F326109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 215 | 122 | 215 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10000149|Ga0070709_1000014924 |
| Length | 176 |
| Sequence | MILGMSTATFTALHVLISLVGIGSGLVVMYGFFNANRMDRWTQLFLATTALTSLTGFLFPNEHITPGIVIGILSMIILAVAAGTRYGLRMRGVWRPAYVISASIALYFNVFVFVVQSFEKVPALRALAPTQKEPPFAITQLLVLILFVVVTVFAVKRFRPDMAAAASDLANEKRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 45 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 46 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 66 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 116 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 117 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 119 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 120 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 121 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 122 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.65 |
| Rhizosphere | 94.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10159805 | 3300005290 | Unclassified | 1310 |
| 2 | Ga0065715_10189438 | 3300005293 | Unclassified | 1424 |
| 3 | Ga0070690_100122995 | 3300005330 | Bacteria | 1744 |
| 4 | Ga0070670_100045911 | 3300005331 | Bacteria | 3756 |
| 5 | Ga0070677_10017986 | 3300005333 | Unclassified | 2540 |
| 6 | Ga0070666_10258664 | 3300005335 | Unclassified | 1234 |
| 7 | Ga0068868_100026695 | 3300005338 | Bacteria | 4403 |
| 8 | Ga0070668_100221979 | 3300005347 | Bacteria | 1559 |
| 9 | Ga0070669_100095760 | 3300005353 | Bacteria | 2233 |
| 10 | Ga0070674_100003915 | 3300005356 | Bacteria | 8432 |
| 11 | Ga0070673_100049182 | 3300005364 | Bacteria | 3291 |
| 12 | Ga0070667_100408539 | 3300005367 | Unclassified | 1236 |
| 13 | Ga0070703_10211795 | 3300005406 | Unclassified | 766 |
| 14 | Ga0070709_10000149 | 3300005434 | Bacteria | 45901 |
| 15 | Ga0070709_10075481 | 3300005434 | Bacteria | 2187 |
| 16 | Ga0070714_100386337 | 3300005435 | Unclassified | 1320 |
| 17 | Ga0070714_100636026 | 3300005435 | Unclassified | 1026 |
| 18 | Ga0070713_100000326 | 3300005436 | Bacteria | 31172 |
| 19 | Ga0070713_100037605 | 3300005436 | Bacteria | 3914 |
| 20 | Ga0070713_100371980 | 3300005436 | Unclassified | 1330 |
| 21 | Ga0070713_100514458 | 3300005436 | Unclassified | 1131 |
| 22 | Ga0070713_101032727 | 3300005436 | Bacteria | 793 |
| 23 | Ga0070710_10046140 | 3300005437 | Bacteria | 2425 |
| 24 | Ga0070710_10132939 | 3300005437 | Unclassified | 1518 |
| 25 | Ga0070710_10389008 | 3300005437 | Bacteria | 932 |
| 26 | Ga0070711_100075033 | 3300005439 | Bacteria | 2393 |
| 27 | Ga0070711_100084865 | 3300005439 | Bacteria | 2266 |
| 28 | Ga0070711_100212305 | 3300005439 | Bacteria | 1500 |
| 29 | Ga0070708_100042318 | 3300005445 | Bacteria | 3998 |
| 30 | Ga0070708_100042563 | 3300005445 | Bacteria | 3987 |
| 31 | Ga0070708_100297782 | 3300005445 | Unclassified | 1519 |
| 32 | Ga0070708_100303286 | 3300005445 | Unclassified | 1504 |
| 33 | Ga0070708_100377028 | 3300005445 | Bacteria | 1337 |
| 34 | Ga0070708_101126357 | 3300005445 | Bacteria | 735 |
| 35 | Ga0070663_100546717 | 3300005455 | Bacteria | 967 |
| 36 | Ga0070681_10442817 | 3300005458 | Bacteria | 1211 |
| 37 | Ga0070681_10484635 | 3300005458 | Bacteria | 1149 |
| 38 | Ga0068867_100786207 | 3300005459 | Unclassified | 847 |
| 39 | Ga0070706_100008279 | 3300005467 | Bacteria | 9692 |
| 40 | Ga0070706_100024445 | 3300005467 | Bacteria | 5561 |
| 41 | Ga0070706_100028529 | 3300005467 | Bacteria | 5138 |
| 42 | Ga0070706_100292918 | 3300005467 | Bacteria | 1519 |
| 43 | Ga0070706_100301200 | 3300005467 | Bacteria | 1496 |
| 44 | Ga0070706_100402974 | 3300005467 | Bacteria | 1273 |
| 45 | Ga0070707_100027384 | 3300005468 | Bacteria | 5423 |
| 46 | Ga0070707_100039383 | 3300005468 | Bacteria | 4517 |
| 47 | Ga0070707_100070725 | 3300005468 | Bacteria | 3361 |
