F326109

General Info

Members Datasets Scaffolds Average Seq Length
215 122 215 164

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10000149|Ga0070709_1000014924
Length 176
Sequence MILGMSTATFTALHVLISLVGIGSGLVVMYGFFNANRMDRWTQLFLATTALTSLTGFLFPNEHITPGIVIGILSMIILAVAAGTRYGLRMRGVWRPAYVISASIALYFNVFVFVVQSFEKVPALRALAPTQKEPPFAITQLLVLILFVVVTVFAVKRFRPDMAAAASDLANEKRAA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
109 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.65
Rhizosphere 94.42
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10159805 3300005290 Unclassified 1310
2 Ga0065715_10189438 3300005293 Unclassified 1424
3 Ga0070690_100122995 3300005330 Bacteria 1744
4 Ga0070670_100045911 3300005331 Bacteria 3756
5 Ga0070677_10017986 3300005333 Unclassified 2540
6 Ga0070666_10258664 3300005335 Unclassified 1234
7 Ga0068868_100026695 3300005338 Bacteria 4403
8 Ga0070668_100221979 3300005347 Bacteria 1559
9 Ga0070669_100095760 3300005353 Bacteria 2233
10 Ga0070674_100003915 3300005356 Bacteria 8432
11 Ga0070673_100049182 3300005364 Bacteria 3291
12 Ga0070667_100408539 3300005367 Unclassified 1236
13 Ga0070703_10211795 3300005406 Unclassified 766
14 Ga0070709_10000149 3300005434 Bacteria 45901
15 Ga0070709_10075481 3300005434 Bacteria 2187
16 Ga0070714_100386337 3300005435 Unclassified 1320
17 Ga0070714_100636026 3300005435 Unclassified 1026
18 Ga0070713_100000326 3300005436 Bacteria 31172
19 Ga0070713_100037605 3300005436 Bacteria 3914
20 Ga0070713_100371980 3300005436 Unclassified 1330
21 Ga0070713_100514458 3300005436 Unclassified 1131
22 Ga0070713_101032727 3300005436 Bacteria 793
23 Ga0070710_10046140 3300005437 Bacteria 2425
24 Ga0070710_10132939 3300005437 Unclassified 1518
25 Ga0070710_10389008 3300005437 Bacteria 932
26 Ga0070711_100075033 3300005439 Bacteria 2393
27 Ga0070711_100084865 3300005439 Bacteria 2266
28 Ga0070711_100212305 3300005439 Bacteria 1500
29 Ga0070708_100042318 3300005445 Bacteria 3998
30 Ga0070708_100042563 3300005445 Bacteria 3987
31 Ga0070708_100297782 3300005445 Unclassified 1519
32 Ga0070708_100303286 3300005445 Unclassified 1504
33 Ga0070708_100377028 3300005445 Bacteria 1337
34 Ga0070708_101126357 3300005445 Bacteria 735
35 Ga0070663_100546717 3300005455 Bacteria 967
36 Ga0070681_10442817 3300005458 Bacteria 1211
37 Ga0070681_10484635 3300005458 Bacteria 1149
38 Ga0068867_100786207 3300005459 Unclassified 847
39 Ga0070706_100008279 3300005467 Bacteria 9692
40 Ga0070706_100024445 3300005467 Bacteria 5561
41 Ga0070706_100028529 3300005467 Bacteria 5138
42 Ga0070706_100292918 3300005467 Bacteria 1519
43 Ga0070706_100301200 3300005467 Bacteria 1496
44 Ga0070706_100402974 3300005467 Bacteria 1273
45 Ga0070707_100027384 3300005468 Bacteria 5423
46 Ga0070707_100039383 3300005468 Bacteria 4517
47 Ga0070707_100070725 3300005468 Bacteria 3361
48 Ga0070707_100197981 3300005468 Bacteria 1959
49 Ga0070707_100255946 3300005468 Bacteria 1703
50 Ga0070707_100514989 3300005468 Bacteria 1158
51 Ga0070707_100736886 3300005468 Bacteria 949
52 Ga0070707_100960594 3300005468 Bacteria 820
53 Ga0070698_100106984 3300005471 Bacteria 2765
54 Ga0070699_100017049 3300005518 Bacteria 6238
