F325556

General Info

Members Datasets Scaffolds Average Seq Length
214 98 428 143

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0248392|Ga0466967_0248392_724_1221
Length 165
Sequence MSDERPLLPHRDDHDGPVATLWNVDDLYRENILDHYKHPHNWSPPGSPIETPDLEFHDLNPLCGDELTVQLALDAEDRVGDVRFSGHGCAISQAAASMVSDEVKGMPVRDLLGLDRAFVLDLLGIDISATRMKCALLSLKVLKGASLGHAADWEPETPESGLDAA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
11 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
12 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
13 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
14 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
15 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
16 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
17 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
18 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
19 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
32 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
33 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
34 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
35 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
36 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
37 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
38 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
39 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
40 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
41 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
42 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
43 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
44 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
53 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
54 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
55 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
56 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
57 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
58 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
59 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
62 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
63 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
64 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
65 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
70 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
71 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
72 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
73 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
74 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
75 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
76 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
77 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
96 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
97 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
98 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.07
Rhizosphere 78.04
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0248392 3300045976 Bacteria 1699
2 Ga0070658_11033637 3300005327 Bacteria 715
3 Ga0070714_100201610 3300005435 Bacteria 1820
4 Ga0070714_100277191 3300005435 Bacteria 1557
5 Ga0070714_100521784 3300005435 Bacteria 1135