| 48 | Ga0070707_100197981 | 3300005468 | Bacteria | 1959 |
| 49 | Ga0070707_100255946 | 3300005468 | Bacteria | 1703 |
| 50 | Ga0070707_100514989 | 3300005468 | Bacteria | 1158 |
| 51 | Ga0070707_100736886 | 3300005468 | Bacteria | 949 |
| 52 | Ga0070707_100960594 | 3300005468 | Bacteria | 820 |
| 53 | Ga0070698_100106984 | 3300005471 | Bacteria | 2765 |
| 54 | Ga0070699_100017049 | 3300005518 | Bacteria | 6238 |
| 55 | Ga0070699_100076715 | 3300005518 | Bacteria | 2909 |
| 56 | Ga0070699_100148148 | 3300005518 | Bacteria | 2074 |
| 57 | Ga0070699_101049999 | 3300005518 | Unclassified | 747 |
| 58 | Ga0070679_100139491 | 3300005530 | Bacteria | 2405 |
| 59 | Ga0070697_100082325 | 3300005536 | Unclassified | 2653 |
| 60 | Ga0070697_100087633 | 3300005536 | Bacteria | 2570 |
| 61 | Ga0070697_100221021 | 3300005536 | Bacteria | 1614 |
| 62 | Ga0070697_100301427 | 3300005536 | Bacteria | 1377 |
| 63 | Ga0070697_100419572 | 3300005536 | Bacteria | 1163 |
| 64 | Ga0070697_100649811 | 3300005536 | Bacteria | 929 |
| 65 | Ga0070697_100951358 | 3300005536 | Unclassified | 763 |
| 66 | Ga0070697_101041197 | 3300005536 | Unclassified | 728 |
| 67 | Ga0070697_101046279 | 3300005536 | Bacteria | 726 |
| 68 | Ga0070695_101357618 | 3300005545 | Unclassified | 588 |
| 69 | Ga0070693_100484584 | 3300005547 | Bacteria | 874 |
| 70 | Ga0070665_100768903 | 3300005548 | Bacteria | 976 |
| 71 | Ga0068855_100672166 | 3300005563 | Bacteria | 1110 |
| 72 | Ga0068854_100275915 | 3300005578 | Bacteria | 1352 |
| 73 | Ga0068856_100154941 | 3300005614 | Bacteria | 2301 |
| 74 | Ga0068852_100568311 | 3300005616 | Bacteria | 1136 |
| 75 | Ga0068863_100144401 | 3300005841 | Bacteria | 2275 |
| 76 | Ga0068858_100009660 | 3300005842 | Bacteria | 9192 |
| 77 | Ga0068860_100058750 | 3300005843 | Bacteria | 3657 |
| 78 | Ga0070717_10044135 | 3300006028 | Bacteria | 3640 |
| 79 | Ga0070717_10080210 | 3300006028 | Unclassified | 2738 |
| 80 | Ga0070717_10113286 | 3300006028 | Unclassified | 2316 |
| 81 | Ga0070717_10183601 | 3300006028 | Unclassified | 1824 |
| 82 | Ga0070717_10233650 | 3300006028 | Bacteria | 1619 |
| 83 | Ga0070716_100019833 | 3300006173 | Bacteria | 3520 |
| 84 | Ga0070716_100033740 | 3300006173 | Unclassified | 2802 |
| 85 | Ga0070716_100790249 | 3300006173 | Unclassified | 734 |
| 86 | Ga0070712_100002081 | 3300006175 | Bacteria | 12287 |
| 87 | Ga0070712_100126858 | 3300006175 | Unclassified | 1928 |
| 88 | Ga0070712_100241116 | 3300006175 | Bacteria | 1440 |
| 89 | Ga0097621_100096180 | 3300006237 | Bacteria | 2485 |
| 90 | Ga0097621_101096397 | 3300006237 | Bacteria | 747 |
| 91 | Ga0075428_100246505 | 3300006844 | Bacteria | 1926 |
| 92 | Ga0099794_10177801 | 3300007265 | Bacteria | 1086 |
| 93 | Ga0099795_10290499 | 3300007788 | Bacteria | 716 |
| 94 | Ga0105250_10040666 | 3300009092 | Unclassified | 1864 |
| 95 | Ga0105240_10270061 | 3300009093 | Bacteria | 1958 |
| 96 | Ga0105245_10012414 | 3300009098 | Bacteria | 7414 |
| 97 | Ga0105247_10591279 | 3300009101 | Unclassified | 822 |
| 98 | Ga0114129_11339641 | 3300009147 | Bacteria | 886 |
| 99 | Ga0105243_10355058 | 3300009148 | Bacteria | 1347 |
| 100 | Ga0105241_10027308 | 3300009174 | Bacteria | 4250 |
| 101 | Ga0105237_10223963 | 3300009545 | Bacteria | 1881 |
| 102 | Ga0105246_10237276 | 3300011119 | Bacteria | 1439 |
| 103 | Ga0157373_10060266 | 3300013100 | Bacteria | 2689 |
| 104 | Ga0157371_10250924 | 3300013102 | Unclassified | 1274 |
| 105 | Ga0157370_10075850 | 3300013104 | Bacteria | 3169 |
| 106 | Ga0157369_10207051 | 3300013105 | Bacteria | 2057 |
| 107 | Ga0157369_11244138 | 3300013105 | Unclassified | 759 |
| 108 | Ga0157374_10061846 | 3300013296 | Bacteria | 3508 |
| 109 | Ga0157374_10146591 | 3300013296 | Bacteria | 2293 |
| 110 | Ga0157378_10119522 | 3300013297 | Bacteria | 2427 |
| 111 | Ga0157378_10344124 | 3300013297 | Unclassified | 1455 |