55 Ga0070699_100076715 3300005518 Bacteria 2909
56 Ga0070699_100148148 3300005518 Bacteria 2074
57 Ga0070699_101049999 3300005518 Unclassified 747
58 Ga0070679_100139491 3300005530 Bacteria 2405
59 Ga0070697_100082325 3300005536 Unclassified 2653
60 Ga0070697_100087633 3300005536 Bacteria 2570
61 Ga0070697_100221021 3300005536 Bacteria 1614
62 Ga0070697_100301427 3300005536 Bacteria 1377
63 Ga0070697_100419572 3300005536 Bacteria 1163
64 Ga0070697_100649811 3300005536 Bacteria 929
65 Ga0070697_100951358 3300005536 Unclassified 763
66 Ga0070697_101041197 3300005536 Unclassified 728
67 Ga0070697_101046279 3300005536 Bacteria 726
68 Ga0070695_101357618 3300005545 Unclassified 588
69 Ga0070693_100484584 3300005547 Bacteria 874
70 Ga0070665_100768903 3300005548 Bacteria 976
71 Ga0068855_100672166 3300005563 Bacteria 1110
72 Ga0068854_100275915 3300005578 Bacteria 1352
73 Ga0068856_100154941 3300005614 Bacteria 2301
74 Ga0068852_100568311 3300005616 Bacteria 1136
75 Ga0068863_100144401 3300005841 Bacteria 2275
76 Ga0068858_100009660 3300005842 Bacteria 9192
77 Ga0068860_100058750 3300005843 Bacteria 3657
78 Ga0070717_10044135 3300006028 Bacteria 3640
79 Ga0070717_10080210 3300006028 Unclassified 2738
80 Ga0070717_10113286 3300006028 Unclassified 2316
81 Ga0070717_10183601 3300006028 Unclassified 1824
82 Ga0070717_10233650 3300006028 Bacteria 1619
83 Ga0070716_100019833 3300006173 Bacteria 3520
84 Ga0070716_100033740 3300006173 Unclassified 2802
85 Ga0070716_100790249 3300006173 Unclassified 734
86 Ga0070712_100002081 3300006175 Bacteria 12287
87 Ga0070712_100126858 3300006175 Unclassified 1928
88 Ga0070712_100241116 3300006175 Bacteria 1440
89 Ga0097621_100096180 3300006237 Bacteria 2485
90 Ga0097621_101096397 3300006237 Bacteria 747
91 Ga0075428_100246505 3300006844 Bacteria 1926
92 Ga0099794_10177801 3300007265 Bacteria 1086
93 Ga0099795_10290499 3300007788 Bacteria 716
94 Ga0105250_10040666 3300009092 Unclassified 1864
95 Ga0105240_10270061 3300009093 Bacteria 1958
96 Ga0105245_10012414 3300009098 Bacteria 7414
97 Ga0105247_10591279 3300009101 Unclassified 822
98 Ga0114129_11339641 3300009147 Bacteria 886
99 Ga0105243_10355058 3300009148 Bacteria 1347
100 Ga0105241_10027308 3300009174 Bacteria 4250
101 Ga0105237_10223963 3300009545 Bacteria 1881
102 Ga0105246_10237276 3300011119 Bacteria 1439
103 Ga0157373_10060266 3300013100 Bacteria 2689
104 Ga0157371_10250924 3300013102 Unclassified 1274
105 Ga0157370_10075850 3300013104 Bacteria 3169
106 Ga0157369_10207051 3300013105 Bacteria 2057
107 Ga0157369_11244138 3300013105 Unclassified 759
108 Ga0157374_10061846 3300013296 Bacteria 3508
109 Ga0157374_10146591 3300013296 Bacteria 2293
110 Ga0157378_10119522 3300013297 Bacteria 2427
111 Ga0157378_10344124 3300013297 Unclassified 1455
112 Ga0157378_11420021 3300013297 Bacteria 737
113 Ga0163162_10023228 3300013306 Bacteria 6117
114 Ga0163162_10164906 3300013306 Bacteria 2339
115 Ga0157372_10006381 3300013307 Bacteria 12546
116 Ga0157372_10114746 3300013307 Bacteria 3088
117 Ga0157372_10940352 3300013307 Bacteria 1002
118 Ga0157375_10944308 3300013308 Bacteria 1004
119 Ga0163161_10322073 3300017792 Unclassified 1222
