F325757

General Info

Members Datasets Scaffolds Average Seq Length
214 136 214 179

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_65251_c1|nmdc:mga0k408_65251_c1_1149_1748
Length 199
Sequence VREPIIMRLESDIVESGGAMQSLEMNLTQYAAYHRDRRNIATHFVGIPMIVFAIVLGLATVWIPAGELTLTLAAILSVAACIYYFRLDFVFGVVMAATLFVMCAGASEVIHRLGGGAALGLAAVIFVAGWALQFLGHKWEGMKPAFYDDAKQLLIGPLFVWAEVLFLLGALPALRRYIEDRVGPTVARRDGRPLPLTEG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 1.87
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10164469 3300005327 Bacteria 1863
2 Ga0070658_10365184 3300005327 Bacteria 1237
3 Ga0070658_10466860 3300005327 Bacteria 1088
4 Ga0070683_100720229 3300005329 Bacteria 956
5 Ga0068869_100418130 3300005334 Bacteria 1106
6 Ga0070680_100894827 3300005336 Bacteria 766
7 Ga0068868_100137294 3300005338 Bacteria 2005
8 Ga0068868_100357195 3300005338 Bacteria 1253
9 Ga0070660_100158626 3300005339 Bacteria 1822
10 Ga0070689_100030439 3300005340 Bacteria 4097
11 Ga0070689_100129668 3300005340 Bacteria 2021
12 Ga0070689_100238578 3300005340 Bacteria 1497
13 Ga0070689_100697908 3300005340 Bacteria 886
14 Ga0070687_100157713 3300005343 Bacteria 1338
15 Ga0070687_100533531 3300005343 Bacteria 795
16 Ga0070661_100041574 3300005344 Bacteria 3354
17 Ga0070675_100020445 3300005354 Bacteria 5283
18 Ga0070675_100380897 3300005354 Bacteria 1256
19 Ga0070671_100594726 3300005355 Bacteria 956
20 Ga0070674_100430485 3300005356 Bacteria 1085
21 Ga0070674_100788529 3300005356 Bacteria 819
22 Ga0070673_100064405 3300005364 Bacteria 2920
23 Ga0070673_100243222 3300005364 Bacteria 1565
24 Ga0070673_100355073 3300005364 Bacteria 1302
25 Ga0070688_100033403 3300005365 Bacteria 3110
26 Ga0070659_100016665 3300005366 Bacteria 5519
27 Ga0070659_100439841 3300005366 Bacteria 1105
28 Ga0070713_100044692 3300005436 Bacteria 3626
29 Ga0070701_10019633 3300005438 Bacteria 3195
30 Ga0070701_10024126 3300005438 Bacteria 2939
31 Ga0070705_100258892 3300005440 Bacteria 1226
32 Ga0070678_101264578 3300005456 Bacteria 686
33 Ga0070681_10793394 3300005458 Bacteria 864
34 Ga0068867_100056909 3300005459 Bacteria 2894
35 Ga0068867_100795406 3300005459 Bacteria 843
36 Ga0070685_10109892 3300005466 Bacteria 1697
37 Ga0070685_10760748 3300005466 Bacteria 711
38 Ga0070679_100015893 3300005530 Bacteria 7244
39 Ga0070684_100341060 3300005535 Bacteria 1378
40 Ga0068853_100057672 3300005539 Bacteria 3352
41 Ga0068853_100632336 3300005539 Bacteria 1018
42 Ga0068853_101672221 3300005539 Bacteria 617
43 Ga0070672_100084115 3300005543 Bacteria 2554
44 Ga0070686_100504907 3300005544 Bacteria 939
45 Ga0070693_100010063 3300005547 Bacteria 4722
46 Ga0070693_100635461 3300005547 Bacteria 775
47 Ga0070665_100087221 3300005548 Bacteria 3126
48 Ga0070704_100025868 3300005549 Bacteria 3869
49 Ga0068855_100120974 3300005563 Bacteria 2996
50 Ga0070664_100474094 3300005564 Bacteria 1151
51 Ga0068857_100157600 3300005577 Bacteria 2059
52 Ga0068854_100209441 3300005578 Bacteria 1537
53 Ga0068854_100284825 3300005578 Bacteria 1332
54 Ga0068856_100360411 3300005614 Bacteria 1473
55 Ga0070702_100073743 3300005615 Bacteria 2023