| 112 | Ga0157378_11420021 | 3300013297 | Bacteria | 737 |
| 113 | Ga0163162_10023228 | 3300013306 | Bacteria | 6117 |
| 114 | Ga0163162_10164906 | 3300013306 | Bacteria | 2339 |
| 115 | Ga0157372_10006381 | 3300013307 | Bacteria | 12546 |
| 116 | Ga0157372_10114746 | 3300013307 | Bacteria | 3088 |
| 117 | Ga0157372_10940352 | 3300013307 | Bacteria | 1002 |
| 118 | Ga0157375_10944308 | 3300013308 | Bacteria | 1004 |
| 119 | Ga0163161_10322073 | 3300017792 | Unclassified | 1222 |
| 120 | Ga0213874_10008040 | 3300021377 | Bacteria | 2556 |
| 121 | Ga0207682_10148250 | 3300025893 | Bacteria | 1057 |
| 122 | Ga0207692_10059057 | 3300025898 | Bacteria | 1979 |
| 123 | Ga0207692_10060574 | 3300025898 | Bacteria | 1958 |
| 124 | Ga0207692_10068993 | 3300025898 | Unclassified | 1856 |
| 125 | Ga0207710_10261991 | 3300025900 | Unclassified | 866 |
| 126 | Ga0207680_10099858 | 3300025903 | Bacteria | 1863 |
| 127 | Ga0207685_10120754 | 3300025905 | Unclassified | 1150 |
| 128 | Ga0207699_10003600 | 3300025906 | Bacteria | 7404 |
| 129 | Ga0207699_10086282 | 3300025906 | Bacteria | 1960 |
| 130 | Ga0207699_10333842 | 3300025906 | Bacteria | 1066 |
| 131 | Ga0207699_10484079 | 3300025906 | Unclassified | 891 |
| 132 | Ga0207684_10011061 | 3300025910 | Bacteria | 7903 |
| 133 | Ga0207684_10013620 | 3300025910 | Bacteria | 7028 |
| 134 | Ga0207684_10137845 | 3300025910 | Bacteria | 2096 |
| 135 | Ga0207684_10199450 | 3300025910 | Unclassified | 1726 |
| 136 | Ga0207684_10329067 | 3300025910 | Bacteria | 1316 |
| 137 | Ga0207684_10353504 | 3300025910 | Bacteria | 1265 |
| 138 | Ga0207684_10374465 | 3300025910 | Unclassified | 1225 |
| 139 | Ga0207654_10008603 | 3300025911 | Bacteria | 5169 |
| 140 | Ga0207695_10185510 | 3300025913 | Bacteria | 1999 |
| 141 | Ga0207671_10473845 | 3300025914 | Bacteria | 998 |
| 142 | Ga0207693_10000089 | 3300025915 | Bacteria | 81143 |
| 143 | Ga0207693_10102256 | 3300025915 | Bacteria | 2247 |
| 144 | Ga0207693_10268132 | 3300025915 | Unclassified | 1338 |
| 145 | Ga0207693_10303995 | 3300025915 | Unclassified | 1249 |
| 146 | Ga0207693_10456466 | 3300025915 | Unclassified | 998 |
| 147 | Ga0207663_10030702 | 3300025916 | Bacteria | 3172 |
| 148 | Ga0207663_10163699 | 3300025916 | Bacteria | 1573 |
| 149 | Ga0207663_10178655 | 3300025916 | Bacteria | 1514 |
| 150 | Ga0207646_10034549 | 3300025922 | Bacteria | 4569 |
| 151 | Ga0207646_10064631 | 3300025922 | Bacteria | 3266 |
| 152 | Ga0207646_10071236 | 3300025922 | Bacteria | 3105 |
| 153 | Ga0207646_10179290 | 3300025922 | Bacteria | 1913 |
| 154 | Ga0207646_10181279 | 3300025922 | Bacteria | 1902 |
| 155 | Ga0207646_10545358 | 3300025922 | Bacteria | 1043 |
| 156 | Ga0207687_10065268 | 3300025927 | Bacteria | 2584 |
| 157 | Ga0207700_10000507 | 3300025928 | Bacteria | 22859 |
| 158 | Ga0207700_10263179 | 3300025928 | Unclassified | 1477 |
| 159 | Ga0207700_10447925 | 3300025928 | Unclassified | 1137 |
| 160 | Ga0207700_10851054 | 3300025928 | Unclassified | 816 |
| 161 | Ga0207700_11016918 | 3300025928 | Bacteria | 742 |
| 162 | Ga0207664_10149105 | 3300025929 | Bacteria | 1986 |
| 163 | Ga0207664_10367347 | 3300025929 | Unclassified | 1276 |
| 164 | Ga0207665_10064584 | 3300025939 | Unclassified | 2487 |
| 165 | Ga0207665_10088781 | 3300025939 | Unclassified | 2140 |
| 166 | Ga0207665_10128227 | 3300025939 | Bacteria | 1798 |
| 167 | Ga0207665_10192947 | 3300025939 | Unclassified | 1481 |
| 168 | Ga0207661_10660376 | 3300025944 | Bacteria | 961 |
| 169 | Ga0207667_10241454 | 3300025949 | Bacteria | 1848 |
| 170 | Ga0207667_11277682 | 3300025949 | Bacteria | 711 |
| 171 | Ga0207712_10181407 | 3300025961 | Bacteria | 1654 |
| 172 | Ga0207668_10182415 | 3300025972 | Bacteria | 1657 |
| 173 | Ga0207640_10335248 | 3300025981 | Bacteria | 1209 |
| 174 | Ga0207658_10170572 | 3300025986 | Unclassified | 1792 |
| 175 | Ga0207677_10065010 | 3300026023 | Bacteria | 2543 |
