F325794

General Info

Members Datasets Scaffolds Average Seq Length
214 159 428 271

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0004869|Ga0500559_0004869_2737_3570
Length 277
Sequence VIPAAFTYRRPGSVADVLALLTEYGDDAKVLAGGHSLLPVMKLRLAAPEVLIDLGALADLRYVRTSGHTIEIGAMTRYHDLLCDDVLAEHAPLLAHTAGVVGDPQVRHRGTIGGSVAHADPAADLPAALLASDASFVVTGPEGTREIPAAGFFLGPFTTPLAANELLTEIRVPMRTGLGWGFEKFTRRAIDWAIVGVAAVGQSVALINMGGTPMRALAVQAALAEGASIQDAAALAAEGASPLDEPHASARYRKHLARVLTGRVLQQVSGVTPAGLS

Samples

Sample ID Description Type Environment
1 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
146 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
154 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
155 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
156 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
157 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
158 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
159 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 1.4
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 1.4
Rhizosphere 92.99
Stem 0
Stem Tuber 0.47
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500559_0004869 3300053136 Bacteria 6262
2 Ga0070658_10015354 3300005327 Bacteria 6129
3 Ga0070658_10338932 3300005327 Bacteria 1286
4 Ga0070690_100028692 3300005330 Bacteria 3448
5 Ga0068869_100241263 3300005334 Bacteria 1440
6 Ga0070680_100019986 3300005336 Bacteria 5309
7 Ga0070660_100056211 3300005339 Bacteria 3044
8 Ga0070660_100206246 3300005339 Bacteria 1595
9 Ga0070660_100288331 3300005339 Bacteria 1344
10 Ga0070668_100008134 3300005347 Bacteria 7792
11 Ga0070674_100049672 3300005356 Bacteria 2885
12 Ga0070659_100002235 3300005366 Bacteria 13761
13 Ga0070659_100416907 3300005366 Bacteria 1135
14 Ga0070709_10046582 3300005434 Bacteria 2696
15 Ga0070713_100046035 3300005436 Bacteria 3578
16 Ga0070663_100000117 3300005455 Bacteria 37277
17 Ga0070678_100017550 3300005456 Bacteria 4613
18 Ga0070681_10000019 3300005458 Bacteria 124774
19 Ga0070681_10012556 3300005458 Bacteria 8404
20 Ga0070681_10047600 3300005458 Bacteria 4286
21 Ga0070681_10154283 3300005458 Bacteria 2222
22 Ga0068867_100029119 3300005459 Bacteria 3979
23 Ga0070706_100075252 3300005467 Bacteria 3124
24 Ga0070707_100014995 3300005468 Bacteria 7273
25 Ga0070707_100091073 3300005468 Bacteria 2952
26 Ga0070707_100093580 3300005468 Bacteria 2910
27 Ga0070707_100186310 3300005468 Bacteria 2024
28 Ga0070698_100233953 3300005471 Bacteria 1770
29 Ga0070699_100044479 3300005518 Bacteria 3844
30 Ga0070679_100024866 3300005530 Bacteria 5870
31 Ga0070679_100030451 3300005530 Bacteria 5328
32 Ga0070679_100076198 3300005530 Bacteria 3344
33 Ga0070679_100126503 3300005530 Bacteria 2538
34 Ga0070679_100221873 3300005530 Bacteria 1851
35 Ga0081455_10000258 3300005937 Bacteria 69890
36 Ga0081455_10248735 3300005937 Bacteria 1302
37 Ga0081538_10004035 3300005981 Bacteria 13659
38 Ga0081538_10004916 3300005981 Bacteria 12176
39 Ga0081538_10017261 3300005981 Bacteria 5486
40 Ga0081538_10020312 3300005981 Bacteria 4895
41 Ga0081538_10040457 3300005981 Bacteria 2973
42 Ga0081539_10050311 3300005985 Bacteria 2359
43 Ga0075428_100154062 3300006844 Bacteria 2496
44 Ga0075430_100068721 3300006846 Bacteria 2972
45 Ga0075431_100104266 3300006847 Bacteria 2927
46 Ga0075431_100351073 3300006847 Bacteria 1483
47 Ga0068865_100018379 3300006881 Bacteria 4509
48 Ga0105240_10759518 3300009093 Bacteria 1053
49 Ga0111539_10503596 3300009094 Bacteria 1410
50 Ga0114129_10107250 3300009147 Bacteria 3858
51 Ga0105242_10073680 3300009176 Bacteria 2840
52 Ga0105237_10302101 3300009545 Bacteria 1604
53 Ga0157369_10010668 3300013105 Bacteria 10457
54 Ga0157369_10021044 3300013105 Bacteria 7292
55 Ga0163163_10095948 3300014325 Bacteria 2985
56 Ga0163163_10563161 3300014325 Bacteria 1202
57 Ga0197907_10505410 3300020069 Bacteria 3768
58 Ga0213875_10001950 3300021388 Bacteria 12764
59 Ga0207705_10002007 3300025909 Bacteria 15831
60 Ga0207684_10130245 3300025910 Bacteria 2159
61 Ga0207707_10020824 3300025912 Bacteria 5729
62 Ga0207707_10022313 3300025912 Bacteria 5535
63 Ga0207671_10189275 3300025914 Bacteria 1604
64 Ga0207660_10002144 3300025917 Bacteria 13097
65 Ga0207657_10046254 3300025919 Bacteria 3813
66 Ga0207657_10185201 3300025919 Bacteria 1682
67 Ga0207657_10270635 3300025919 Bacteria 1350
68 Ga0207652_10001128 3300025921 Bacteria 24033
69 Ga0207652_10017548 3300025921 Bacteria 5858
70 Ga0207652_10182200 3300025921 Bacteria 1888
71 Ga0207652_10265237 3300025921 Bacteria 1549
72 Ga0207646_10018823 3300025922 Bacteria 6432
73 Ga0207646_10130499 3300025922 Bacteria 2261
74 Ga0207646_10177355 3300025922 Bacteria 1925
75 Ga0207690_10000089 3300025932 Bacteria 75740
76 Ga0207686_10038291 3300025934 Bacteria 2901
77 Ga0207686_10240473 3300025934 Bacteria 1317
78 Ga0207669_10036850 3300025937 Bacteria 2799
79 Ga0207704_10109779 3300025938 Bacteria 1862
80 Ga0207689_10243332 3300025942 Bacteria 1487
81 Ga0207668_10018511 3300025972 Bacteria 4385
82 Ga0207678_10000093 3300026067 Bacteria 74658
83 Ga0207708_10077113 3300026075 Bacteria 2557
84 Ga0207648_10278254 3300026089 Bacteria 1496
85 Ga0207683_10176385 3300026121 Bacteria 1937
86 Ga0268266_10611067 3300028379 Bacteria 1048
87 Ga0307514_10292367 3300031649 Bacteria 921
88 Ga0307413_10034145 3300031824 Bacteria 2904
89 Ga0307518_10009045 3300031838 Bacteria 7111
90 Ga0307410_10150689 3300031852 Bacteria 1731
91 Ga0307406_10182391 3300031901 Bacteria 1529
92 Ga0307407_10009811 3300031903 Bacteria 4480
93 Ga0307407_10146809 3300031903 Bacteria 1528
94 Ga0307407_10160045 3300031903 Bacteria 1472
95 Ga0307409_100017103 3300031995 Bacteria 4822
96 Ga0307409_100309000 3300031995 Bacteria 1474
97 Ga0307416_100079162 3300032002 Bacteria 2769
98 Ga0307416_100116678 3300032002 Bacteria 2367
99 Ga0307414_10141349 3300032004 Bacteria 1885
100 Ga0307414_10569983 3300032004 Bacteria 1011
101 Ga0307415_100045904 3300032126 Bacteria 2932
102 Ga0307415_100108733 3300032126 Bacteria 2052
103 Ga0307507_10003547 3300033179 Bacteria 29942
104 Ga0373936_0002884 3300035113 Bacteria 6417
105 Ga0373953_0004757 3300035117 Bacteria 4351
106 Ga0373954_0031582 3300035118 Bacteria 2445
107 Ga0373956_0086128 3300035119 Bacteria 1445
108 Ga0373957_0003229 3300035120 Bacteria 4789
109 Ga0373933_0029931 3300035724 Bacteria 3150
110 Ga0373947_0054445 3300035725 Bacteria 2414
111 Ga0373947_0180392 3300035725 Bacteria 1374
112 Ga0373937_0005800 3300036401 Bacteria 10614
113 Ga0373937_0353492 3300036401 Bacteria 1392
114 Ga0373925_0119248 3300037068 Bacteria 2047
115 Ga0395899_0110628 3300037312 Bacteria 1976
116 Ga0395900_0031892 3300037418 Bacteria 5417
117 Ga0395900_0443552 3300037418 Bacteria 1255
118 Ga0436364_1232097 3300037853 Bacteria 76315
119 Ga0395901_0045674 3300038443 Bacteria 4547
120 Ga0466961_0001004 3300044693 Bacteria 17412
121 Ga0466961_0193581 3300044693 Bacteria 1260
122 Ga0466963_0397476 3300044694 Bacteria 972
123 Ga0466964_0024172 3300044706 Bacteria 2366
124 Ga0466960_0155169 3300044901 Bacteria 1226
125 Ga0466959_0069096 3300045049 Bacteria 2560
126 Ga0466958_0067029 3300045836 Bacteria 2192
127 Ga0466967_0155474 3300045976 Bacteria 2142
128 Ga0495629_0008508 3300046459 Bacteria 7556
129 Ga0495641_0008903 3300046461 Bacteria 6038
130 Ga0495653_0128549 3300046463 Bacteria 1796
131 Ga0495653_0139915 3300046463 Bacteria 1704
132 Ga0495582_0033419 3300046473 Bacteria 2827
133 Ga0495639_0050185 3300046475 Bacteria 1895
134 Ga0495662_0006236 3300046476 Bacteria 5959
135 Ga0495664_0081688 3300046477 Bacteria 1937
136 Ga0495608_0007272 3300046511 Bacteria 7827
137 Ga0495618_0027875 3300046514 Bacteria 3517
138 Ga0495618_0175936 3300046514 Bacteria 1361
139 Ga0495628_0082404 3300046516 Bacteria 2498
140 Ga0495630_0151809 3300046517 Bacteria 1762
141 Ga0495652_0108335 3300046529 Bacteria 2239
142 Ga0495665_0042201 3300046531 Bacteria 2428
143 Ga0495640_0021575 3300046533 Bacteria 4725
144 Ga0495586_0045380 3300046535 Bacteria 2368
145 Ga0495587_0026833 3300046536 Bacteria 3508
146 Ga0495645_0057580 3300046543 Bacteria 2820
147 Ga0495667_0010773 3300046559 Bacteria 6181
148 Ga0495667_0064680 3300046559 Bacteria 2392
149 Ga0495634_0007214 3300046642 Bacteria 8378
150 Ga0495635_0207501 3300046663 Bacteria 1327
151 Ga0495657_0033221 3300046675 Bacteria 3593
152 Ga0495657_0136880 3300046675 Bacteria 1530
153 Ga0495599_0099809 3300046678 Bacteria 1809
154 Ga0495623_0113217 3300046679 Bacteria 1642
155 Ga0495646_0251385 3300046680 Bacteria 947
156 Ga0495658_0019088 3300046683 Bacteria 3574
157 Ga0495613_0039891 3300046689 Bacteria 3479
158 Ga0495613_0191106 3300046689 Bacteria 1447
159 Ga0495624_0009609 3300046690 Bacteria 6697
160 Ga0495624_0050564 3300046690 Bacteria 2633
161 Ga0495600_0004910 3300046809 Bacteria 8030
162 Ga0495581_0015547 3300047315 Bacteria 4417
163 Ga0495674_0162211 3300047319 Bacteria 1870
164 Ga0495680_0055639 3300047322 Bacteria 3067
165 Ga0495593_0005204 3300047673 Bacteria 7688
166 Ga0495602_0181694 3300048088 Bacteria 1621
167 Ga0496100_0562348 3300048903 Bacteria 883
168 Ga0496110_0512522 3300048913 Bacteria 1092
169 Ga0496115_0017335 3300048918 Bacteria 5504
170 Ga0501318_008959 3300049534 Bacteria 1081
171 Ga0501321_007955 3300049537 Bacteria 1114
172 Ga0501036_0005291 3300049572 Bacteria 10442
173 Ga0501038_0011069 3300049574 Bacteria 8239
174 Ga0501039_0211441 3300049575 Bacteria 1525
175 Ga0501040_0008011 3300049576 Bacteria 6861
176 Ga0501041_0171791 3300049577 Bacteria 1356
177 Ga0501042_0181688 3300049578 Bacteria 1517
178 Ga0501070_0013852 3300049586 Bacteria 6793
179 Ga0501071_0030890 3300049587 Bacteria 3792
180 Ga0501072_0053893 3300049588 Bacteria 3168
181 Ga0501074_0048012 3300049590 Bacteria 3084
182 Ga0501076_0009123 3300049592 Bacteria 7303
183 Ga0501077_0068830 3300049593 Bacteria 2244
184 Ga0501079_0023583 3300049741 Bacteria 4722
185 Ga0501079_0121409 3300049741 Bacteria 2032
186 Ga0501081_0031167 3300049743 Bacteria 3613
187 Ga0501081_0208909 3300049743 Bacteria 1417
188 Ga0501083_0366424 3300049744 Bacteria 937
189 Ga0501045_0000704 3300049824 Bacteria 21248
190 Ga0501045_0045074 3300049824 Bacteria 3211
191 Ga0501045_0246383 3300049824 Bacteria 1330
192 nmdc:mga05p37_172749_c1 3300050507 Bacteria 2635
193 nmdc:mga05p37_477842_c1 3300050507 Bacteria 1436
194 nmdc:mga0qj67_61063_c1 3300050509 Bacteria 2992
195 nmdc:mga06r32_341540_c1 3300050510 Bacteria 1482
196 Ga0495601_0021126 3300053077 Bacteria 3983
197 Ga0495612_0015297 3300053078 Bacteria 3076
198 Ga0495595_0022511 3300053084 Bacteria 2766
199 Ga0495619_0003487 3300053085 Bacteria 10155
200 Ga0495619_0006684 3300053085 Bacteria 7295
201 Ga0500616_0153142 3300053153 Bacteria 1065
202 Ga0501084_0000697 3300054114 Bacteria 25775
203 Ga0501084_0111924 3300054114 Bacteria 2294
204 Ga0590075_002880 3300059424 Bacteria 4099
205 Ga0501082_0011400 3300060353 Bacteria 7648
206 Ga0530510_0005518 3300061734 Bacteria 8760
207 2776373433 2775506925 Bacteria 7237746
208 2863068782 2863067949 Bacteria 8541735
209 2866553193 2866552031 Bacteria 5824618
210 2899376471 2899370129 Bacteria 6781179
211 2917736238 2917736166 Bacteria 9690793
212 8003315572 8003314358 Bacteria 10575343
213 8003320766 8003314358 Bacteria 10575343
214 8056215531 8056207758 Bacteria 8639239
215 Ga0500559_0004869
216 Ga0070658_10015354
217 Ga0070658_10338932
218 Ga0070690_100028692
219 Ga0068869_100241263
220 Ga0070680_100019986
221 Ga0070660_100056211
222 Ga0070660_100206246
223 Ga0070660_100288331
224 Ga0070668_100008134
225 Ga0070674_100049672
226 Ga0070659_100002235
227 Ga0070659_100416907
228 Ga0070709_10046582
229 Ga0070713_100046035
230 Ga0070663_100000117
231 Ga0070678_100017550
232 Ga0070681_10000019
233 Ga0070681_10012556
234 Ga0070681_10047600
235 Ga0070681_10154283
236 Ga0068867_100029119
237 Ga0070706_100075252
238 Ga0070707_100014995
239 Ga0070707_100091073
240 Ga0070707_100093580
241 Ga0070707_100186310
242 Ga0070698_100233953
243 Ga0070699_100044479
244 Ga0070679_100024866
245 Ga0070679_100030451
246 Ga0070679_100076198
247 Ga0070679_100126503
248 Ga0070679_100221873
249 Ga0081455_10000258
250 Ga0081455_10248735
251 Ga0081538_10004035
252 Ga0081538_10004916
253 Ga0081538_10017261
254 Ga0081538_10020312
255 Ga0081538_10040457
256 Ga0081539_10050311
257 Ga0075428_100154062
258 Ga0075430_100068721
259 Ga0075431_100104266
260 Ga0075431_100351073
261 Ga0068865_100018379
262 Ga0105240_10759518
263 Ga0111539_10503596
264 Ga0114129_10107250
265 Ga0105242_10073680
266 Ga0105237_10302101
267 Ga0157369_10010668
268 Ga0157369_10021044
269 Ga0163163_10095948
270 Ga0163163_10563161
271 Ga0197907_10505410
272 Ga0213875_10001950
273 Ga0207705_10002007
274 Ga0207684_10130245
275 Ga0207707_10020824
276 Ga0207707_10022313
277 Ga0207671_10189275
278 Ga0207660_10002144
279 Ga0207657_10046254
280 Ga0207657_10185201
281 Ga0207657_10270635
282 Ga0207652_10001128
283 Ga0207652_10017548
284 Ga0207652_10182200
285 Ga0207652_10265237
286 Ga0207646_10018823
287 Ga0207646_10130499
288 Ga0207646_10177355
289 Ga0207690_10000089
290 Ga0207686_10038291
291 Ga0207686_10240473
292 Ga0207669_10036850
293 Ga0207704_10109779
294 Ga0207689_10243332
295 Ga0207668_10018511
296 Ga0207678_10000093
297 Ga0207708_10077113
298 Ga0207648_10278254
299 Ga0207683_10176385
300 Ga0268266_10611067
301 Ga0307514_10292367
302 Ga0307413_10034145
303 Ga0307518_10009045
304 Ga0307410_10150689
305 Ga0307406_10182391
306 Ga0307407_10009811
307 Ga0307407_10146809
308 Ga0307407_10160045
309 Ga0307409_100017103
310 Ga0307409_100309000
311 Ga0307416_100079162
312 Ga0307416_100116678
313 Ga0307414_10141349
314 Ga0307414_10569983
315 Ga0307415_100045904
316 Ga0307415_100108733
317 Ga0307507_10003547
318 Ga0373936_0002884
319 Ga0373953_0004757
320 Ga0373954_0031582
321 Ga0373956_0086128
322 Ga0373957_0003229
323 Ga0373933_0029931
324 Ga0373947_0054445
325 Ga0373947_0180392
326 Ga0373937_0005800
327 Ga0373937_0353492
328 Ga0373925_0119248
329 Ga0395899_0110628
330 Ga0395900_0031892
331 Ga0395900_0443552
332 Ga0436364_1232097
333 Ga0395901_0045674
334 Ga0466961_0001004
335 Ga0466961_0193581
336 Ga0466963_0397476
337 Ga0466964_0024172
338 Ga0466960_0155169
339 Ga0466959_0069096
340 Ga0466958_0067029
341 Ga0466967_0155474
342 Ga0495629_0008508
343 Ga0495641_0008903
344 Ga0495653_0128549
345 Ga0495653_0139915
346 Ga0495582_0033419
347 Ga0495639_0050185
348 Ga0495662_0006236
349 Ga0495664_0081688
350 Ga0495608_0007272
351 Ga0495618_0027875
352 Ga0495618_0175936
353 Ga0495628_0082404
354 Ga0495630_0151809
355 Ga0495652_0108335
356 Ga0495665_0042201
357 Ga0495640_0021575
358 Ga0495586_0045380
359 Ga0495587_0026833
360 Ga0495645_0057580
361 Ga0495667_0010773
362 Ga0495667_0064680
363 Ga0495634_0007214
364 Ga0495635_0207501
365 Ga0495657_0033221
366 Ga0495657_0136880
367 Ga0495599_0099809
368 Ga0495623_0113217
369 Ga0495646_0251385
370 Ga0495658_0019088
371 Ga0495613_0039891
372 Ga0495613_0191106
373 Ga0495624_0009609
374 Ga0495624_0050564
375 Ga0495600_0004910
376 Ga0495581_0015547
377 Ga0495674_0162211
378 Ga0495680_0055639
379 Ga0495593_0005204
380 Ga0495602_0181694
381 Ga0496100_0562348
382 Ga0496110_0512522
383 Ga0496115_0017335
384 Ga0501318_008959
385 Ga0501321_007955
386 Ga0501036_0005291
387 Ga0501038_0011069
388 Ga0501039_0211441
389 Ga0501040_0008011
390 Ga0501041_0171791
391 Ga0501042_0181688
392 Ga0501070_0013852
393 Ga0501071_0030890
394 Ga0501072_0053893
395 Ga0501074_0048012
396 Ga0501076_0009123
397 Ga0501077_0068830
398 Ga0501079_0023583
399 Ga0501079_0121409
400 Ga0501081_0031167
401 Ga0501081_0208909
402 Ga0501083_0366424
403 Ga0501045_0000704
404 Ga0501045_0045074
405 Ga0501045_0246383
406 nmdc:mga05p37_172749_c1
407 nmdc:mga05p37_477842_c1
408 nmdc:mga0qj67_61063_c1
409 nmdc:mga06r32_341540_c1
410 Ga0495601_0021126
411 Ga0495612_0015297
412 Ga0495595_0022511
413 Ga0495619_0003487
414 Ga0495619_0006684
415 Ga0500616_0153142
416 Ga0501084_0000697
417 Ga0501084_0111924
418 Ga0590075_002880
419 Ga0501082_0011400
420 Ga0530510_0005518
421 2776373433
422 2863068782
423 2866553193
424 2899376471
425 2917736238
426 8003315572
427 8003320766
428 8056215531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

4

175

0.99

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

180

268

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dqx-assembly1.cif.gz_E crystal structure of xanthine dehydrogenase family protein 0.9113 1 269
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.911 1 269
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9094 1 271
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9072 1 271
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9057 1 269
ID Description Score Start End Superfamily
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9743 61 173 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9652 61 173 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9621 59 174 3.30.465.10
af_Q46800_56_173_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9595 59 173 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9577 61 173 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A3D4YMN0-F1-model_v4 Carbon monoxide dehydrogenase 0.9682 145 272
AF-A0A1W9WKL7-F1-model_v4 Molybdopterin dehydrogenase 0.9616 44 173 GO:0016491
GO:0071949
AF-A0A3D4YMN0-F1-model_v4 Carbon monoxide dehydrogenase 0.9608 145 272
AF-A0A7W1LJ48-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9585 145 269
AF-A0A7W1UWN2-F1-model_v4 FAD binding domain-containing protein 0.9511 128 272 GO:0016491
GO:0050660

Map