ga0500578_0004410 3300053086 Bacteria 9917
181 Ga0500566_0210154 3300053094 Bacteria 975
182 Ga0500641_0051076 3300053096 Bacteria 1701
183 Ga0500654_041949 3300053099 Bacteria 2585
184 Ga0500553_039651 3300053101 Bacteria 2315
185 Ga0500556_0034372 3300053104 Bacteria 1744
186 Ga0500569_121542 3300053109 Bacteria 869
187 Ga0500628_006339 3300053129 Bacteria 1999
188 Ga0500652_002750 3300053131 Bacteria 5308
189 Ga0500658_0067935 3300053134 Bacteria 1497
190 Ga0500573_0217626 3300053140 Bacteria 1004
191 Ga0500577_0196308 3300053142 Bacteria 870
192 Ga0500579_064927 3300053143 Bacteria 2143
193 Ga0500588_0318430 3300053146 Bacteria 590
194 Ga0500616_0116498 3300053153 Bacteria 1282
195 Ga0500656_005233 3300053732 Bacteria 1276
196 Ga0500587_002921 3300053739 Bacteria 2420
197 Ga0501082_0116250 3300060353 Bacteria 2316
198 Ga0466962_0010230 3300061719 Bacteria 4505
199 Ga0530510_0801968 3300061734 Bacteria 718
200 2643942443 2643221587 Bacteria 7586415
201 2644390066 2643221670 Bacteria 6497041
202 2644429524 2643221677 Bacteria 7584031
203 2753035636 2751185725 Bacteria 5740550
204 2753326338 2751185792 Bacteria 5739090
205 2799185859 2799112218 Bacteria 4315149
206 2862179336 2862178590 Bacteria 8583590
207 2867477222 2867475112 Bacteria 6909112
208 2868093497 2868088558 Bacteria 7609351
209 2884997015 2884994152 Bacteria 4492978
210 2918505413 2918501144 Bacteria 8668083
211 2929216325 2929212328 Bacteria 7708288
212 2935393268 2935390628 Bacteria 7043367
213 2946049837 2946045630 Bacteria 8527308
214 2995465984 2995463766 Bacteria 8577691
215 2997457680 2997451912 Bacteria 8492419
216 Ga0213875_10025698
217 Ga0070683_101279008
218 Ga0068868_102182568
219 Ga0070668_101287192
220 Ga0070659_100412289
221 Ga0070667_100000840
222 Ga0070662_101279759
223 Ga0068867_100321106
224 Ga0070685_10712394
225 Ga0070684_100047079
226 Ga0068853_100578785
227 Ga0068855_101983650
228 Ga0068852_100332688
229 Ga0068866_10332933
230 Ga0068860_100180849
231 Ga0068860_100883796
232 Ga0105245_10088815
233 Ga0105247_10226073
234 Ga0105248_10295358
235 Ga0105237_11262266
236 Ga0105238_10294330
237 Ga0105238_10668838
238 Ga0105249_10197398
239 Ga0105249_11241354
240 Ga0105249_11383389
241 Ga0105239_12876939
242 Ga0105246_10445279
243 Ga0157369_10112655
244 Ga0157372_10413300
245 Ga0157372_10923638
246 Ga0157372_11396592
247 Ga0157375_10096992
248 Ga0157375_10475981
249 Ga0157375_10863802
250 Ga0163163_10298694
251 Ga0157380_10166767
252 Ga0182008_10104914
253 Ga0207642_10517200
254 Ga0207652_10707145
255 Ga0207652_11232012
256 Ga0207686_11271916
257 Ga0207651_11364427
258 Ga0207712_10791731
259 Ga0207640_10454753
260 Ga0207658_10001083
261 Ga0207676_10325971
262 Ga0207675_101339950
263 Ga0207698_10383279
264 Ga0268266_10430185
265 Ga0268264_10396921
266 Ga0307517_10066520
267 Ga0307508_10206622
268 Ga0307514_10186601
269 Ga0316579_10003551
270 Ga0316578_10025293
271 Ga0307516_10070273
272 Ga0316577_10007430
273 Ga0307409_100209133
274 Ga0307411_10260217
275 Ga0316585_10021439
276 Ga0316580_10023657
277 Ga0316574_0035508
278 Ga0316584_0104949
279 Ga0395905_0333660
280 Ga0436364_1516570
281 Ga0451793_1172451
282 Ga0451797_0196194
283 Ga0451853_2998127
284 Ga0439446_0098653
285 Ga0439446_0329384
286 Ga0466969_0270594
287 Ga0466966_0426016
288 Ga0466961_0134781
289 Ga0466963_0143507
290 Ga0466963_0216195
291 Ga0466971_0145580
292 Ga0466970_0194066
293 Ga0466960_0054547
294 Ga0466960_0339337
295 Ga0466959_0118012
296 Ga0466967_0632059
297 Ga0495627_096448
298 Ga0495592_0015509
299 Ga0495629_0464024
300 Ga0495629_1032025
301 Ga0495638_0003924
302 Ga0495638_0070167
303 Ga0495651_0087822
304 Ga0495653_0007500
305 Ga0495653_0049941
306 Ga0495580_0037077
307 Ga0495662_0011121
308 Ga0495664_0005267
309 Ga0495585_0023101
310 Ga0495608_0000757
311 Ga0495608_0464439
312 Ga0495610_0162746
313 Ga0495628_0040683
314 Ga0495630_0038539
315 Ga0495643_0011931
316 Ga0495666_0001361