| 176 | Ga0207703_10005837 | 3300026035 | Bacteria | 9861 |
| 177 | Ga0207678_10317222 | 3300026067 | Unclassified | 1341 |
| 178 | Ga0207702_10035178 | 3300026078 | Bacteria | 4188 |
| 179 | Ga0207702_10125816 | 3300026078 | Bacteria | 2301 |
| 180 | Ga0207641_10338350 | 3300026088 | Bacteria | 1431 |
| 181 | Ga0209588_1044119 | 3300027671 | Unclassified | 1442 |
| 182 | Ga0268266_10530876 | 3300028379 | Unclassified | 1126 |
| 183 | Ga0268264_10080253 | 3300028381 | Bacteria | 2786 |
| 184 | Ga0265326_10035727 | 3300028558 | Unclassified | 1413 |
| 185 | Ga0265318_10025563 | 3300028577 | Bacteria | 2331 |
| 186 | Ga0265338_10000053 | 3300028800 | Bacteria | 208184 |
| 187 | Ga0265338_10000160 | 3300028800 | Bacteria | 122713 |
| 188 | Ga0265324_10000163 | 3300029957 | Bacteria | 51372 |
| 189 | Ga0265762_1018312 | 3300030760 | Bacteria | 1278 |
| 190 | Ga0265332_10176855 | 3300031238 | Bacteria | 890 |
| 191 | Ga0265328_10090631 | 3300031239 | Bacteria | 1129 |
| 192 | Ga0265320_10059235 | 3300031240 | Bacteria | 1832 |
| 193 | Ga0265339_10012521 | 3300031249 | Bacteria | 5176 |
| 194 | Ga0265331_10149699 | 3300031250 | Unclassified | 1060 |
| 195 | Ga0265313_10032112 | 3300031595 | Bacteria | 2685 |
| 196 | Ga0373942_0331888 | 3300035207 | Unclassified | 534 |
| 197 | Ga0373961_0274028 | 3300035241 | Unclassified | 617 |
| 198 | Ga0373931_0164943 | 3300035691 | Bacteria | 1301 |
| 199 | Ga0373935_0185018 | 3300035692 | Bacteria | 1432 |
| 200 | Ga0373925_0420625 | 3300037068 | Bacteria | 1092 |
| 201 | Ga0395900_1340497 | 3300037418 | Bacteria | 629 |
| 202 | Ga0395901_0641049 | 3300038443 | Bacteria | 1067 |
| 203 | Ga0395901_1349834 | 3300038443 | Unclassified | 673 |
| 204 | Ga0436363_1014330 | 3300039450 | Bacteria | 3352 |
| 205 | Ga0453683_0141165 | 3300044673 | Bacteria | 1520 |
| 206 | Ga0496100_1472554 | 3300048903 | Unclassified | 538 |
| 207 | Ga0496106_0306872 | 3300048909 | Unclassified | 1273 |
| 208 | Ga0496107_0501230 | 3300048910 | Unclassified | 901 |
| 209 | Ga0496110_0287684 | 3300048913 | Bacteria | 1497 |
| 210 | Ga0496112_0021456 | 3300048915 | Bacteria | 6143 |
| 211 | Ga0496112_0162604 | 3300048915 | Bacteria | 2199 |
| 212 | Ga0496112_0376506 | 3300048915 | Bacteria | 1361 |
| 213 | Ga0496115_0042340 | 3300048918 | Bacteria | 3628 |
| 214 | Ga0496115_0151073 | 3300048918 | Bacteria | 1918 |
| 215 | Ga0496115_0683931 | 3300048918 | Bacteria | 808 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_1349834 | Ga0395901_1349834_73_501 | 136 |
| 2 | 3300009545 | Ga0105237_10223963 | Ga0105237_102239632 | 137 |
| 3 | 3300035207 | Ga0373942_0331888 | Ga0373942_0331888_38_478 | 137 |
| 4 | 3300035241 | Ga0373961_0274028 | Ga0373961_0274028_66_506 | 137 |
| 5 | 3300009147 | Ga0114129_11339641 | Ga0114129_113396412 | 138 |
| 6 | 3300005467 | Ga0070706_100028529 | Ga0070706_1000285292 | 139 |
| 7 | 3300005468 | Ga0070707_100027384 | Ga0070707_1000273849 | 139 |
| 8 | 3300005471 | Ga0070698_100106984 | Ga0070698_1001069842 | 139 |
| 9 | 3300005518 | Ga0070699_100017049 | Ga0070699_1000170496 | 139 |
| 10 | 3300025910 | Ga0207684_10329067 | Ga0207684_103290672 | 139 |
| 11 | 3300025922 | Ga0207646_10064631 | Ga0207646_100646312 | 139 |
| 12 | 3300013105 | Ga0157369_11244138 | Ga0157369_112441382 | 141 |
| 13 | 3300005536 | Ga0070697_101046279 | Ga0070697_1010462792 | 149 |
| 14 | 3300005536 | Ga0070697_100649811 | Ga0070697_1006498111 | 150 |
| 15 | 3300048918 | Ga0496115_0042340 | Ga0496115_0042340_2136_2621 | 150 |
| 16 | 3300048918 | Ga0496115_0683931 | Ga0496115_0683931_10_504 | 153 |
| 17 | 3300005333 | Ga0070677_10017986 | Ga0070677_100179862 | 154 |
| 18 | 3300025893 | Ga0207682_10148250 | Ga0207682_101482502 | 154 |
| 19 | 3300025913 | Ga0207695_10185510 | Ga0207695_101855102 | 154 |
| 20 | 3300028577 | Ga0265318_10025563 | Ga0265318_100255634 | 154 |