120 Ga0213874_10008040 3300021377 Bacteria 2556
121 Ga0207682_10148250 3300025893 Bacteria 1057
122 Ga0207692_10059057 3300025898 Bacteria 1979
123 Ga0207692_10060574 3300025898 Bacteria 1958
124 Ga0207692_10068993 3300025898 Unclassified 1856
125 Ga0207710_10261991 3300025900 Unclassified 866
126 Ga0207680_10099858 3300025903 Bacteria 1863
127 Ga0207685_10120754 3300025905 Unclassified 1150
128 Ga0207699_10003600 3300025906 Bacteria 7404
129 Ga0207699_10086282 3300025906 Bacteria 1960
130 Ga0207699_10333842 3300025906 Bacteria 1066
131 Ga0207699_10484079 3300025906 Unclassified 891
132 Ga0207684_10011061 3300025910 Bacteria 7903
133 Ga0207684_10013620 3300025910 Bacteria 7028
134 Ga0207684_10137845 3300025910 Bacteria 2096
135 Ga0207684_10199450 3300025910 Unclassified 1726
136 Ga0207684_10329067 3300025910 Bacteria 1316
137 Ga0207684_10353504 3300025910 Bacteria 1265
138 Ga0207684_10374465 3300025910 Unclassified 1225
139 Ga0207654_10008603 3300025911 Bacteria 5169
140 Ga0207695_10185510 3300025913 Bacteria 1999
141 Ga0207671_10473845 3300025914 Bacteria 998
142 Ga0207693_10000089 3300025915 Bacteria 81143
143 Ga0207693_10102256 3300025915 Bacteria 2247
144 Ga0207693_10268132 3300025915 Unclassified 1338
145 Ga0207693_10303995 3300025915 Unclassified 1249
146 Ga0207693_10456466 3300025915 Unclassified 998
147 Ga0207663_10030702 3300025916 Bacteria 3172
148 Ga0207663_10163699 3300025916 Bacteria 1573
149 Ga0207663_10178655 3300025916 Bacteria 1514
150 Ga0207646_10034549 3300025922 Bacteria 4569
151 Ga0207646_10064631 3300025922 Bacteria 3266
152 Ga0207646_10071236 3300025922 Bacteria 3105
153 Ga0207646_10179290 3300025922 Bacteria 1913
154 Ga0207646_10181279 3300025922 Bacteria 1902
155 Ga0207646_10545358 3300025922 Bacteria 1043
156 Ga0207687_10065268 3300025927 Bacteria 2584
157 Ga0207700_10000507 3300025928 Bacteria 22859
158 Ga0207700_10263179 3300025928 Unclassified 1477
159 Ga0207700_10447925 3300025928 Unclassified 1137
160 Ga0207700_10851054 3300025928 Unclassified 816
161 Ga0207700_11016918 3300025928 Bacteria 742
162 Ga0207664_10149105 3300025929 Bacteria 1986
163 Ga0207664_10367347 3300025929 Unclassified 1276
164 Ga0207665_10064584 3300025939 Unclassified 2487
165 Ga0207665_10088781 3300025939 Unclassified 2140
166 Ga0207665_10128227 3300025939 Bacteria 1798
167 Ga0207665_10192947 3300025939 Unclassified 1481
168 Ga0207661_10660376 3300025944 Bacteria 961
169 Ga0207667_10241454 3300025949 Bacteria 1848
170 Ga0207667_11277682 3300025949 Bacteria 711
171 Ga0207712_10181407 3300025961 Bacteria 1654
172 Ga0207668_10182415 3300025972 Bacteria 1657
173 Ga0207640_10335248 3300025981 Bacteria 1209
174 Ga0207658_10170572 3300025986 Unclassified 1792
175 Ga0207677_10065010 3300026023 Bacteria 2543
176 Ga0207703_10005837 3300026035 Bacteria 9861
177 Ga0207678_10317222 3300026067 Unclassified 1341
178 Ga0207702_10035178 3300026078 Bacteria 4188
179 Ga0207702_10125816 3300026078 Bacteria 2301
180 Ga0207641_10338350 3300026088 Bacteria 1431
181 Ga0209588_1044119 3300027671 Unclassified 1442
182 Ga0268266_10530876 3300028379 Unclassified 1126
183 Ga0268264_10080253 3300028381 Bacteria 2786