56 Ga0068852_100000134 3300005616 Bacteria 49788
57 Ga0068852_100024559 3300005616 Bacteria 4873
58 Ga0068852_100111902 3300005616 Bacteria 2484
59 Ga0068852_100180758 3300005616 Bacteria 1983
60 Ga0068852_100894582 3300005616 Bacteria 905
61 Ga0068859_100075552 3300005617 Bacteria 3410
62 Ga0068859_100450147 3300005617 Bacteria 1384
63 Ga0068864_100590803 3300005618 Bacteria 1077
64 Ga0068864_100778573 3300005618 Bacteria 939
65 Ga0068864_101222350 3300005618 Bacteria 750
66 Ga0068861_100301782 3300005719 Bacteria 1387
67 Ga0068851_10006365 3300005834 Bacteria 5389
68 Ga0068851_10221029 3300005834 Bacteria 1064
69 Ga0068851_10510243 3300005834 Bacteria 722
70 Ga0068870_10603036 3300005840 Bacteria 746
71 Ga0068863_100544480 3300005841 Bacteria 1145
72 Ga0068858_100011629 3300005842 Bacteria 8303
73 Ga0068860_100206755 3300005843 Bacteria 1904
74 Ga0068862_100557766 3300005844 Bacteria 1095
75 Ga0075364_10049385 3300006051 Bacteria 2743
76 Ga0075364_10616930 3300006051 Bacteria 741
77 Ga0075366_10020636 3300006195 Bacteria 3825
78 Ga0097621_100008122 3300006237 Bacteria 7545
79 Ga0097621_100018356 3300006237 Bacteria 5340
80 Ga0068871_100006223 3300006358 Bacteria 8418
81 Ga0068871_100835175 3300006358 Bacteria 851
82 Ga0075428_100087111 3300006844 Bacteria 3407
83 Ga0075434_100923046 3300006871 Bacteria 888
84 Ga0075429_100289169 3300006880 Bacteria 1435
85 Ga0097620_100075558 3300006931 Bacteria 3410
86 Ga0097620_100450142 3300006931 Bacteria 1384
87 Ga0105240_10064089 3300009093 Bacteria 4568
88 Ga0105240_11156129 3300009093 Bacteria 821
89 Ga0111539_10013444 3300009094 Bacteria 10231
90 Ga0105245_10129189 3300009098 Bacteria 2368
91 Ga0105245_10139296 3300009098 Bacteria 2283
92 Ga0105245_10162377 3300009098 Bacteria 2121
93 Ga0105243_10124963 3300009148 Bacteria 2175
94 Ga0105241_11060642 3300009174 Bacteria 761
95 Ga0105242_10004379 3300009176 Bacteria 10984
96 Ga0105242_10096869 3300009176 Bacteria 2493
97 Ga0105242_10347204 3300009176 Bacteria 1369
98 Ga0105242_11012984 3300009176 Bacteria 839
99 Ga0105248_10146979 3300009177 Bacteria 2660
100 Ga0105248_10478540 3300009177 Bacteria 1403
101 Ga0105248_10504642 3300009177 Bacteria 1364
102 Ga0105248_10808249 3300009177 Bacteria 1058
103 Ga0105238_10039623 3300009551 Bacteria 4777
104 Ga0105249_10336968 3300009553 Bacteria 1524
105 Ga0157370_10290187 3300013104 Bacteria 1511
106 Ga0157369_10016993 3300013105 Bacteria 8177
107 Ga0157374_10300034 3300013296 Bacteria 1589
108 Ga0157374_10538046 3300013296 Bacteria 1175
109 Ga0163162_10109942 3300013306 Bacteria 2853
110 Ga0163162_10319207 3300013306 Bacteria 1686
111 Ga0163162_10508465 3300013306 Bacteria 1335
112 Ga0157372_10012757 3300013307 Bacteria 8953
113 Ga0157380_10365392 3300014326 Bacteria 1356
114 Ga0157380_10514152 3300014326 Bacteria 1166
115 Ga0157377_10321512 3300014745 Bacteria 1028
116 Ga0157379_10091401 3300014968 Bacteria 2730
117 Ga0157379_10129212 3300014968 Bacteria 2273
118 Ga0157376_10127459 3300014969 Bacteria 2266
119 Ga0157376_10646526 3300014969 Bacteria 1057
120 Ga0163161_10243910 3300017792 Bacteria 1398
121 Ga0213876_10331326 3300021384 Bacteria 809