| 21 | 3300031595 | Ga0265313_10032112 | Ga0265313_100321121 | 154 |
| 22 | 3300005547 | Ga0070693_100484584 | Ga0070693_1004845841 | 155 |
| 23 | 3300005364 | Ga0070673_100049182 | Ga0070673_1000491822 | 156 |
| 24 | 3300005436 | Ga0070713_100514458 | Ga0070713_1005144582 | 156 |
| 25 | 3300006028 | Ga0070717_10080210 | Ga0070717_100802102 | 156 |
| 26 | 3300006028 | Ga0070717_10183601 | Ga0070717_101836012 | 156 |
| 27 | 3300009093 | Ga0105240_10270061 | Ga0105240_102700614 | 156 |
| 28 | 3300013297 | Ga0157378_11420021 | Ga0157378_114200211 | 156 |
| 29 | 3300025928 | Ga0207700_10447925 | Ga0207700_104479252 | 156 |
| 30 | 3300025929 | Ga0207664_10149105 | Ga0207664_101491053 | 156 |
| 31 | 3300048915 | Ga0496112_0376506 | Ga0496112_0376506_847_1323 | 156 |
| 32 | 3300005536 | Ga0070697_100082325 | Ga0070697_1000823252 | 157 |
| 33 | 3300044673 | Ga0453683_0141165 | Ga0453683_0141165_856_1347 | 157 |
| 34 | 3300005331 | Ga0070670_100045911 | Ga0070670_1000459112 | 158 |
| 35 | 3300005338 | Ga0068868_100026695 | Ga0068868_1000266952 | 158 |
| 36 | 3300005842 | Ga0068858_100009660 | Ga0068858_1000096605 | 158 |
| 37 | 3300006844 | Ga0075428_100246505 | Ga0075428_1002465054 | 158 |
| 38 | 3300009101 | Ga0105247_10591279 | Ga0105247_105912792 | 158 |
| 39 | 3300021377 | Ga0213874_10008040 | Ga0213874_100080402 | 158 |
| 40 | 3300025900 | Ga0207710_10261991 | Ga0207710_102619912 | 158 |
| 41 | 3300026035 | Ga0207703_10005837 | Ga0207703_100058379 | 158 |
| 42 | 3300027671 | Ga0209588_1044119 | Ga0209588_10441192 | 158 |
| 43 | 3300028800 | Ga0265338_10000053 | Ga0265338_10000053138 | 158 |
| 44 | 3300029957 | Ga0265324_10000163 | Ga0265324_1000016337 | 158 |
| 45 | 3300031238 | Ga0265332_10176855 | Ga0265332_101768552 | 158 |
| 46 | 3300031239 | Ga0265328_10090631 | Ga0265328_100906312 | 158 |
| 47 | 3300031240 | Ga0265320_10059235 | Ga0265320_100592353 | 158 |
| 48 | 3300031249 | Ga0265339_10012521 | Ga0265339_100125212 | 158 |
| 49 | 3300039450 | Ga0436363_1014330 | Ga0436363_1014330_2344_2859 | 158 |
| 50 | 3300005436 | Ga0070713_100371980 | Ga0070713_1003719802 | 159 |
| 51 | 3300005437 | Ga0070710_10389008 | Ga0070710_103890082 | 159 |
| 52 | 3300005614 | Ga0068856_100154941 | Ga0068856_1001549412 | 159 |
| 53 | 3300025898 | Ga0207692_10059057 | Ga0207692_100590572 | 159 |
| 54 | 3300025928 | Ga0207700_10851054 | Ga0207700_108510541 | 159 |
| 55 | 3300026078 | Ga0207702_10125816 | Ga0207702_101258162 | 159 |
| 56 | 3300028558 | Ga0265326_10035727 | Ga0265326_100357271 | 159 |
| 57 | 3300028800 | Ga0265338_10000160 | Ga0265338_1000016012 | 159 |
| 58 | 3300031250 | Ga0265331_10149699 | Ga0265331_101496991 | 159 |
| 59 | 3300005293 | Ga0065715_10189438 | Ga0065715_101894382 | 160 |
| 60 | 3300005330 | Ga0070690_100122995 | Ga0070690_1001229955 | 160 |
| 61 | 3300005335 | Ga0070666_10258664 | Ga0070666_102586642 | 160 |
| 62 | 3300005347 | Ga0070668_100221979 | Ga0070668_1002219792 | 160 |
| 63 | 3300005353 | Ga0070669_100095760 | Ga0070669_1000957605 | 160 |
| 64 | 3300005356 | Ga0070674_100003915 | Ga0070674_1000039152 | 160 |
| 65 | 3300005367 | Ga0070667_100408539 | Ga0070667_1004085392 | 160 |
| 66 | 3300005406 | Ga0070703_10211795 | Ga0070703_102117951 | 160 |
| 67 | 3300005434 | Ga0070709_10000149 | Ga0070709_1000014924 | 160 |
| 68 | 3300005434 | Ga0070709_10075481 | Ga0070709_100754812 | 160 |
| 69 | 3300005435 | Ga0070714_100386337 | Ga0070714_1003863372 | 160 |
| 70 | 3300005435 | Ga0070714_100636026 | Ga0070714_1006360261 | 160 |
| 71 | 3300005436 | Ga0070713_100000326 | Ga0070713_10000032617 | 160 |
| 72 | 3300005436 | Ga0070713_100037605 | Ga0070713_1000376057 | 160 |
| 73 | 3300005436 | Ga0070713_101032727 | Ga0070713_1010327271 | 160 |
| 74 | 3300005437 | Ga0070710_10046140 | Ga0070710_100461403 | 160 |
| 75 | 3300005437 | Ga0070710_10132939 | Ga0070710_101329392 | 160 |
| 76 | 3300005439 | Ga0070711_100075033 | Ga0070711_1000750332 | 160 |