6 Ga0070714_100523311 3300005435 Bacteria 1133
7 Ga0070714_100588841 3300005435 Bacteria 1067
8 Ga0070714_102107325 3300005435 Bacteria 549
9 Ga0070713_100107072 3300005436 Bacteria 2431
10 Ga0070713_100142709 3300005436 Bacteria 2123
11 Ga0070713_100164386 3300005436 Bacteria 1983
12 Ga0070713_100813720 3300005436 Bacteria 896
13 Ga0070710_10008279 3300005437 Bacteria 5062
14 Ga0070710_10740977 3300005437 Bacteria 697
15 Ga0070710_11284896 3300005437 Bacteria 544
16 Ga0070711_100005201 3300005439 Bacteria 7762
17 Ga0070693_100671268 3300005547 Bacteria 756
18 Ga0070665_100001603 3300005548 Bacteria 26029
19 Ga0070717_10004305 3300006028 Bacteria 10266
20 Ga0070717_10072562 3300006028 Bacteria 2874
21 Ga0070717_10121073 3300006028 Bacteria 2242
22 Ga0070717_10181981 3300006028 Bacteria 1832
23 Ga0070717_10226626 3300006028 Bacteria 1644
24 Ga0070717_10670163 3300006028 Bacteria 942
25 Ga0070712_100247909 3300006175 Bacteria 1421
26 Ga0105248_12079512 3300009177 Bacteria 645
27 Ga0157369_11412164 3300013105 Unclassified 709
28 Ga0163162_11777685 3300013306 Bacteria 705
29 Ga0163163_10873738 3300014325 Bacteria 962
30 Ga0213873_10006193 3300021358 Bacteria 2344
31 Ga0213873_10006218 3300021358 Bacteria 2340
32 Ga0213873_10170899 3300021358 Bacteria 663
33 Ga0213874_10005983 3300021377 Bacteria 2859
34 Ga0213876_10021459 3300021384 Bacteria 3415
35 Ga0213876_10030495 3300021384 Bacteria 2844
36 Ga0213876_10142206 3300021384 Bacteria 1276
37 Ga0213875_10000625 3300021388 Bacteria 28322
38 Ga0213875_10132721 3300021388 Bacteria 1165
39 Ga0213875_10168134 3300021388 Bacteria 1029
40 Ga0213875_10410838 3300021388 Bacteria 646
41 Ga0207692_10350314 3300025898 Bacteria 910
42 Ga0207692_11172767 3300025898 Bacteria 510
43 Ga0207699_10255548 3300025906 Bacteria 1209
44 Ga0207705_10406721 3300025909 Bacteria 1053
45 Ga0207695_10701783 3300025913 Bacteria 892
46 Ga0207693_10007522 3300025915 Bacteria 8946
47 Ga0207693_10081363 3300025915 Bacteria 2535
48 Ga0207663_10046735 3300025916 Bacteria 2668
49 Ga0207700_10074448 3300025928 Bacteria 2627
50 Ga0207700_11390754 3300025928 Bacteria 624
51 Ga0207664_10002150 3300025929 Bacteria 12949
52 Ga0207664_10143756 3300025929 Bacteria 2021
53 Ga0207664_10196497 3300025929 Bacteria 1739
54 Ga0207664_10243182 3300025929 Bacteria 1568
55 Ga0207664_10294907 3300025929 Bacteria 1426
56 Ga0207664_11287773 3300025929 Bacteria 650
57 Ga0207665_10130563 3300025939 Bacteria 1783
58 Ga0207711_10292296 3300025941 Bacteria 1502
59 Ga0207678_10472765 3300026067 Bacteria 1091
60 Ga0268266_10004025 3300028379 Bacteria 14208
61 Ga0373953_0023937 3300035117 Bacteria 2317
62 Ga0373943_0437363 3300035170 Bacteria 759
63 Ga0373946_0516834 3300035171 Bacteria 614
64 Ga0373933_0045708 3300035724 Bacteria 2597
65 Ga0373947_0331692 3300035725 Bacteria 1019
66 Ga0373937_0054982 3300036401 Bacteria 3653
67 Ga0373925_0950898 3300037068 Bacteria 708
68 Ga0436364_0268526 3300037853 Bacteria 4395
69 Ga0436364_0820820 3300037853 Bacteria 608
70 Ga0436364_0842144 3300037853 Bacteria 23644
71 Ga0436364_0848997 3300037853 Bacteria 1557
72 Ga0436364_0993330 3300037853 Bacteria 1039
73 Ga0436364_1031907 3300037853 Bacteria 102112
74 Ga0436364_1245936 3300037853 Bacteria 605
75 Ga0436364_1317744 3300037853 Bacteria 2446