122 Ga0207656_10003114 3300025321 Bacteria 5682
123 Ga0207656_10385599 3300025321 Bacteria 703
124 Ga0207643_10016889 3300025908 Bacteria 3982
125 Ga0207705_10092804 3300025909 Bacteria 2212
126 Ga0207705_10152435 3300025909 Bacteria 1732
127 Ga0207705_10164295 3300025909 Bacteria 1669
128 Ga0207705_10491703 3300025909 Bacteria 953
129 Ga0207695_10068102 3300025913 Bacteria 3648
130 Ga0207695_10781010 3300025913 Bacteria 835
131 Ga0207660_10603542 3300025917 Bacteria 894
132 Ga0207649_10363478 3300025920 Bacteria 1075
133 Ga0207649_10671991 3300025920 Bacteria 802
134 Ga0207652_10014243 3300025921 Bacteria 6441
135 Ga0207652_10507896 3300025921 Bacteria 1085
136 Ga0207694_10352083 3300025924 Bacteria 1219
137 Ga0207694_10794884 3300025924 Bacteria 799
138 Ga0207659_10047128 3300025926 Bacteria 3047
139 Ga0207687_10161390 3300025927 Bacteria 1720
140 Ga0207700_10036469 3300025928 Bacteria 3552
141 Ga0207690_10114432 3300025932 Bacteria 1948
142 Ga0207690_10553249 3300025932 Bacteria 936
143 Ga0207686_10537123 3300025934 Bacteria 912
144 Ga0207709_10064933 3300025935 Bacteria 2293
145 Ga0207709_10785108 3300025935 Bacteria 768
146 Ga0207670_10006546 3300025936 Bacteria 6468
147 Ga0207670_10736420 3300025936 Bacteria 818
148 Ga0207669_10458992 3300025937 Bacteria 1011
149 Ga0207691_10002413 3300025940 Bacteria 18292
150 Ga0207711_10117600 3300025941 Bacteria 2371
151 Ga0207689_10022545 3300025942 Bacteria 5292
152 Ga0207689_10139493 3300025942 Bacteria 1997
153 Ga0207689_11318317 3300025942 Bacteria 606
154 Ga0207667_10189697 3300025949 Bacteria 2109
155 Ga0207651_10341472 3300025960 Bacteria 1258
156 Ga0207712_10784384 3300025961 Bacteria 837
157 Ga0207640_10060372 3300025981 Bacteria 2506
158 Ga0207677_10040159 3300026023 Bacteria 3082
159 Ga0207677_10446903 3300026023 Bacteria 1107
160 Ga0207677_11014160 3300026023 Bacteria 753
161 Ga0207703_10044914 3300026035 Bacteria 3552
162 Ga0207639_10959631 3300026041 Bacteria 800
163 Ga0207708_10384694 3300026075 Bacteria 1157
164 Ga0207708_10422070 3300026075 Bacteria 1106
165 Ga0207641_10100048 3300026088 Bacteria 2553
166 Ga0207648_10029398 3300026089 Bacteria 4874
167 Ga0207648_10369873 3300026089 Bacteria 1295
168 Ga0207676_10749165 3300026095 Bacteria 950
169 Ga0207676_11435864 3300026095 Bacteria 686
170 Ga0207674_10085282 3300026116 Bacteria 3154
171 Ga0207675_100874411 3300026118 Bacteria 914
172 Ga0207698_10001165 3300026142 Bacteria 15335
173 Ga0207698_10006071 3300026142 Bacteria 7514
174 Ga0207698_10085951 3300026142 Bacteria 2556
175 Ga0207698_10099244 3300026142 Bacteria 2408
176 Ga0268266_10113042 3300028379 Bacteria 2408
177 Ga0268266_10116823 3300028379 Bacteria 2370
178 Ga0268266_10863046 3300028379 Bacteria 875
179 Ga0268265_10750753 3300028380 Bacteria 947
180 Ga0268264_10262156 3300028381 Bacteria 1610
181 Ga0268264_10875672 3300028381 Bacteria 900
182 Ga0265314_10194802 3300031711 Bacteria 1203
183 Ga0307405_10264101 3300031731 Bacteria 1287
184 Ga0307405_10268601 3300031731 Bacteria 1278
185 Ga0307412_10377344 3300031911 Bacteria 1147
186 Ga0307412_10444111 3300031911 Bacteria 1067
187 Ga0307416_100369625 3300032002 Bacteria 1460