184 Ga0265326_10035727 3300028558 Unclassified 1413
185 Ga0265318_10025563 3300028577 Bacteria 2331
186 Ga0265338_10000053 3300028800 Bacteria 208184
187 Ga0265338_10000160 3300028800 Bacteria 122713
188 Ga0265324_10000163 3300029957 Bacteria 51372
189 Ga0265762_1018312 3300030760 Bacteria 1278
190 Ga0265332_10176855 3300031238 Bacteria 890
191 Ga0265328_10090631 3300031239 Bacteria 1129
192 Ga0265320_10059235 3300031240 Bacteria 1832
193 Ga0265339_10012521 3300031249 Bacteria 5176
194 Ga0265331_10149699 3300031250 Unclassified 1060
195 Ga0265313_10032112 3300031595 Bacteria 2685
196 Ga0373942_0331888 3300035207 Unclassified 534
197 Ga0373961_0274028 3300035241 Unclassified 617
198 Ga0373931_0164943 3300035691 Bacteria 1301
199 Ga0373935_0185018 3300035692 Bacteria 1432
200 Ga0373925_0420625 3300037068 Bacteria 1092
201 Ga0395900_1340497 3300037418 Bacteria 629
202 Ga0395901_0641049 3300038443 Bacteria 1067
203 Ga0395901_1349834 3300038443 Unclassified 673
204 Ga0436363_1014330 3300039450 Bacteria 3352
205 Ga0453683_0141165 3300044673 Bacteria 1520
206 Ga0496100_1472554 3300048903 Unclassified 538
207 Ga0496106_0306872 3300048909 Unclassified 1273
208 Ga0496107_0501230 3300048910 Unclassified 901
209 Ga0496110_0287684 3300048913 Bacteria 1497
210 Ga0496112_0021456 3300048915 Bacteria 6143
211 Ga0496112_0162604 3300048915 Bacteria 2199
212 Ga0496112_0376506 3300048915 Bacteria 1361
213 Ga0496115_0042340 3300048918 Bacteria 3628
214 Ga0496115_0151073 3300048918 Bacteria 1918
215 Ga0496115_0683931 3300048918 Bacteria 808

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1349834 Ga0395901_1349834_73_501 136
2 3300009545 Ga0105237_10223963 Ga0105237_102239632 137
3 3300035207 Ga0373942_0331888 Ga0373942_0331888_38_478 137
4 3300035241 Ga0373961_0274028 Ga0373961_0274028_66_506 137
5 3300009147 Ga0114129_11339641 Ga0114129_113396412 138
6 3300005467 Ga0070706_100028529 Ga0070706_1000285292 139
7 3300005468 Ga0070707_100027384 Ga0070707_1000273849 139
8 3300005471 Ga0070698_100106984 Ga0070698_1001069842 139
9 3300005518 Ga0070699_100017049 Ga0070699_1000170496 139
10 3300025910 Ga0207684_10329067 Ga0207684_103290672 139
11 3300025922 Ga0207646_10064631 Ga0207646_100646312 139
12 3300013105 Ga0157369_11244138 Ga0157369_112441382 141
13 3300005536 Ga0070697_101046279 Ga0070697_1010462792 149
14 3300005536 Ga0070697_100649811 Ga0070697_1006498111 150
15 3300048918 Ga0496115_0042340 Ga0496115_0042340_2136_2621 150
16 3300048918 Ga0496115_0683931 Ga0496115_0683931_10_504 153
17 3300005333 Ga0070677_10017986 Ga0070677_100179862 154
18 3300025893 Ga0207682_10148250 Ga0207682_101482502 154
19 3300025913 Ga0207695_10185510 Ga0207695_101855102 154
20 3300028577 Ga0265318_10025563 Ga0265318_100255634 154
21 3300031595 Ga0265313_10032112 Ga0265313_100321121 154
22 3300005547 Ga0070693_100484584 Ga0070693_1004845841 155
23 3300005364 Ga0070673_100049182 Ga0070673_1000491822 156
24 3300005436 Ga0070713_100514458 Ga0070713_1005144582 156
25 3300006028 Ga0070717_10080210 Ga0070717_100802102 156
26 3300006028 Ga0070717_10183601 Ga0070717_101836012 156
27 3300009093 Ga0105240_10270061 Ga0105240_102700614 156