76 Ga0436364_1381546 3300037853 Bacteria 1124
77 Ga0436364_1397381 3300037853 Bacteria 5602
78 Ga0436364_1468831 3300037853 Bacteria 818
79 Ga0436364_1505805 3300037853 Bacteria 2316
80 Ga0436365_0200348 3300039437 Bacteria 2015
81 Ga0436365_0551575 3300039437 Unclassified 782
82 Ga0436365_0687339 3300039437 Unclassified 2026
83 Ga0436365_0780642 3300039437 Bacteria 7020
84 Ga0436365_0982122 3300039437 Bacteria 701
85 Ga0436365_1296982 3300039437 Bacteria 7201
86 Ga0436365_1402107 3300039437 Bacteria 601
87 Ga0436365_1827970 3300039437 Unclassified 551
88 Ga0436360_0522132 3300039438 Bacteria 879
89 Ga0436360_1106670 3300039438 Bacteria 624
90 Ga0436361_0379182 3300039447 Bacteria 915
91 Ga0436361_0788768 3300039447 Bacteria 2015
92 Ga0436363_0150798 3300039450 Bacteria 1403
93 Ga0436363_0187523 3300039450 Bacteria 19050
94 Ga0436363_0313411 3300039450 Bacteria 638
95 Ga0436363_1370544 3300039450 Bacteria 2025
96 Ga0436363_1578803 3300039450 Bacteria 973
97 Ga0436363_1715658 3300039450 Bacteria 684
98 Ga0436362_0035688 3300039453 Bacteria 709
99 Ga0436362_0282709 3300039453 Bacteria 751
100 Ga0436362_0429085 3300039453 Bacteria 2299
101 Ga0436362_0588737 3300039453 Bacteria 960
102 Ga0436362_0897421 3300039453 Bacteria 669
103 Ga0436362_1091120 3300039453 Bacteria 609
104 Ga0436362_1127395 3300039453 Bacteria 6155
105 Ga0436362_1203112 3300039453 Bacteria 940
106 Ga0466969_0154898 3300044656 Bacteria 1055
107 Ga0466966_0143156 3300044684 Bacteria 1460
108 Ga0466966_0161281 3300044684 Bacteria 1365
109 Ga0466966_0960720 3300044684 Bacteria 515
110 Ga0466961_0022429 3300044693 Bacteria 4061
111 Ga0466961_0055607 3300044693 Bacteria 2523
112 Ga0466961_0082085 3300044693 Bacteria 2040
113 Ga0466961_0168252 3300044693 Bacteria 1364
114 Ga0466961_0244433 3300044693 Bacteria 1103
115 Ga0466961_0469851 3300044693 Bacteria 761
116 Ga0466963_0002155 3300044694 Bacteria 10892
117 Ga0466963_0051201 3300044694 Bacteria 2736
118 Ga0466963_0063844 3300044694 Bacteria 2466
119 Ga0466971_0180884 3300044719 Bacteria 991
120 Ga0466968_0035768 3300044735 Bacteria 2079
121 Ga0466968_0100504 3300044735 Bacteria 1291
122 Ga0466968_0145875 3300044735 Bacteria 1085
123 Ga0466968_0224696 3300044735 Bacteria 885
124 Ga0466968_0461767 3300044735 Bacteria 629
125 Ga0466970_0022825 3300044765 Bacteria 3265
126 Ga0466970_0040735 3300044765 Bacteria 2467
127 Ga0466970_0252501 3300044765 Bacteria 988
128 Ga0466970_0456503 3300044765 Bacteria 733
129 Ga0466970_0718313 3300044765 Bacteria 583
130 Ga0466957_0016524 3300044842 Bacteria 4316
131 Ga0466957_0195964 3300044842 Bacteria 1325
132 Ga0466957_0198720 3300044842 Bacteria 1316
133 Ga0466957_0277719 3300044842 Bacteria 1120
134 Ga0466959_0002047 3300045049 Bacteria 12751
135 Ga0466959_0007942 3300045049 Bacteria 7473
136 Ga0466959_0018570 3300045049 Bacteria 5106
137 Ga0466959_0086508 3300045049 Bacteria 2255
138 Ga0466959_0108692 3300045049 Bacteria 1981
139 Ga0466959_0118769 3300045049 Bacteria 1881
140 Ga0466959_0241122 3300045049 Bacteria 1249
141 Ga0466959_0269609 3300045049 Unclassified 1170
142 Ga0466959_0375332 3300045049 Bacteria 968
143 Ga0466959_0423753 3300045049 Bacteria 903
144 Ga0466959_0940070 3300045049 Bacteria 576