188 Ga0307416_100408770 3300032002 Bacteria 1397
189 Ga0307416_101548695 3300032002 Bacteria 768
190 Ga0307411_10810871 3300032005 Bacteria 825
191 Ga0373931_0035157 3300035691 Bacteria 2604
192 Ga0373931_0468071 3300035691 Bacteria 808
193 Ga0373931_0531367 3300035691 Bacteria 762
194 Ga0395900_0960303 3300037418 Bacteria 776
195 Ga0395901_1059516 3300038443 Bacteria 783
196 Ga0436365_1533942 3300039437 Bacteria 3044
197 Ga0451807_1906558 3300041486 Bacteria 627
198 Ga0439444_0049837 3300042437 Bacteria 848
199 Ga0451577_0038326 3300042876 Bacteria 4312
200 Ga0466961_0554570 3300044693 Bacteria 692
201 Ga0466957_0016609 3300044842 Bacteria 4305
202 Ga0466959_0151273 3300045049 Bacteria 1636
203 Ga0466958_0189117 3300045836 Bacteria 1308
204 Ga0495621_0230601 3300046539 Bacteria 752
205 Ga0495647_0088710 3300046681 Bacteria 1265
206 Ga0495658_0382401 3300046683 Bacteria 896
207 Ga0496104_0123528 3300048907 Bacteria 2485
208 Ga0496105_0149919 3300048908 Bacteria 1917
209 Ga0496110_0054448 3300048913 Bacteria 3519
210 nmdc:mga00v17_293742_c1 3300050491 Bacteria 1055
211 nmdc:mga0k408_65251_c1 3300050493 Bacteria 2119
212 nmdc:mga0k408_7248_c1 3300050493 Bacteria 5927
213 nmdc:mga09592_268275_c1 3300050508 Bacteria 1480
214 nmdc:mga08y16_1442_c1 3300050511 Bacteria 23816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005356 Ga0070674_100430485 Ga0070674_1004304852 157
2 3300005456 Ga0070678_101264578 Ga0070678_1012645781 157
3 3300025937 Ga0207669_10458992 Ga0207669_104589921 157
4 3300005618 Ga0068864_101222350 Ga0068864_1012223501 160
5 3300009177 Ga0105248_10504642 Ga0105248_105046421 160
6 3300009177 Ga0105248_10808249 Ga0105248_108082492 160
7 3300005539 Ga0068853_101672221 Ga0068853_1016722211 161
8 3300005327 Ga0070658_10365184 Ga0070658_103651842 163
9 3300005618 Ga0068864_100590803 Ga0068864_1005908032 163
10 3300005834 Ga0068851_10221029 Ga0068851_102210292 163
11 3300009148 Ga0105243_10124963 Ga0105243_101249632 163
12 3300013306 Ga0163162_10109942 Ga0163162_101099423 163
13 3300014968 Ga0157379_10129212 Ga0157379_101292122 163
14 3300025321 Ga0207656_10385599 Ga0207656_103855991 163
15 3300025961 Ga0207712_10784384 Ga0207712_107843842 163
16 3300005436 Ga0070713_100044692 Ga0070713_1000446921 164
17 3300025928 Ga0207700_10036469 Ga0207700_100364691 164
18 3300009176 Ga0105242_11012984 Ga0105242_110129841 165
19 3300013306 Ga0163162_10508465 Ga0163162_105084652 165
20 3300014969 Ga0157376_10127459 Ga0157376_101274592 165
21 3300026118 Ga0207675_100874411 Ga0207675_1008744111 165
22 3300005844 Ga0068862_100557766 Ga0068862_1005577662 166
23 3300006195 Ga0075366_10020636 Ga0075366_100206363 166
24 3300006358 Ga0068871_100835175 Ga0068871_1008351751 166
25 3300017792 Ga0163161_10243910 Ga0163161_102439103 166
26 3300028380 Ga0268265_10750753 Ga0268265_107507532 166
27 3300050493 nmdc:mga0k408_7248_c1 nmdc:mga0k408_7248_c1_1437_1964 166
28 3300005334 Ga0068869_100418130 Ga0068869_1004181302 167
29 3300005354 Ga0070675_100380897 Ga0070675_1003808972 167
30 3300005459 Ga0068867_100056909 Ga0068867_1000569091 167
31 3300005466 Ga0070685_10760748 Ga0070685_107607481 167