28 3300013297 Ga0157378_11420021 Ga0157378_114200211 156
29 3300025928 Ga0207700_10447925 Ga0207700_104479252 156
30 3300025929 Ga0207664_10149105 Ga0207664_101491053 156
31 3300048915 Ga0496112_0376506 Ga0496112_0376506_847_1323 156
32 3300005536 Ga0070697_100082325 Ga0070697_1000823252 157
33 3300044673 Ga0453683_0141165 Ga0453683_0141165_856_1347 157
34 3300005331 Ga0070670_100045911 Ga0070670_1000459112 158
35 3300005338 Ga0068868_100026695 Ga0068868_1000266952 158
36 3300005842 Ga0068858_100009660 Ga0068858_1000096605 158
37 3300006844 Ga0075428_100246505 Ga0075428_1002465054 158
38 3300009101 Ga0105247_10591279 Ga0105247_105912792 158
39 3300021377 Ga0213874_10008040 Ga0213874_100080402 158
40 3300025900 Ga0207710_10261991 Ga0207710_102619912 158
41 3300026035 Ga0207703_10005837 Ga0207703_100058379 158
42 3300027671 Ga0209588_1044119 Ga0209588_10441192 158
43 3300028800 Ga0265338_10000053 Ga0265338_10000053138 158
44 3300029957 Ga0265324_10000163 Ga0265324_1000016337 158
45 3300031238 Ga0265332_10176855 Ga0265332_101768552 158
46 3300031239 Ga0265328_10090631 Ga0265328_100906312 158
47 3300031240 Ga0265320_10059235 Ga0265320_100592353 158
48 3300031249 Ga0265339_10012521 Ga0265339_100125212 158
49 3300039450 Ga0436363_1014330 Ga0436363_1014330_2344_2859 158
50 3300005436 Ga0070713_100371980 Ga0070713_1003719802 159
51 3300005437 Ga0070710_10389008 Ga0070710_103890082 159
52 3300005614 Ga0068856_100154941 Ga0068856_1001549412 159
53 3300025898 Ga0207692_10059057 Ga0207692_100590572 159
54 3300025928 Ga0207700_10851054 Ga0207700_108510541 159
55 3300026078 Ga0207702_10125816 Ga0207702_101258162 159
56 3300028558 Ga0265326_10035727 Ga0265326_100357271 159
57 3300028800 Ga0265338_10000160 Ga0265338_1000016012 159
58 3300031250 Ga0265331_10149699 Ga0265331_101496991 159
59 3300005293 Ga0065715_10189438 Ga0065715_101894382 160
60 3300005330 Ga0070690_100122995 Ga0070690_1001229955 160
61 3300005335 Ga0070666_10258664 Ga0070666_102586642 160
62 3300005347 Ga0070668_100221979 Ga0070668_1002219792 160
63 3300005353 Ga0070669_100095760 Ga0070669_1000957605 160
64 3300005356 Ga0070674_100003915 Ga0070674_1000039152 160
65 3300005367 Ga0070667_100408539 Ga0070667_1004085392 160
66 3300005406 Ga0070703_10211795 Ga0070703_102117951 160
67 3300005434 Ga0070709_10000149 Ga0070709_1000014924 160
68 3300005434 Ga0070709_10075481 Ga0070709_100754812 160
69 3300005435 Ga0070714_100386337 Ga0070714_1003863372 160
70 3300005435 Ga0070714_100636026 Ga0070714_1006360261 160
71 3300005436 Ga0070713_100000326 Ga0070713_10000032617 160
72 3300005436 Ga0070713_100037605 Ga0070713_1000376057 160
73 3300005436 Ga0070713_101032727 Ga0070713_1010327271 160
74 3300005437 Ga0070710_10046140 Ga0070710_100461403 160
75 3300005437 Ga0070710_10132939 Ga0070710_101329392 160
76 3300005439 Ga0070711_100075033 Ga0070711_1000750332 160
77 3300005439 Ga0070711_100084865 Ga0070711_1000848653 160
78 3300005439 Ga0070711_100212305 Ga0070711_1002123053 160
79 3300005445 Ga0070708_100042318 Ga0070708_1000423184 160
80 3300005445 Ga0070708_100303286 Ga0070708_1003032862 160
81 3300005445 Ga0070708_100377028 Ga0070708_1003770282 160
82 3300005445 Ga0070708_101126357 Ga0070708_1011263571 160