145 Ga0466958_0002910 3300045836 Bacteria 8748
146 Ga0466958_0037181 3300045836 Bacteria 2916
147 Ga0466958_0066852 3300045836 Bacteria 2195
148 Ga0466958_0151459 3300045836 Bacteria 1463
149 Ga0466958_0243883 3300045836 Bacteria 1148
150 Ga0466958_0249826 3300045836 Bacteria 1134
151 Ga0466958_0603365 3300045836 Bacteria 714
152 Ga0466958_0778201 3300045836 Bacteria 624
153 Ga0466958_1085641 3300045836 Bacteria 522
154 Ga0466967_0026919 3300045976 Bacteria 4774
155 Ga0466967_0743946 3300045976 Bacteria 972
156 Ga0466967_1516736 3300045976 Unclassified 667
157 Ga0495592_0287145 3300046454 Bacteria 1074
158 Ga0495641_0065996 3300046461 Bacteria 1629
159 Ga0495651_0008354 3300046462 Bacteria 7935
160 Ga0495664_0156401 3300046477 Bacteria 1383
161 Ga0495664_0474039 3300046477 Bacteria 748
162 Ga0495608_0005979 3300046511 Bacteria 8652
163 Ga0495618_0015149 3300046514 Bacteria 4703
164 Ga0495628_0039766 3300046516 Bacteria 3760
165 Ga0495628_0785476 3300046516 Bacteria 667
166 Ga0495630_0130744 3300046517 Bacteria 1907
167 Ga0495630_0155616 3300046517 Bacteria 1740
168 Ga0495652_0087283 3300046529 Bacteria 2559
169 Ga0495652_0832782 3300046529 Bacteria 612
170 Ga0495665_0322646 3300046531 Bacteria 789
171 Ga0495640_0427993 3300046533 Bacteria 810
172 Ga0495587_0059718 3300046536 Bacteria 2237
173 Ga0495645_0097710 3300046543 Bacteria 2091
174 Ga0495645_0526532 3300046543 Bacteria 736
175 Ga0495667_0005887 3300046559 Bacteria 8302
176 Ga0495634_0062130 3300046642 Bacteria 2481
177 Ga0495635_0055012 3300046663 Bacteria 2741
178 Ga0495635_0073048 3300046663 Bacteria 2350
179 Ga0495657_0049258 3300046675 Bacteria 2838
180 Ga0495599_0453845 3300046678 Bacteria 759
181 Ga0495623_0464063 3300046679 Bacteria 673
182 Ga0495646_0066479 3300046680 Bacteria 2132
183 Ga0495624_0553686 3300046690 Bacteria 687
184 Ga0495649_0587318 3300046694 Bacteria 550
185 Ga0495600_0031688 3300046809 Bacteria 3426
186 Ga0495604_0063163 3300047317 Bacteria 2825
187 Ga0495604_0540345 3300047317 Bacteria 752
188 Ga0495674_0129863 3300047319 Bacteria 2123
189 Ga0495674_0289554 3300047319 Bacteria 1340
190 Ga0495680_0012392 3300047322 Bacteria 7501
191 Ga0495675_0039399 3300047444 Bacteria 3009
192 Ga0495684_0024142 3300047471 Bacteria 4678
193 Ga0495593_0284643 3300047673 Bacteria 827
194 Ga0495602_0053091 3300048088 Bacteria 3592
195 Ga0495602_0321816 3300048088 Bacteria 1125
196 Ga0496100_1506592 3300048903 Bacteria 531
197 Ga0496102_1096676 3300048905 Bacteria 716
198 Ga0496102_1328582 3300048905 Bacteria 638
199 Ga0496108_0331225 3300048911 Bacteria 1328
200 Ga0496109_0182579 3300048912 Bacteria 1971
201 Ga0496109_1296903 3300048912 Bacteria 664
202 Ga0496110_0192475 3300048913 Bacteria 1852
203 Ga0496110_1464681 3300048913 Bacteria 592
204 Ga0496111_0237801 3300048914 Bacteria 1353
205 Ga0496112_0002862 3300048915 Bacteria 14022
206 Ga0496113_0044334 3300048916 Bacteria 3295
207 Ga0496114_0738390 3300048917 Bacteria 861
208 Ga0496115_0847102 3300048918 Bacteria 708
209 Ga0495601_0100708 3300053077 Bacteria 1866
210 Ga0495612_0158423 3300053078 Bacteria 988
211 Ga0495595_0013555 3300053084 Bacteria 3445
212 Ga0495619_0063596 3300053085 Bacteria 2458
213 Ga0466962_0045330 3300061719 Bacteria 2102
214 Ga0466962_0457189 3300061719 Unclassified 643
215 Ga0466967_0248392
216 Ga0070658_11033637
217 Ga0070714_100201610
218 Ga0070714_100277191
219 Ga0070714_100521784
220 Ga0070714_100523311
221 Ga0070714_100588841
222 Ga0070714_102107325
223 Ga0070713_100107072
224 Ga0070713_100142709
225 Ga0070713_100164386
226 Ga0070713_100813720
227 Ga0070710_10008279
228 Ga0070710_10740977
229 Ga0070710_11284896
230 Ga0070711_100005201
231 Ga0070693_100671268
232 Ga0070665_100001603
233 Ga0070717_10004305
234 Ga0070717_10072562
235 Ga0070717_10121073
236 Ga0070717_10181981
237 Ga0070717_10226626
238 Ga0070717_10670163
239 Ga0070712_100247909
240 Ga0105248_12079512
241 Ga0157369_11412164
242 Ga0163162_11777685
243 Ga0163163_10873738
244 Ga0213873_10006193
245 Ga0213873_10006218
246 Ga0213873_10170899
247 Ga0213874_10005983
248 Ga0213876_10021459
249 Ga0213876_10030495
250 Ga0213876_10142206
251 Ga0213875_10000625
252 Ga0213875_10132721
253 Ga0213875_10168134
254 Ga0213875_10410838
255 Ga0207692_10350314
256 Ga0207692_11172767
257 Ga0207699_10255548
258 Ga0207705_10406721
259 Ga0207695_10701783
260 Ga0207693_10007522
261 Ga0207693_10081363
262 Ga0207663_10046735
263 Ga0207700_10074448
264 Ga0207700_11390754
265 Ga0207664_10002150
266 Ga0207664_10143756
267 Ga0207664_10196497
268 Ga0207664_10243182
269 Ga0207664_10294907
270 Ga0207664_11287773
271 Ga0207665_10130563
272 Ga0207711_10292296
273 Ga0207678_10472765
274 Ga0268266_10004025
275 Ga0373953_0023937
276 Ga0373943_0437363
277 Ga0373946_0516834
278 Ga0373933_0045708
279 Ga0373947_0331692
280 Ga0373937_0054982
281 Ga0373925_0950898
282 Ga0436364_0268526
283 Ga0436364_0820820
284 Ga0436364_0842144
285 Ga0436364_0848997
286 Ga0436364_0993330
287 Ga0436364_1031907
288 Ga0436364_1245936
289 Ga0436364_1317744
290 Ga0436364_1381546
291 Ga0436364_1397381
292 Ga0436364_1468831
293 Ga0436364_1505805
294 Ga0436365_0200348
295 Ga0436365_0551575
296 Ga0436365_0687339
297 Ga0436365_0780642
298 Ga0436365_0982122
299 Ga0436365_1296982
300 Ga0436365_1402107
301 Ga0436365_1827970
302 Ga0436360_0522132
303 Ga0436360_1106670
304 Ga0436361_0379182
305 Ga0436361_0788768
306 Ga0436363_0150798
307 Ga0436363_0187523
308 Ga0436363_0313411
309 Ga0436363_1370544
310 Ga0436363_1578803
311 Ga0436363_1715658
312 Ga0436362_0035688
313 Ga0436362_0282709
314 Ga0436362_0429085
315 Ga0436362_0588737
316 Ga0436362_0897421
317 Ga0436362_1091120
318 Ga0436362_1127395
319 Ga0436362_1203112
320 Ga0466969_0154898
321 Ga0466966_0143156
322 Ga0466966_0161281
323 Ga0466966_0960720
324 Ga0466961_0022429
325 Ga0466961_0055607
326 Ga0466961_0082085
327 Ga0466961_0168252
328 Ga0466961_0244433
329 Ga0466961_0469851
330 Ga0466963_0002155
331 Ga0466963_0051201
332 Ga0466963_0063844
333 Ga0466971_0180884
334 Ga0466968_0035768
335 Ga0466968_0100504
336 Ga0466968_0145875
337 Ga0466968_0224696
338 Ga0466968_0461767
339 Ga0466970_0022825
340 Ga0466970_0040735
341 Ga0466970_0252501
342 Ga0466970_0456503
343 Ga0466970_0718313
344 Ga0466957_0016524
345 Ga0466957_0195964
346 Ga0466957_0198720
347 Ga0466957_0277719
348 Ga0466959_0002047
349 Ga0466959_0007942
350 Ga0466959_0018570
351 Ga0466959_0086508
352 Ga0466959_0108692
353 Ga0466959_0118769
354 Ga0466959_0241122
355 Ga0466959_0269609
356 Ga0466959_0375332
357 Ga0466959_0423753
358 Ga0466959_0940070
359 Ga0466958_0002910
360 Ga0466958_0037181
361 Ga0466958_0066852
362 Ga0466958_0151459
363 Ga0466958_0243883
364 Ga0466958_0249826
365 Ga0466958_0603365
366 Ga0466958_0778201
367 Ga0466958_1085641
368 Ga0466967_0026919
369 Ga0466967_0743946
370 Ga0466967_1516736
371 Ga0495592_0287145
372 Ga0495641_0065996
373 Ga0495651_0008354
374 Ga0495664_0156401
375 Ga0495664_0474039
376 Ga0495608_0005979
377 Ga0495618_0015149
378 Ga0495628_0039766
379 Ga0495628_0785476
380 Ga0495630_0130744
381 Ga0495630_0155616
382 Ga0495652_0087283
383 Ga0495652_0832782
384 Ga0495665_0322646
385 Ga0495640_0427993
386 Ga0495587_0059718
387 Ga0495645_0097710
388 Ga0495645_0526532
389 Ga0495667_0005887
390 Ga0495634_0062130
391 Ga0495635_0055012
392 Ga0495635_0073048
393 Ga0495657_0049258
394 Ga0495599_0453845
395 Ga0495623_0464063
396 Ga0495646_0066479
397 Ga0495624_0553686
398 Ga0495649_0587318
399 Ga0495600_0031688
400 Ga0495604_0063163
401 Ga0495604_0540345
402 Ga0495674_0129863
403 Ga0495674_0289554
404 Ga0495680_0012392
405 Ga0495675_0039399
406 Ga0495684_0024142
407 Ga0495593_0284643
408 Ga0495602_0053091
409 Ga0495602_0321816
410 Ga0496100_1506592
411 Ga0496102_1096676
412 Ga0496102_1328582
413 Ga0496108_0331225
414 Ga0496109_0182579
415 Ga0496109_1296903
416 Ga0496110_0192475
417 Ga0496110_1464681
418 Ga0496111_0237801
419 Ga0496112_0002862
420 Ga0496113_0044334
421 Ga0496114_0738390
422 Ga0496115_0847102
423 Ga0495601_0100708
424 Ga0495612_0158423
425 Ga0495595_0013555
426 Ga0495619_0063596
427 Ga0466962_0045330
428 Ga0466962_0457189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

27

151

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c8o-assembly1.cif.gz_D crystal structure of iscu d40a/h106a variant 0.8859 16 120
1wfz-assembly1.cif.gz_A solution structure of iron-sulfur cluster protein u (iscu) 0.8672 16 120
4eb5-assembly1.cif.gz_C a. fulgidus iscs-iscu complex structure 0.8634 9 120
4eb7-assembly1.cif.gz_C a. fulgidus iscs-iscu complex structure 0.8523 9 120
7cnv-assembly2.cif.gz_D crystal structure of iscu h106c variant 0.8488 9 120
ID Description Score Start End Superfamily
5wlwD01 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9291 27 120 3.90.1010.10
4eb7C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8523 9 120 3.90.1010.10
5wlwD01 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8431 27 120 3.90.1010.10
4eb5D00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8381 9 122 3.90.1010.10
af_Q8IKT4_39_161_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8073 9 120 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A2H5UY79-F1-model_v4 Iron-sulfur cluster assembly scaffold protein IscU 0.9898 42 121 GO:0005506
GO:0016226
GO:0051536
AF-K2BZU5-F1-model_v4 NIF system FeS cluster assembly NifU N-terminal domain-containing protein 0.9836 42 119 GO:0005506
GO:0016226
GO:0051536
AF-A0A3M1N1N6-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9777 20 121 GO:0005506
GO:0016226
GO:0051536
AF-A0A7C1IKB6-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9662 43 121 GO:0005506
GO:0016226
GO:0051536
AF-A0A538E9Q4-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9641 20 122 GO:0005506
GO:0016226
GO:0051536

Map