32 3300005615 Ga0070702_100073743 Ga0070702_1000737432 167
33 3300009177 Ga0105248_10478540 Ga0105248_104785402 167
34 3300014745 Ga0157377_10321512 Ga0157377_103215122 167
35 3300025920 Ga0207649_10671991 Ga0207649_106719911 167
36 3300025936 Ga0207670_10736420 Ga0207670_107364202 167
37 3300026089 Ga0207648_10029398 Ga0207648_100293982 167
38 3300009093 Ga0105240_10064089 Ga0105240_100640892 168
39 3300031731 Ga0307405_10264101 Ga0307405_102641012 168
40 3300031911 Ga0307412_10444111 Ga0307412_104441111 168
41 3300032002 Ga0307416_101548695 Ga0307416_1015486951 168
42 3300046681 Ga0495647_0088710 Ga0495647_0088710_194_733 168
43 3300005338 Ga0068868_100137294 Ga0068868_1001372942 170
44 3300005355 Ga0070671_100594726 Ga0070671_1005947261 170
45 3300005616 Ga0068852_100000134 Ga0068852_10000013424 170
46 3300005834 Ga0068851_10006365 Ga0068851_100063655 170
47 3300006237 Ga0097621_100008122 Ga0097621_1000081222 170
48 3300006358 Ga0068871_100006223 Ga0068871_1000062235 170
49 3300009553 Ga0105249_10336968 Ga0105249_103369681 170
50 3300025321 Ga0207656_10003114 Ga0207656_100031144 170
51 3300025913 Ga0207695_10068102 Ga0207695_100681023 170
52 3300026023 Ga0207677_10040159 Ga0207677_100401593 170
53 3300026142 Ga0207698_10001165 Ga0207698_100011653 170
54 3300048907 Ga0496104_0123528 Ga0496104_0123528_1895_2434 170
55 3300048908 Ga0496105_0149919 Ga0496105_0149919_527_1066 170
56 3300048913 Ga0496110_0054448 Ga0496110_0054448_1960_2499 170
57 3300041486 Ga0451807_1906558 Ga0451807_1906558_33_587 173
58 3300005547 Ga0070693_100635461 Ga0070693_1006354611 174
59 3300025942 Ga0207689_11318317 Ga0207689_113183171 175
60 3300005340 Ga0070689_100238578 Ga0070689_1002385782 177
61 3300005364 Ga0070673_100355073 Ga0070673_1003550732 177
62 3300005564 Ga0070664_100474094 Ga0070664_1004740942 177
63 3300005340 Ga0070689_100697908 Ga0070689_1006979082 178
64 3300005343 Ga0070687_100157713 Ga0070687_1001577132 178
65 3300005343 Ga0070687_100533531 Ga0070687_1005335311 178
66 3300005364 Ga0070673_100243222 Ga0070673_1002432222 178
67 3300005438 Ga0070701_10019633 Ga0070701_100196334 178
68 3300005459 Ga0068867_100795406 Ga0068867_1007954062 178
69 3300005548 Ga0070665_100087221 Ga0070665_1000872212 178
70 3300005549 Ga0070704_100025868 Ga0070704_1000258682 178
71 3300005578 Ga0068854_100284825 Ga0068854_1002848252 178
72 3300005617 Ga0068859_100075552 Ga0068859_1000755525 178
73 3300005618 Ga0068864_100778573 Ga0068864_1007785732 178
74 3300005840 Ga0068870_10603036 Ga0068870_106030362 178
75 3300005843 Ga0068860_100206755 Ga0068860_1002067552 178
76 3300006051 Ga0075364_10049385 Ga0075364_100493853 178
77 3300006931 Ga0097620_100075558 Ga0097620_1000755585 178
78 3300009093 Ga0105240_11156129 Ga0105240_111561292 178
79 3300009098 Ga0105245_10162377 Ga0105245_101623772 178
80 3300009176 Ga0105242_10096869 Ga0105242_100968692 178
81 3300025913 Ga0207695_10781010 Ga0207695_107810102 178
82 3300025934 Ga0207686_10537123 Ga0207686_105371232 178
83 3300025935 Ga0207709_10064933 Ga0207709_100649334 178
84 3300025960 Ga0207651_10341472 Ga0207651_103414722 178
85 3300025981 Ga0207640_10060372 Ga0207640_100603723 178