| 77 | 3300005439 | Ga0070711_100084865 | Ga0070711_1000848653 | 160 |
| 78 | 3300005439 | Ga0070711_100212305 | Ga0070711_1002123053 | 160 |
| 79 | 3300005445 | Ga0070708_100042318 | Ga0070708_1000423184 | 160 |
| 80 | 3300005445 | Ga0070708_100303286 | Ga0070708_1003032862 | 160 |
| 81 | 3300005445 | Ga0070708_100377028 | Ga0070708_1003770282 | 160 |
| 82 | 3300005445 | Ga0070708_101126357 | Ga0070708_1011263571 | 160 |
| 83 | 3300005455 | Ga0070663_100546717 | Ga0070663_1005467171 | 160 |
| 84 | 3300005458 | Ga0070681_10442817 | Ga0070681_104428172 | 160 |
| 85 | 3300005458 | Ga0070681_10484635 | Ga0070681_104846352 | 160 |
| 86 | 3300005459 | Ga0068867_100786207 | Ga0068867_1007862072 | 160 |
| 87 | 3300005467 | Ga0070706_100292918 | Ga0070706_1002929182 | 160 |
| 88 | 3300005467 | Ga0070706_100301200 | Ga0070706_1003012002 | 160 |
| 89 | 3300005467 | Ga0070706_100402974 | Ga0070706_1004029741 | 160 |
| 90 | 3300005468 | Ga0070707_100070725 | Ga0070707_1000707252 | 160 |
| 91 | 3300005468 | Ga0070707_100197981 | Ga0070707_1001979812 | 160 |
| 92 | 3300005468 | Ga0070707_100255946 | Ga0070707_1002559461 | 160 |
| 93 | 3300005468 | Ga0070707_100514989 | Ga0070707_1005149892 | 160 |
| 94 | 3300005468 | Ga0070707_100960594 | Ga0070707_1009605942 | 160 |
| 95 | 3300005518 | Ga0070699_100076715 | Ga0070699_1000767152 | 160 |
| 96 | 3300005518 | Ga0070699_100148148 | Ga0070699_1001481483 | 160 |
| 97 | 3300005530 | Ga0070679_100139491 | Ga0070679_1001394912 | 160 |
| 98 | 3300005536 | Ga0070697_100087633 | Ga0070697_1000876332 | 160 |
| 99 | 3300005536 | Ga0070697_100221021 | Ga0070697_1002210212 | 160 |
| 100 | 3300005536 | Ga0070697_100301427 | Ga0070697_1003014272 | 160 |
| 101 | 3300005536 | Ga0070697_101041197 | Ga0070697_1010411972 | 160 |
| 102 | 3300005545 | Ga0070695_101357618 | Ga0070695_1013576181 | 160 |
| 103 | 3300005548 | Ga0070665_100768903 | Ga0070665_1007689032 | 160 |
| 104 | 3300005563 | Ga0068855_100672166 | Ga0068855_1006721661 | 160 |
| 105 | 3300005578 | Ga0068854_100275915 | Ga0068854_1002759153 | 160 |
| 106 | 3300005616 | Ga0068852_100568311 | Ga0068852_1005683111 | 160 |
| 107 | 3300005841 | Ga0068863_100144401 | Ga0068863_1001444012 | 160 |
| 108 | 3300005843 | Ga0068860_100058750 | Ga0068860_1000587504 | 160 |
| 109 | 3300006028 | Ga0070717_10044135 | Ga0070717_100441352 | 160 |
| 110 | 3300006028 | Ga0070717_10113286 | Ga0070717_101132864 | 160 |
| 111 | 3300006173 | Ga0070716_100019833 | Ga0070716_1000198333 | 160 |
| 112 | 3300006173 | Ga0070716_100033740 | Ga0070716_1000337402 | 160 |
| 113 | 3300006175 | Ga0070712_100002081 | Ga0070712_1000020817 | 160 |
| 114 | 3300006175 | Ga0070712_100126858 | Ga0070712_1001268582 | 160 |
| 115 | 3300006175 | Ga0070712_100241116 | Ga0070712_1002411162 | 160 |
| 116 | 3300006237 | Ga0097621_100096180 | Ga0097621_1000961802 | 160 |
| 117 | 3300006237 | Ga0097621_101096397 | Ga0097621_1010963971 | 160 |
| 118 | 3300007265 | Ga0099794_10177801 | Ga0099794_101778012 | 160 |
| 119 | 3300009092 | Ga0105250_10040666 | Ga0105250_100406661 | 160 |
| 120 | 3300009098 | Ga0105245_10012414 | Ga0105245_100124144 | 160 |
| 121 | 3300009148 | Ga0105243_10355058 | Ga0105243_103550582 | 160 |
| 122 | 3300009174 | Ga0105241_10027308 | Ga0105241_100273083 | 160 |
| 123 | 3300011119 | Ga0105246_10237276 | Ga0105246_102372762 | 160 |
| 124 | 3300013100 | Ga0157373_10060266 | Ga0157373_100602662 | 160 |
| 125 | 3300013102 | Ga0157371_10250924 | Ga0157371_102509242 | 160 |
| 126 | 3300013104 | Ga0157370_10075850 | Ga0157370_100758503 | 160 |
| 127 | 3300013105 | Ga0157369_10207051 | Ga0157369_102070512 | 160 |
| 128 | 3300013296 | Ga0157374_10061846 | Ga0157374_100618463 | 160 |
| 129 | 3300013296 | Ga0157374_10146591 | Ga0157374_101465912 | 160 |
| 130 | 3300013297 | Ga0157378_10119522 | Ga0157378_101195224 | 160 |