317 Ga0495652_0025662
318 Ga0495665_0002446
319 Ga0495640_0084730
320 Ga0495640_0164144
321 Ga0495586_0007769
322 Ga0495587_0018866
323 Ga0495597_0080055
324 Ga0495645_0013430
325 Ga0495645_0014278
326 Ga0495645_0975059
327 Ga0495667_0004012
328 Ga0495634_0026037
329 Ga0495611_0492171
330 Ga0495635_0067056
331 Ga0495661_0247978
332 Ga0495657_0019389
333 Ga0495623_0013109
334 Ga0495646_0025130
335 Ga0495613_0009861
336 Ga0495670_0187760
337 Ga0495589_0076883
338 Ga0495600_0302622
339 Ga0495660_0136283
340 Ga0495581_0068457
341 Ga0495604_0001436
342 Ga0495636_0524361
343 Ga0495674_0121074
344 Ga0495687_050750
345 Ga0495675_0004791
346 Ga0495675_0039772
347 Ga0495685_000371
348 Ga0495684_0185460
349 Ga0495602_0053440
350 Ga0496101_0645069
351 Ga0496102_0036577
352 Ga0496102_0049641
353 Ga0496103_0000228
354 Ga0496103_0869786
355 Ga0496104_0128169
356 Ga0496104_0164890
357 Ga0496105_0235827
358 Ga0496105_0483553
359 Ga0496108_0416618
360 Ga0496108_0453163
361 Ga0496108_0724215
362 Ga0496108_0815815
363 Ga0496109_0314443
364 Ga0496109_0443154
365 Ga0496109_0489344
366 Ga0496110_0073590
367 Ga0496111_0357193
368 Ga0496112_0389673
369 Ga0496113_0796841
370 Ga0496114_0044913
371 Ga0496114_0052324
372 Ga0496114_0091783
373 Ga0496114_0160248
374 Ga0496114_0256992
375 Ga0496114_0522431
376 Ga0496115_0559473
377 Ga0496118_0001227
378 Ga0496119_0001211
379 Ga0496122_0001313
380 Ga0496125_0000212
381 Ga0496126_0000039
382 Ga0501034_0026275
383 Ga0501034_0468226
384 Ga0501039_0489260
385 Ga0501041_0197467
386 Ga0501042_0440584
387 Ga0501046_0017749
388 Ga0501048_0236247
389 Ga0501073_0022204
390 Ga0501035_0021531
391 Ga0501045_0214858
392 Ga0495601_0060305
393 Ga0495619_0024807
394 Ga0495619_0478157
395 Ga0500578_0004410
396 Ga0500566_0210154
397 Ga0500641_0051076
398 Ga0500654_041949
399 Ga0500553_039651
400 Ga0500556_0034372
401 Ga0500569_121542
402 Ga0500628_006339
403 Ga0500652_002750
404 Ga0500658_0067935
405 Ga0500573_0217626
406 Ga0500577_0196308
407 Ga0500579_064927
408 Ga0500588_0318430
409 Ga0500616_0116498
410 Ga0500656_005233
411 Ga0500587_002921
412 Ga0501082_0116250
413 Ga0466962_0010230
414 Ga0530510_0801968
415 2643942443
416 2644390066
417 2644429524
418 2753035636
419 2753326338
420 2799185859
421 2862179336
422 2867477222
423 2868093497
424 2884997015
425 2918505413
426 2929216325
427 2935393268
428 2946049837
429 2995465984
430 2997457680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

2

151

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9358 1 141
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.93 1 139
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9277 1 140
3knf-assembly2.cif.gz_C crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum 0.925 1 140
3kod-assembly3.cif.gz_F dtd from plasmodium falciparum in complex with d-serine 0.9241 1 140
ID Description Score Start End Superfamily
af_P9WNS9_1_143_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9652 1 140 3.50.80.10
af_P9WNS9_1_143_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9453 1 140 3.50.80.10
af_Q5AEI9_1_136_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9365 30 141 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9358 1 141 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9283 1 140 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A6N9VIG3-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9839 29 94 GO:0005737
GO:0051500
AF-A0A2W4LF39-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9795 1 106 GO:0005737
GO:0051500
AF-A0A7G1NGN5-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9789 2 139 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1D8G2K8-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9786 2 140 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A6I4MPF9-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9782 1 140 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Map