86 3300026023 Ga0207677_11014160 Ga0207677_110141601 178
87 3300026095 Ga0207676_10749165 Ga0207676_107491652 178
88 3300028379 Ga0268266_10116823 Ga0268266_101168234 178
89 3300028381 Ga0268264_10262156 Ga0268264_102621562 178
90 3300035691 Ga0373931_0531367 Ga0373931_0531367_94_630 178
91 3300042876 Ga0451577_0038326 Ga0451577_0038326_413_961 178
92 3300046539 Ga0495621_0230601 Ga0495621_0230601_179_727 178
93 3300050491 nmdc:mga00v17_293742_c1 nmdc:mga00v17_293742_c1_34_570 178
94 3300005338 Ga0068868_100357195 Ga0068868_1003571952 179
95 3300005340 Ga0070689_100030439 Ga0070689_1000304395 179
96 3300005340 Ga0070689_100129668 Ga0070689_1001296683 179
97 3300005354 Ga0070675_100020445 Ga0070675_1000204454 179
98 3300005356 Ga0070674_100788529 Ga0070674_1007885292 179
99 3300005364 Ga0070673_100064405 Ga0070673_1000644052 179
100 3300005365 Ga0070688_100033403 Ga0070688_1000334033 179
101 3300005438 Ga0070701_10024126 Ga0070701_100241261 179
102 3300005440 Ga0070705_100258892 Ga0070705_1002588922 179
103 3300005466 Ga0070685_10109892 Ga0070685_101098922 179
104 3300005543 Ga0070672_100084115 Ga0070672_1000841153 179
105 3300005544 Ga0070686_100504907 Ga0070686_1005049071 179
106 3300005547 Ga0070693_100010063 Ga0070693_1000100632 179
107 3300005577 Ga0068857_100157600 Ga0068857_1001576002 179
108 3300005616 Ga0068852_100894582 Ga0068852_1008945822 179
109 3300005617 Ga0068859_100450147 Ga0068859_1004501472 179
110 3300005719 Ga0068861_100301782 Ga0068861_1003017822 179
111 3300006051 Ga0075364_10616930 Ga0075364_106169302 179
112 3300006237 Ga0097621_100018356 Ga0097621_1000183567 179
113 3300006871 Ga0075434_100923046 Ga0075434_1009230461 179
114 3300006931 Ga0097620_100450142 Ga0097620_1004501422 179
115 3300009098 Ga0105245_10139296 Ga0105245_101392963 179
116 3300009174 Ga0105241_11060642 Ga0105241_110606422 179
117 3300009176 Ga0105242_10347204 Ga0105242_103472042 179
118 3300013296 Ga0157374_10538046 Ga0157374_105380462 179
119 3300014326 Ga0157380_10365392 Ga0157380_103653922 179
120 3300014326 Ga0157380_10514152 Ga0157380_105141522 179
121 3300014969 Ga0157376_10646526 Ga0157376_106465262 179
122 3300025908 Ga0207643_10016889 Ga0207643_100168893 179
123 3300025926 Ga0207659_10047128 Ga0207659_100471282 179
124 3300025936 Ga0207670_10006546 Ga0207670_100065465 179
125 3300025940 Ga0207691_10002413 Ga0207691_100024132 179
126 3300025942 Ga0207689_10022545 Ga0207689_100225452 179
127 3300025942 Ga0207689_10139493 Ga0207689_101394932 179
128 3300026023 Ga0207677_10446903 Ga0207677_104469032 179
129 3300026041 Ga0207639_10959631 Ga0207639_109596312 179
130 3300026075 Ga0207708_10384694 Ga0207708_103846942 179
131 3300026075 Ga0207708_10422070 Ga0207708_104220702 179
132 3300026088 Ga0207641_10100048 Ga0207641_101000483 179
133 3300026089 Ga0207648_10369873 Ga0207648_103698732 179
134 3300026095 Ga0207676_11435864 Ga0207676_114358642 179
135 3300026116 Ga0207674_10085282 Ga0207674_100852823 179
136 3300028379 Ga0268266_10863046 Ga0268266_108630462 179
137 3300035691 Ga0373931_0035157 Ga0373931_0035157_693_1280 179
138 3300046683 Ga0495658_0382401 Ga0495658_0382401_50_589 179
139 3300005339 Ga0070660_100158626 Ga0070660_1001586262 180
140 3300005841 Ga0068863_100544480 Ga0068863_1005444802 180
141 3300005842 Ga0068858_100011629 Ga0068858_10001162910 180
142 3300009098 Ga0105245_10129189 Ga0105245_101291893 180
143 3300009176 Ga0105242_10004379 Ga0105242_100043792 180
144 3300009177 Ga0105248_10146979 Ga0105248_101469792 180
145 3300014968 Ga0157379_10091401 Ga0157379_100914012 180
146 3300025924 Ga0207694_10794884 Ga0207694_107948841 180
147 3300025927 Ga0207687_10161390 Ga0207687_101613901 180
148 3300025935 Ga0207709_10785108 Ga0207709_107851081 180
149 3300025941 Ga0207711_10117600 Ga0207711_101176002 180
150 3300026035 Ga0207703_10044914 Ga0207703_100449144 180
151 3300028381 Ga0268264_10875672 Ga0268264_108756722 180
152 3300031711 Ga0265314_10194802 Ga0265314_101948022 180
153 3300032002 Ga0307416_100369625 Ga0307416_1003696252 180
154 3300035691 Ga0373931_0468071 Ga0373931_0468071_69_647 180
155 3300050493 nmdc:mga0k408_65251_c1 nmdc:mga0k408_65251_c1_1149_1748 180
156 3300013296 Ga0157374_10300034 Ga0157374_103000342 181
157 3300013306 Ga0163162_10319207 Ga0163162_103192072 181
158 3300005327 Ga0070658_10466860 Ga0070658_104668602 183
159 3300005329 Ga0070683_100720229 Ga0070683_1007202291 183
160 3300005344 Ga0070661_100041574 Ga0070661_1000415744 183
161 3300005366 Ga0070659_100016665 Ga0070659_1000166653 183
162 3300005366 Ga0070659_100439841 Ga0070659_1004398412 183
163 3300005458 Ga0070681_10793394 Ga0070681_107933942 183
164 3300005535 Ga0070684_100341060 Ga0070684_1003410602 183
165 3300005539 Ga0068853_100057672 Ga0068853_1000576724 183
166 3300005539 Ga0068853_100632336 Ga0068853_1006323362 183
167 3300005563 Ga0068855_100120974 Ga0068855_1001209744 183
168 3300005578 Ga0068854_100209441 Ga0068854_1002094412 183
169 3300005614 Ga0068856_100360411 Ga0068856_1003604112 183
170 3300005616 Ga0068852_100024559 Ga0068852_1000245593 183
171 3300005616 Ga0068852_100111902 Ga0068852_1001119022 183
172 3300006844 Ga0075428_100087111 Ga0075428_1000871115 183
173 3300006880 Ga0075429_100289169 Ga0075429_1002891692 183
174 3300009094 Ga0111539_10013444 Ga0111539_100134446 183
175 3300009551 Ga0105238_10039623 Ga0105238_100396233 183
176 3300013104 Ga0157370_10290187 Ga0157370_102901872 183
177 3300013105 Ga0157369_10016993 Ga0157369_100169936 183
178 3300013307 Ga0157372_10012757 Ga0157372_100127577 183
179 3300021384 Ga0213876_10331326 Ga0213876_103313262 183
180 3300025909 Ga0207705_10152435 Ga0207705_101524352 183
181 3300025909 Ga0207705_10164295 Ga0207705_101642952 183
182 3300025920 Ga0207649_10363478 Ga0207649_103634782 183
183 3300025921 Ga0207652_10507896 Ga0207652_105078962 183
184 3300025932 Ga0207690_10114432 Ga0207690_101144322 183
185 3300025932 Ga0207690_10553249 Ga0207690_105532492 183
186 3300025949 Ga0207667_10189697 Ga0207667_101896973 183
187 3300026142 Ga0207698_10085951 Ga0207698_100859513 183
188 3300026142 Ga0207698_10099244 Ga0207698_100992443 183
189 3300028379 Ga0268266_10113042 Ga0268266_101130422 183
190 3300031731 Ga0307405_10268601 Ga0307405_102686012 183
191 3300031911 Ga0307412_10377344 Ga0307412_103773441 183
192 3300032002 Ga0307416_100408770 Ga0307416_1004087702 183
193 3300032005 Ga0307411_10810871 Ga0307411_108108712 183
194 3300037418 Ga0395900_0960303 Ga0395900_0960303_113_664 183
195 3300038443 Ga0395901_1059516 Ga0395901_1059516_191_742 183
196 3300039437 Ga0436365_1533942 Ga0436365_1533942_2351_2905 183
197 3300042437 Ga0439444_0049837 Ga0439444_0049837_270_821 183
198 3300044693 Ga0466961_0554570 Ga0466961_0554570_92_643 183
199 3300044842 Ga0466957_0016609 Ga0466957_0016609_3159_3710 183
200 3300045049 Ga0466959_0151273 Ga0466959_0151273_520_1071 183
201 3300045836 Ga0466958_0189117 Ga0466958_0189117_245_796 183
202 3300050508 nmdc:mga09592_268275_c1 nmdc:mga09592_268275_c1_763_1314 183
203 3300050511 nmdc:mga08y16_1442_c1 nmdc:mga08y16_1442_c1_15692_16243 183
204 3300005327 Ga0070658_10164469 Ga0070658_101644693 184
205 3300005336 Ga0070680_100894827 Ga0070680_1008948271 184
206 3300005530 Ga0070679_100015893 Ga0070679_1000158934 184
207 3300005616 Ga0068852_100180758 Ga0068852_1001807581 184
208 3300005834 Ga0068851_10510243 Ga0068851_105102432 184
209 3300025909 Ga0207705_10092804 Ga0207705_100928043 184
210 3300025909 Ga0207705_10491703 Ga0207705_104917031 184
211 3300025917 Ga0207660_10603542 Ga0207660_106035422 184
212 3300025921 Ga0207652_10014243 Ga0207652_100142433 184
213 3300025924 Ga0207694_10352083 Ga0207694_103520832 184
214 3300026142 Ga0207698_10006071 Ga0207698_100060719 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

20

168

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h9v-assembly1.cif.gz_4 human atp synthase state 3b (combined) 0.4076 20 116
6b2z-assembly1.cif.gz_5 cryo-em structure of the dimeric fo region of yeast mitochondrial atp synthase 0.3958 17 115
6s1k-assembly1.cif.gz_I e. coli core signaling unit, carrying qqqq receptor mutation 0.3935 20 118
7tkh-assembly1.cif.gz_0 yeast atp synthase state 2catalytic(b) with 10 mm atp backbone model 0.3927 17 115
8h9v-assembly1.cif.gz_4 human atp synthase state 3b (combined) 0.3904 20 116
ID Description Score Start End Superfamily
af_P46889_19_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.616 17 132 1.20.140.150
af_Q8IJ82_12_190_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.4673 29 91 1.20.1540.10
af_P61829_1_76_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.4005 17 115 1.20.20.10
6b2z500 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.3958 17 115 1.20.20.10
af_P61829_1_76_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.3879 17 115 1.20.20.10
ID Description Score Start End GO Terms
AF-A0A0P7XVQ4-F1-model_v4 Membrane protein YGL010W 0.9421 1 163 GO:0016020
GO:0046521
AF-A0A4R6RAG1-F1-model_v4 Putative membrane protein YGL010W 0.9357 1 165 GO:0016020
GO:0046521
AF-A0A257LBA7-F1-model_v4 DUF962 domain-containing protein 0.9354 2 152 GO:0016020
GO:0046521
AF-A0A5B8N0R1-F1-model_v4 DUF962 domain-containing protein 0.9327 4 161 GO:0005783
GO:0016020
GO:0046521
AF-A0A537G5U9-F1-model_v4 DUF962 domain-containing protein 0.93 1 118 GO:0016020
GO:0046521

Feature Viewer

pLDDT pTM Quality
82.64 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map