| 131 | 3300013297 | Ga0157378_10344124 | Ga0157378_103441242 | 160 |
| 132 | 3300013306 | Ga0163162_10023228 | Ga0163162_100232282 | 160 |
| 133 | 3300013306 | Ga0163162_10164906 | Ga0163162_101649064 | 160 |
| 134 | 3300013307 | Ga0157372_10006381 | Ga0157372_1000638110 | 160 |
| 135 | 3300013307 | Ga0157372_10114746 | Ga0157372_101147464 | 160 |
| 136 | 3300013308 | Ga0157375_10944308 | Ga0157375_109443082 | 160 |
| 137 | 3300017792 | Ga0163161_10322073 | Ga0163161_103220732 | 160 |
| 138 | 3300025898 | Ga0207692_10060574 | Ga0207692_100605741 | 160 |
| 139 | 3300025898 | Ga0207692_10068993 | Ga0207692_100689933 | 160 |
| 140 | 3300025903 | Ga0207680_10099858 | Ga0207680_100998582 | 160 |
| 141 | 3300025905 | Ga0207685_10120754 | Ga0207685_101207542 | 160 |
| 142 | 3300025906 | Ga0207699_10003600 | Ga0207699_100036002 | 160 |
| 143 | 3300025906 | Ga0207699_10086282 | Ga0207699_100862824 | 160 |
| 144 | 3300025906 | Ga0207699_10333842 | Ga0207699_103338422 | 160 |
| 145 | 3300025906 | Ga0207699_10484079 | Ga0207699_104840791 | 160 |
| 146 | 3300025910 | Ga0207684_10013620 | Ga0207684_100136203 | 160 |
| 147 | 3300025910 | Ga0207684_10137845 | Ga0207684_101378453 | 160 |
| 148 | 3300025910 | Ga0207684_10353504 | Ga0207684_103535042 | 160 |
| 149 | 3300025911 | Ga0207654_10008603 | Ga0207654_100086032 | 160 |
| 150 | 3300025914 | Ga0207671_10473845 | Ga0207671_104738451 | 160 |
| 151 | 3300025915 | Ga0207693_10000089 | Ga0207693_1000008926 | 160 |
| 152 | 3300025915 | Ga0207693_10102256 | Ga0207693_101022564 | 160 |
| 153 | 3300025915 | Ga0207693_10268132 | Ga0207693_102681322 | 160 |
| 154 | 3300025915 | Ga0207693_10303995 | Ga0207693_103039951 | 160 |
| 155 | 3300025916 | Ga0207663_10163699 | Ga0207663_101636992 | 160 |
| 156 | 3300025916 | Ga0207663_10178655 | Ga0207663_101786552 | 160 |
| 157 | 3300025922 | Ga0207646_10071236 | Ga0207646_100712362 | 160 |
| 158 | 3300025922 | Ga0207646_10179290 | Ga0207646_101792902 | 160 |
| 159 | 3300025922 | Ga0207646_10181279 | Ga0207646_101812792 | 160 |
| 160 | 3300025927 | Ga0207687_10065268 | Ga0207687_100652683 | 160 |
| 161 | 3300025928 | Ga0207700_10000507 | Ga0207700_100005078 | 160 |
| 162 | 3300025928 | Ga0207700_10263179 | Ga0207700_102631792 | 160 |
| 163 | 3300025928 | Ga0207700_11016918 | Ga0207700_110169181 | 160 |
| 164 | 3300025929 | Ga0207664_10367347 | Ga0207664_103673471 | 160 |
| 165 | 3300025939 | Ga0207665_10064584 | Ga0207665_100645842 | 160 |
| 166 | 3300025939 | Ga0207665_10088781 | Ga0207665_100887811 | 160 |
| 167 | 3300025939 | Ga0207665_10128227 | Ga0207665_101282272 | 160 |
| 168 | 3300025944 | Ga0207661_10660376 | Ga0207661_106603761 | 160 |
| 169 | 3300025949 | Ga0207667_10241454 | Ga0207667_102414542 | 160 |
| 170 | 3300025949 | Ga0207667_11277682 | Ga0207667_112776822 | 160 |
| 171 | 3300025961 | Ga0207712_10181407 | Ga0207712_101814072 | 160 |
| 172 | 3300025972 | Ga0207668_10182415 | Ga0207668_101824152 | 160 |
| 173 | 3300025981 | Ga0207640_10335248 | Ga0207640_103352482 | 160 |
| 174 | 3300025986 | Ga0207658_10170572 | Ga0207658_101705722 | 160 |
| 175 | 3300026023 | Ga0207677_10065010 | Ga0207677_100650103 | 160 |
| 176 | 3300026067 | Ga0207678_10317222 | Ga0207678_103172222 | 160 |
| 177 | 3300026078 | Ga0207702_10035178 | Ga0207702_100351782 | 160 |
| 178 | 3300026088 | Ga0207641_10338350 | Ga0207641_103383502 | 160 |
| 179 | 3300028379 | Ga0268266_10530876 | Ga0268266_105308762 | 160 |
| 180 | 3300028381 | Ga0268264_10080253 | Ga0268264_100802533 | 160 |
| 181 | 3300035691 | Ga0373931_0164943 | Ga0373931_0164943_366_887 | 160 |
| 182 | 3300035692 | Ga0373935_0185018 | Ga0373935_0185018_694_1182 | 160 |
| 183 | 3300037068 | Ga0373925_0420625 | Ga0373925_0420625_451_939 | 160 |
| 184 | 3300037418 | Ga0395900_1340497 | Ga0395900_1340497_67_555 | 160 |
| 185 | 3300038443 | Ga0395901_0641049 | Ga0395901_0641049_477_965 | 160 |