83 3300005455 Ga0070663_100546717 Ga0070663_1005467171 160
84 3300005458 Ga0070681_10442817 Ga0070681_104428172 160
85 3300005458 Ga0070681_10484635 Ga0070681_104846352 160
86 3300005459 Ga0068867_100786207 Ga0068867_1007862072 160
87 3300005467 Ga0070706_100292918 Ga0070706_1002929182 160
88 3300005467 Ga0070706_100301200 Ga0070706_1003012002 160
89 3300005467 Ga0070706_100402974 Ga0070706_1004029741 160
90 3300005468 Ga0070707_100070725 Ga0070707_1000707252 160
91 3300005468 Ga0070707_100197981 Ga0070707_1001979812 160
92 3300005468 Ga0070707_100255946 Ga0070707_1002559461 160
93 3300005468 Ga0070707_100514989 Ga0070707_1005149892 160
94 3300005468 Ga0070707_100960594 Ga0070707_1009605942 160
95 3300005518 Ga0070699_100076715 Ga0070699_1000767152 160
96 3300005518 Ga0070699_100148148 Ga0070699_1001481483 160
97 3300005530 Ga0070679_100139491 Ga0070679_1001394912 160
98 3300005536 Ga0070697_100087633 Ga0070697_1000876332 160
99 3300005536 Ga0070697_100221021 Ga0070697_1002210212 160
100 3300005536 Ga0070697_100301427 Ga0070697_1003014272 160
101 3300005536 Ga0070697_101041197 Ga0070697_1010411972 160
102 3300005545 Ga0070695_101357618 Ga0070695_1013576181 160
103 3300005548 Ga0070665_100768903 Ga0070665_1007689032 160
104 3300005563 Ga0068855_100672166 Ga0068855_1006721661 160
105 3300005578 Ga0068854_100275915 Ga0068854_1002759153 160
106 3300005616 Ga0068852_100568311 Ga0068852_1005683111 160
107 3300005841 Ga0068863_100144401 Ga0068863_1001444012 160
108 3300005843 Ga0068860_100058750 Ga0068860_1000587504 160
109 3300006028 Ga0070717_10044135 Ga0070717_100441352 160
110 3300006028 Ga0070717_10113286 Ga0070717_101132864 160
111 3300006173 Ga0070716_100019833 Ga0070716_1000198333 160
112 3300006173 Ga0070716_100033740 Ga0070716_1000337402 160
113 3300006175 Ga0070712_100002081 Ga0070712_1000020817 160
114 3300006175 Ga0070712_100126858 Ga0070712_1001268582 160
115 3300006175 Ga0070712_100241116 Ga0070712_1002411162 160
116 3300006237 Ga0097621_100096180 Ga0097621_1000961802 160
117 3300006237 Ga0097621_101096397 Ga0097621_1010963971 160
118 3300007265 Ga0099794_10177801 Ga0099794_101778012 160
119 3300009092 Ga0105250_10040666 Ga0105250_100406661 160
120 3300009098 Ga0105245_10012414 Ga0105245_100124144 160
121 3300009148 Ga0105243_10355058 Ga0105243_103550582 160
122 3300009174 Ga0105241_10027308 Ga0105241_100273083 160
123 3300011119 Ga0105246_10237276 Ga0105246_102372762 160
124 3300013100 Ga0157373_10060266 Ga0157373_100602662 160
125 3300013102 Ga0157371_10250924 Ga0157371_102509242 160
126 3300013104 Ga0157370_10075850 Ga0157370_100758503 160
127 3300013105 Ga0157369_10207051 Ga0157369_102070512 160
128 3300013296 Ga0157374_10061846 Ga0157374_100618463 160
129 3300013296 Ga0157374_10146591 Ga0157374_101465912 160
130 3300013297 Ga0157378_10119522 Ga0157378_101195224 160
131 3300013297 Ga0157378_10344124 Ga0157378_103441242 160
132 3300013306 Ga0163162_10023228 Ga0163162_100232282 160
133 3300013306 Ga0163162_10164906 Ga0163162_101649064 160
134 3300013307 Ga0157372_10006381 Ga0157372_1000638110 160
135 3300013307 Ga0157372_10114746 Ga0157372_101147464 160
136 3300013308 Ga0157375_10944308 Ga0157375_109443082 160
137 3300017792 Ga0163161_10322073 Ga0163161_103220732 160
138 3300025898 Ga0207692_10060574 Ga0207692_100605741 160
139 3300025898 Ga0207692_10068993 Ga0207692_100689933 160
140 3300025903 Ga0207680_10099858 Ga0207680_100998582 160
141 3300025905 Ga0207685_10120754 Ga0207685_101207542 160
142 3300025906 Ga0207699_10003600 Ga0207699_100036002 160
143 3300025906 Ga0207699_10086282 Ga0207699_100862824 160
144 3300025906 Ga0207699_10333842 Ga0207699_103338422 160
145 3300025906 Ga0207699_10484079 Ga0207699_104840791 160
146 3300025910 Ga0207684_10013620 Ga0207684_100136203 160
147 3300025910 Ga0207684_10137845 Ga0207684_101378453 160
148 3300025910 Ga0207684_10353504 Ga0207684_103535042 160
149 3300025911 Ga0207654_10008603 Ga0207654_100086032 160
150 3300025914 Ga0207671_10473845 Ga0207671_104738451 160
151 3300025915 Ga0207693_10000089 Ga0207693_1000008926 160
152 3300025915 Ga0207693_10102256 Ga0207693_101022564 160
153 3300025915 Ga0207693_10268132 Ga0207693_102681322 160
154 3300025915 Ga0207693_10303995 Ga0207693_103039951 160
155 3300025916 Ga0207663_10163699 Ga0207663_101636992 160
156 3300025916 Ga0207663_10178655 Ga0207663_101786552 160
157 3300025922 Ga0207646_10071236 Ga0207646_100712362 160
158 3300025922 Ga0207646_10179290 Ga0207646_101792902 160
159 3300025922 Ga0207646_10181279 Ga0207646_101812792 160
160 3300025927 Ga0207687_10065268 Ga0207687_100652683 160
161 3300025928 Ga0207700_10000507 Ga0207700_100005078 160
162 3300025928 Ga0207700_10263179 Ga0207700_102631792 160
163 3300025928 Ga0207700_11016918 Ga0207700_110169181 160
164 3300025929 Ga0207664_10367347 Ga0207664_103673471 160
165 3300025939 Ga0207665_10064584 Ga0207665_100645842 160
166 3300025939 Ga0207665_10088781 Ga0207665_100887811 160
167 3300025939 Ga0207665_10128227 Ga0207665_101282272 160
168 3300025944 Ga0207661_10660376 Ga0207661_106603761 160
169 3300025949 Ga0207667_10241454 Ga0207667_102414542 160
170 3300025949 Ga0207667_11277682 Ga0207667_112776822 160
171 3300025961 Ga0207712_10181407 Ga0207712_101814072 160
172 3300025972 Ga0207668_10182415 Ga0207668_101824152 160
173 3300025981 Ga0207640_10335248 Ga0207640_103352482 160
174 3300025986 Ga0207658_10170572 Ga0207658_101705722 160
175 3300026023 Ga0207677_10065010 Ga0207677_100650103 160
176 3300026067 Ga0207678_10317222 Ga0207678_103172222 160
177 3300026078 Ga0207702_10035178 Ga0207702_100351782 160
178 3300026088 Ga0207641_10338350 Ga0207641_103383502 160
179 3300028379 Ga0268266_10530876 Ga0268266_105308762 160
180 3300028381 Ga0268264_10080253 Ga0268264_100802533 160
181 3300035691 Ga0373931_0164943 Ga0373931_0164943_366_887 160
182 3300035692 Ga0373935_0185018 Ga0373935_0185018_694_1182 160
183 3300037068 Ga0373925_0420625 Ga0373925_0420625_451_939 160
184 3300037418 Ga0395900_1340497 Ga0395900_1340497_67_555 160
185 3300038443 Ga0395901_0641049 Ga0395901_0641049_477_965 160
186 3300048903 Ga0496100_1472554 Ga0496100_1472554_22_510 160
187 3300048909 Ga0496106_0306872 Ga0496106_0306872_234_722 160
188 3300048910 Ga0496107_0501230 Ga0496107_0501230_85_573 160
189 3300048915 Ga0496112_0021456 Ga0496112_0021456_3222_3743 160
190 3300048915 Ga0496112_0162604 Ga0496112_0162604_1299_1799 160
191 3300048918 Ga0496115_0151073 Ga0496115_0151073_1058_1546 160
192 3300005290 Ga0065712_10159805 Ga0065712_101598052 162
193 3300005445 Ga0070708_100042563 Ga0070708_1000425634 162
194 3300005445 Ga0070708_100297782 Ga0070708_1002977822 162
195 3300005467 Ga0070706_100008279 Ga0070706_1000082796 162
196 3300005467 Ga0070706_100024445 Ga0070706_1000244455 162
197 3300005468 Ga0070707_100039383 Ga0070707_1000393834 162
198 3300005468 Ga0070707_100736886 Ga0070707_1007368861 162
199 3300005518 Ga0070699_101049999 Ga0070699_1010499991 162
200 3300005536 Ga0070697_100419572 Ga0070697_1004195721 162
201 3300005536 Ga0070697_100951358 Ga0070697_1009513581 162
202 3300006028 Ga0070717_10233650 Ga0070717_102336502 162
203 3300006173 Ga0070716_100790249 Ga0070716_1007902492 162
204 3300007788 Ga0099795_10290499 Ga0099795_102904991 162
205 3300013307 Ga0157372_10940352 Ga0157372_109403521 162
206 3300025910 Ga0207684_10011061 Ga0207684_100110615 162
207 3300025910 Ga0207684_10199450 Ga0207684_101994503 162
208 3300025910 Ga0207684_10374465 Ga0207684_103744652 162
209 3300025915 Ga0207693_10456466 Ga0207693_104564661 162
210 3300025916 Ga0207663_10030702 Ga0207663_100307021 162
211 3300025922 Ga0207646_10034549 Ga0207646_100345493 162
212 3300025922 Ga0207646_10545358 Ga0207646_105453582 162
213 3300025939 Ga0207665_10192947 Ga0207665_101929471 162
214 3300030760 Ga0265762_1018312 Ga0265762_10183122 162
215 3300048913 Ga0496110_0287684 Ga0496110_0287684_11_499 162

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vxn-assembly1.cif.gz_A cryo-em structure of arabidopsis thaliana msl1 a320v 0.5831 66 150
2l6f-assembly1.cif.gz_A nmr solution structure of fat domain of fak complexed with ld2 and ld4 motifs of paxillin 0.5664 10 158
2l6f-assembly1.cif.gz_A nmr solution structure of fat domain of fak complexed with ld2 and ld4 motifs of paxillin 0.5296 10 158
3kyj-assembly1.cif.gz_A crystal structure of the p1 domain of chea3 in complex with chey6 from r. sphaeroides 0.5247 4 145
7au3-assembly1.cif.gz_C cytochrome c oxidase structure in f-state 0.524 6 114
ID Description Score Start End Superfamily
af_Q64355_426_558_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6892 3 115 1.20.120.230
af_Q14511_698_834_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.636 10 105 1.20.120.230
af_O35177_697_833_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6336 10 105 1.20.120.230
af_A4IJ58_688_822_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6214 4 105 1.20.120.230
af_Q64355_426_558_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6027 3 115 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A1G4PD52-F1-model_v4 Uncharacterized protein 0.9924 6 150 GO:0016020
AF-A0A1Q8BAH7-F1-model_v4 Cupin type-1 domain-containing protein 0.9889 6 162 GO:0016020
AF-A0A437ME15-F1-model_v4 DUF2306 domain-containing protein 0.9881 3 151 GO:0016020
AF-A7IM47-F1-model_v4 Uncharacterized protein 0.9869 6 155 GO:0016020
AF-A0A811B8I9-F1-model_v4 deleted 0.9863 6 162

Feature Viewer

pLDDT pTM Quality
92.97 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map