| 186 | 3300048903 | Ga0496100_1472554 | Ga0496100_1472554_22_510 | 160 |
| 187 | 3300048909 | Ga0496106_0306872 | Ga0496106_0306872_234_722 | 160 |
| 188 | 3300048910 | Ga0496107_0501230 | Ga0496107_0501230_85_573 | 160 |
| 189 | 3300048915 | Ga0496112_0021456 | Ga0496112_0021456_3222_3743 | 160 |
| 190 | 3300048915 | Ga0496112_0162604 | Ga0496112_0162604_1299_1799 | 160 |
| 191 | 3300048918 | Ga0496115_0151073 | Ga0496115_0151073_1058_1546 | 160 |
| 192 | 3300005290 | Ga0065712_10159805 | Ga0065712_101598052 | 162 |
| 193 | 3300005445 | Ga0070708_100042563 | Ga0070708_1000425634 | 162 |
| 194 | 3300005445 | Ga0070708_100297782 | Ga0070708_1002977822 | 162 |
| 195 | 3300005467 | Ga0070706_100008279 | Ga0070706_1000082796 | 162 |
| 196 | 3300005467 | Ga0070706_100024445 | Ga0070706_1000244455 | 162 |
| 197 | 3300005468 | Ga0070707_100039383 | Ga0070707_1000393834 | 162 |
| 198 | 3300005468 | Ga0070707_100736886 | Ga0070707_1007368861 | 162 |
| 199 | 3300005518 | Ga0070699_101049999 | Ga0070699_1010499991 | 162 |
| 200 | 3300005536 | Ga0070697_100419572 | Ga0070697_1004195721 | 162 |
| 201 | 3300005536 | Ga0070697_100951358 | Ga0070697_1009513581 | 162 |
| 202 | 3300006028 | Ga0070717_10233650 | Ga0070717_102336502 | 162 |
| 203 | 3300006173 | Ga0070716_100790249 | Ga0070716_1007902492 | 162 |
| 204 | 3300007788 | Ga0099795_10290499 | Ga0099795_102904991 | 162 |
| 205 | 3300013307 | Ga0157372_10940352 | Ga0157372_109403521 | 162 |
| 206 | 3300025910 | Ga0207684_10011061 | Ga0207684_100110615 | 162 |
| 207 | 3300025910 | Ga0207684_10199450 | Ga0207684_101994503 | 162 |
| 208 | 3300025910 | Ga0207684_10374465 | Ga0207684_103744652 | 162 |
| 209 | 3300025915 | Ga0207693_10456466 | Ga0207693_104564661 | 162 |
| 210 | 3300025916 | Ga0207663_10030702 | Ga0207663_100307021 | 162 |
| 211 | 3300025922 | Ga0207646_10034549 | Ga0207646_100345493 | 162 |
| 212 | 3300025922 | Ga0207646_10545358 | Ga0207646_105453582 | 162 |
| 213 | 3300025939 | Ga0207665_10192947 | Ga0207665_101929471 | 162 |
| 214 | 3300030760 | Ga0265762_1018312 | Ga0265762_10183122 | 162 |
| 215 | 3300048913 | Ga0496110_0287684 | Ga0496110_0287684_11_499 | 162 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vxn-assembly1.cif.gz_A | cryo-em structure of arabidopsis thaliana msl1 a320v | 0.5831 | 66 | 150 |
| 2l6f-assembly1.cif.gz_A | nmr solution structure of fat domain of fak complexed with ld2 and ld4 motifs of paxillin | 0.5664 | 10 | 158 |
| 2l6f-assembly1.cif.gz_A | nmr solution structure of fat domain of fak complexed with ld2 and ld4 motifs of paxillin | 0.5296 | 10 | 158 |
| 3kyj-assembly1.cif.gz_A | crystal structure of the p1 domain of chea3 in complex with chey6 from r. sphaeroides | 0.5247 | 4 | 145 |
| 7au3-assembly1.cif.gz_C | cytochrome c oxidase structure in f-state | 0.524 | 6 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q64355_426_558_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.6892 | 3 | 115 | 1.20.120.230 |
| af_Q14511_698_834_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.636 | 10 | 105 | 1.20.120.230 |
| af_O35177_697_833_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.6336 | 10 | 105 | 1.20.120.230 |
| af_A4IJ58_688_822_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.6214 | 4 | 105 | 1.20.120.230 |
| af_Q64355_426_558_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.6027 | 3 | 115 | 1.20.120.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G4PD52-F1-model_v4 | Uncharacterized protein | 0.9924 | 6 | 150 |
GO:0016020
|
| AF-A0A1Q8BAH7-F1-model_v4 | Cupin type-1 domain-containing protein | 0.9889 | 6 | 162 |
GO:0016020
|
| AF-A0A437ME15-F1-model_v4 | DUF2306 domain-containing protein | 0.9881 | 3 | 151 |
GO:0016020
|
| AF-A7IM47-F1-model_v4 | Uncharacterized protein | 0.9869 | 6 | 155 |
GO:0016020
|
| AF-A0A811B8I9-F1-model_v4 | deleted | 0.9863 | 6 | 162 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar