F325337

General Info

Members Datasets Scaffolds Average Seq Length
214 123 214 159

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10141479|Ga0265338_101414792
Length 184
Sequence MEGKPLKDDIEEAILYAKKYIEDLLSFFGLNTDVYATTEDHEVIELHIPSTHLNGFLIGQHGDTMRALQYIISSALKNQSFSHVRVNVDVADYKKRRAERVVRDAETWFKEVQTSGQAKELLPMNPADRRAVHKAATDYGLQTESIGEGRERHIVLKPSSELSRPSANADDDEATRKSTAGTSK

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
113 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
114 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
115 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
116 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
117 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
118 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
119 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
120 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
121 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.41
Nodule 0
Rhizoplane 0.47
Rhizosphere 89.25
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10000009 3300002244 Bacteria 33403
2 JGI25406J46586_10027450 3300003203 Unclassified 2183
3 rootH2_10080305 3300003320 Bacteria 8745
4 rootL2_10359168 3300003322 Bacteria 2092
5 Ga0070658_10012051 3300005327 Bacteria 6944
6 Ga0070658_10134120 3300005327 Bacteria 2065
7 Ga0070658_10654881 3300005327 Bacteria 911
8 Ga0070676_10001177 3300005328 Bacteria 13106
9 Ga0070683_100188291 3300005329 Bacteria 1959
10 Ga0070683_100264839 3300005329 Unclassified 1635
11 Ga0070690_100045633 3300005330 Bacteria 2784
12 Ga0070670_100074316 3300005331 Unclassified 2920
13 Ga0070682_100194073 3300005337 Bacteria 1428
14 Ga0070660_100752913 3300005339 Bacteria 818
15 Ga0070689_100977440 3300005340 Unclassified 752
16 Ga0070661_100064556 3300005344 Bacteria 2690
17 Ga0070679_100097683 3300005530 Bacteria 2924
18 Ga0070679_100423643 3300005530 Unclassified 1276
19 Ga0070679_101473454 3300005530 Unclassified 627
20 Ga0070684_100342835 3300005535 Bacteria 1374
21 Ga0070684_100390043 3300005535 Bacteria 1283
22 Ga0070684_101160528 3300005535 Unclassified 726
23 Ga0068853_100980853 3300005539 Bacteria 813
24 Ga0070696_101755913 3300005546 Bacteria 535
25 Ga0068855_100000001 3300005563 Bacteria 818777
26 Ga0068855_100413464 3300005563 Bacteria 1476
27 Ga0068855_100599725 3300005563 Bacteria 1188
28 Ga0068855_100849423 3300005563 Bacteria 967
29 Ga0068855_101006725 3300005563 Bacteria 875
30 Ga0068857_100174058 3300005577 Bacteria 1957
31 Ga0068857_100913157 3300005577 Bacteria 842
32 Ga0068856_100105499 3300005614 Bacteria 2812
33 Ga0068852_100088736 3300005616 Unclassified 2762
34 Ga0068852_100202667 3300005616 Bacteria 1878
35 Ga0068859_100193821 3300005617 Bacteria 2116
36 Ga0068863_100039519 3300005841 Unclassified 4488
37 Ga0068858_100026448 3300005842 Bacteria 5390
38 Ga0081539_10005462 3300005985 Bacteria 12961
39 Ga0081539_10095061 3300005985 Bacteria 1531
40 Ga0075365_10000012 3300006038 Bacteria 82049
41 Ga0075365_10018373 3300006038 Bacteria 4298
42 Ga0075366_10000382 3300006195 Bacteria 20515
43 Ga0097621_100000005 3300006237 Bacteria 143888
44 Ga0068871_100000003 3300006358 Bacteria 141580
45 Ga0075433_10601583 3300006852 Unclassified 965
46 Ga0097620_100193806 3300006931 Bacteria 2116
47 Ga0105240_10419827 3300009093 Bacteria 1503
48 Ga0105240_10495092 3300009093 Bacteria 1360
49 Ga0105240_12250887 3300009093 Unclassified 565
50 Ga0105245_10000007 3300009098 Bacteria 312285
51 Ga0105243_11111865 3300009148 Unclassified 799
52 Ga0105241_10000009 3300009174 Bacteria 258876
53 Ga0105241_10000192 3300009174 Bacteria 45865
54 Ga0105241_10657989 3300009174 Bacteria 952
55 Ga0105241_11287035 3300009174 Bacteria 696
56 Ga0105242_10691779 3300009176 Bacteria 996
57 Ga0105237_10294942 3300009545 Bacteria 1624
58 Ga0105237_10958379 3300009545 Bacteria 862
59 Ga0105238_10000151 3300009551 Bacteria 76390
60 Ga0105238_10554399 3300009551 Unclassified 1154
61 Ga0105238_12162980 3300009551 Unclassified 591
62 Ga0105239_10589543 3300010375 Bacteria 1267
63 Ga0157370_10126094 3300013104 Bacteria 2389
64 Ga0157370_10629039 3300013104 Bacteria 982
65 Ga0157369_10001636 3300013105 Bacteria 27361
66 Ga0157369_10011463 3300013105 Bacteria 10067
67 Ga0157369_10977310 3300013105 Bacteria 867
68 Ga0157374_10000014 3300013296 Bacteria 396846
69 Ga0157374_10450157 3300013296 Bacteria 1289
70 Ga0157378_12343158 3300013297 Unclassified 585
71 Ga0157372_10103296 3300013307 Bacteria 3256
72 Ga0157372_10524500 3300013307 Bacteria 1381
73 Ga0157372_10763017 3300013307 Bacteria 1124
74 Ga0157372_12070321 3300013307 Bacteria 654
75 Ga0157377_10059529 3300014745 Bacteria 2177
76 Ga0157379_10008956 3300014968 Bacteria 8725
77 Ga0207647_10114829 3300025904 Bacteria 1590
78 Ga0207645_10006038 3300025907 Bacteria 8707
79 Ga0207705_10000019 3300025909 Bacteria 317770
80 Ga0207654_10000002 3300025911 Bacteria 1460142
81 Ga0207654_10003399 3300025911 Bacteria 8044
82 Ga0207654_10612712 3300025911 Bacteria 777
83 Ga0207654_10764814 3300025911 Bacteria 696
84 Ga0207707_10003089 3300025912 Bacteria 14770
85 Ga0207707_10596259 3300025912 Unclassified 935
86 Ga0207695_10323847 3300025913 Bacteria 1430
87 Ga0207657_10011343 3300025919 Bacteria 8850
88 Ga0207657_10887572 3300025919 Bacteria 687
89 Ga0207649_10046458 3300025920 Bacteria 2668
90 Ga0207652_10138298 3300025921 Bacteria 2176
91 Ga0207652_10247042 3300025921 Bacteria 1609
92 Ga0207652_10270854 3300025921 Bacteria 1532
93 Ga0207652_10352668 3300025921 Unclassified 1328
94 Ga0207694_10016919 3300025924 Bacteria 5509
95 Ga0207694_10429657 3300025924 Unclassified 1101
96 Ga0207687_10000008 3300025927 Bacteria 497738
97 Ga0207644_10021130 3300025931 Unclassified 4431
98 Ga0207690_10298742 3300025932 Unclassified 1259
99 Ga0207686_10513123 3300025934 Bacteria 932
100 Ga0207670_10093275 3300025936 Bacteria 2133
101 Ga0207670_10369021 3300025936 Bacteria 1140
102 Ga0207661_10186246 3300025944 Unclassified 1817
103 Ga0207661_10222760 3300025944 Bacteria 1668
104 Ga0207667_10000003 3300025949 Bacteria 822935
105 Ga0207667_10025542 3300025949 Bacteria 6465
106 Ga0207667_10029728 3300025949 Bacteria 5919
107 Ga0207667_10033412 3300025949 Bacteria 5530
108 Ga0207667_10660051 3300025949 Bacteria 1051
109 Ga0207703_10005339 3300026035 Bacteria 10350
110 Ga0207639_10859439 3300026041 Unclassified 847
111 Ga0207702_10003709 3300026078 Bacteria 13809
112 Ga0207674_10001822 3300026116 Bacteria 27200
113 Ga0207674_10048713 3300026116 Bacteria 4336
114 Ga0207674_10848391 3300026116 Bacteria 881
115 Ga0265337_1015186 3300028556 Bacteria 2529
116 Ga0265326_10009625 3300028558 Bacteria 2891
117 Ga0265326_10046065 3300028558 Archaea 1236
118 Ga0265334_10000206 3300028573 Bacteria 34123
119 Ga0265334_10000502 3300028573 Bacteria 20124
120 Ga0265334_10012617 3300028573 Bacteria 3548
121 Ga0265334_10027316 3300028573 Bacteria 2299
122 Ga0265318_10025910 3300028577 Unclassified 2311
123 Ga0265318_10116255 3300028577 Archaea 983
124 Ga0265323_10121862 3300028653 Unclassified 849
125 Ga0265322_10002362 3300028654 Bacteria 5839
126 Ga0265322_10053150 3300028654 Bacteria 1149
127 Ga0265322_10057684 3300028654 Archaea 1101
128 Ga0265336_10121455 3300028666 Archaea 778
129 Ga0265336_10208768 3300028666 Unclassified 580
130 Ga0265338_10000217 3300028800 Bacteria 106453
131 Ga0265338_10000894 3300028800 Bacteria 50064
132 Ga0265338_10000979 3300028800 Bacteria 48106
133 Ga0265338_10084526 3300028800 Bacteria 2649
134 Ga0265338_10109043 3300028800 Archaea 2234
135 Ga0265338_10141479 3300028800 Archaea 1884
136 Ga0265338_10470339 3300028800 Bacteria 888
137 Ga0265324_10006011 3300029957 Bacteria 5137
138 Ga0265324_10024917 3300029957 Archaea 2123
139 Ga0265324_10128724 3300029957 Unclassified 859
140 Ga0265330_10016742 3300031235 Bacteria 3379
141 Ga0265332_10062993 3300031238 Bacteria 1584
142 Ga0265320_10012911 3300031240 Unclassified 4829
143 Ga0265320_10076274 3300031240 Archaea 1571
144 Ga0265320_10188048 3300031240 Bacteria 924
145 Ga0265325_10011085 3300031241 Archaea 5187
146 Ga0265325_10073443 3300031241 Archaea 1712
147 Ga0265329_10011539 3300031242 Unclassified 3208
148 Ga0265329_10127746 3300031242 Archaea 817
149 Ga0265340_10000983 3300031247 Bacteria 16295
150 Ga0265339_10069689 3300031249 Unclassified 1876
151 Ga0265339_10110883 3300031249 Unclassified 1419
152 Ga0265339_10267191 3300031249 Unclassified 823
153 Ga0265331_10040109 3300031250 Unclassified 2279
154 Ga0265331_10191071 3300031250 Bacteria 924
155 Ga0265327_10080178 3300031251 Bacteria 1614
156 Ga0265327_10091216 3300031251 Archaea 1485
157 Ga0265316_10000518 3300031344 Bacteria 43510
158 Ga0265316_10004980 3300031344 Bacteria 13044
159 Ga0265316_10140187 3300031344 Bacteria 1817
160 Ga0265313_10055633 3300031595 Unclassified 1873
161 Ga0265313_10109149 3300031595 Archaea 1218
162 Ga0265314_10032104 3300031711 Unclassified 3867
163 Ga0265314_10037196 3300031711 Bacteria 3529
164 Ga0265314_10196106 3300031711 Unclassified 1197
165 Ga0265314_10481032 3300031711 Unclassified 656
166 Ga0265342_10263246 3300031712 Archaea 917
167 Ga0395899_0007401 3300037312 Bacteria 8486
168 Ga0395899_0242915 3300037312 Unclassified 1238
169 Ga0395899_0344280 3300037312 Unclassified 999
170 Ga0395900_0003106 3300037418 Bacteria 18033
171 Ga0395900_0018107 3300037418 Bacteria 7187
172 Ga0395900_0109338 3300037418 Unclassified 2840
173 Ga0395900_0128155 3300037418 Bacteria 2602
174 Ga0395900_0466520 3300037418 Unclassified 1217
175 Ga0395900_1038674 3300037418 Unclassified 738
176 Ga0395898_0039977 3300037466 Bacteria 4640
177 Ga0395898_0159893 3300037466 Unclassified 2154
178 Ga0395905_0002040 3300037471 Bacteria 23070
179 Ga0395905_0014359 3300037471 Bacteria 7567
180 Ga0395905_0087433 3300037471 Unclassified 2922
181 Ga0395901_0002445 3300038443 Bacteria 18833
182 Ga0395901_0009627 3300038443 Bacteria 9803
183 Ga0395901_0104217 3300038443 Bacteria 2977
184 Ga0436365_0981200 3300039437 Unclassified 629
185 Ga0436363_1272177 3300039450 Bacteria 939
186 Ga0495583_0099376 3300046506 Unclassified 1243
187 Ga0496100_0341516 3300048903 Unclassified 1129
188 Ga0501033_0009581 3300049570 Bacteria 7451
189 Ga0501033_0262789 3300049570 Bacteria 1221
190 Ga0501034_0000510 3300049571 Bacteria 62507
191 Ga0501036_0124499 3300049572 Bacteria 2177
192 Ga0501037_0014497 3300049573 Bacteria 5800
193 Ga0501038_0046508 3300049574 Bacteria 3763
194 Ga0501047_0000024 3300049581 Bacteria 230397
195 Ga0501070_0182227 3300049586 Bacteria 1728
196 Ga0501083_0300317 3300049744 Unclassified 1044
197 Ga0501035_0000005 3300049822 Bacteria 392980
198 Ga0501044_0004809 3300049823 Bacteria 15101
199 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
200 nmdc:mga0k408_264_c1 3300050493 Bacteria 28733
201 nmdc:mga0a205_879466_c1 3300050515 Bacteria 743
202 nmdc:mga0sz30_85898_c1 3300050516 Bacteria 1365
203 Ga0500643_000009 3300053087 Bacteria 444150
204 Ga0500644_0105460 3300053088 Bacteria 1077
205 Ga0500646_0002706 3300053090 Bacteria 4577
206 Ga0500650_0000018 3300053098 Bacteria 70093
207 Ga0500594_0000001 3300053118 Bacteria 1178472
208 Ga0500628_003724 3300053129 Bacteria 2517
209 Ga0500655_002269 3300053133 Bacteria 3528
210 Ga0500577_0059187 3300053142 Bacteria 1467
211 Ga0500579_039170 3300053143 Unclassified 2993
212 Ga0500616_0000005 3300053153 Bacteria 961725
213 Ga0500616_0171257 3300053153 Bacteria 986
214 Ga0500570_000001 3300053724 Bacteria 243552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10126094 Ga0157370_101260942 137
2 3300025949 Ga0207667_10029728 Ga0207667_100297282 137
3 3300025921 Ga0207652_10270854 Ga0207652_102708542 142
4 3300005327 Ga0070658_10012051 Ga0070658_100120518 149
5 3300005340 Ga0070689_100977440 Ga0070689_1009774402 149
6 3300005530 Ga0070679_100423643 Ga0070679_1004236432 149
7 3300005577 Ga0068857_100913157 Ga0068857_1009131572 149
8 3300025921 Ga0207652_10352668 Ga0207652_103526682 149
9 3300025936 Ga0207670_10093275 Ga0207670_100932753 149
10 3300026116 Ga0207674_10848391 Ga0207674_108483912 149
11 3300003320 rootH2_10080305 rootH2_100803055 150
12 3300005327 Ga0070658_10134120 Ga0070658_101341203 150
13 3300005327 Ga0070658_10654881 Ga0070658_106548811 150
14 3300005330 Ga0070690_100045633 Ga0070690_1000456333 150
15 3300005530 Ga0070679_101473454 Ga0070679_1014734541 150
16 3300005535 Ga0070684_101160528 Ga0070684_1011605281 150
17 3300005614 Ga0068856_100105499 Ga0068856_1001054993 150
18 3300009551 Ga0105238_12162980 Ga0105238_121629801 150
19 3300013105 Ga0157369_10011463 Ga0157369_100114633 150
20 3300013296 Ga0157374_10450157 Ga0157374_104501572 150
21 3300013297 Ga0157378_12343158 Ga0157378_123431581 150
22 3300013307 Ga0157372_10524500 Ga0157372_105245002 150
23 3300013307 Ga0157372_12070321 Ga0157372_120703212 150
24 3300014745 Ga0157377_10059529 Ga0157377_100595293 150
25 3300025904 Ga0207647_10114829 Ga0207647_101148292 150
26 3300025912 Ga0207707_10003089 Ga0207707_100030898 150
27 3300026078 Ga0207702_10003709 Ga0207702_100037096 150
28 3300037312 Ga0395899_0242915 Ga0395899_0242915_213_677 150
29 3300037312 Ga0395899_0344280 Ga0395899_0344280_281_745 150
30 3300037418 Ga0395900_0003106 Ga0395900_0003106_7188_7652 150
31 3300037418 Ga0395900_0109338 Ga0395900_0109338_1846_2310 150
32 3300037418 Ga0395900_0128155 Ga0395900_0128155_1299_1754 150
33 3300037418 Ga0395900_0466520 Ga0395900_0466520_367_822 150
34 3300037466 Ga0395898_0159893 Ga0395898_0159893_223_687 150
35 3300037471 Ga0395905_0002040 Ga0395905_0002040_5925_6380 150
36 3300038443 Ga0395901_0002445 Ga0395901_0002445_3101_3556 150
37 3300038443 Ga0395901_0009627 Ga0395901_0009627_424_888 150
38 3300048903 Ga0496100_0341516 Ga0496100_0341516_264_719 150
39 3300053088 Ga0500644_0105460 Ga0500644_0105460_558_1013 150
40 3300053090 Ga0500646_0002706 Ga0500646_0002706_2420_2875 150
41 3300053098 Ga0500650_0000018 Ga0500650_0000018_59831_60286 150
42 3300053118 Ga0500594_0000001 Ga0500594_0000001_581531_581986 150
43 3300053133 Ga0500655_002269 Ga0500655_002269_1012_1467 150
44 3300053142 Ga0500577_0059187 Ga0500577_0059187_503_958 150
45 3300053143 Ga0500579_039170 Ga0500579_039170_1671_2126 150
46 3300053724 Ga0500570_000001 Ga0500570_000001_72838_73293 150
47 3300003322 rootL2_10359168 rootL2_103591682 151
48 3300005331 Ga0070670_100074316 Ga0070670_1000743162 151
49 3300005546 Ga0070696_101755913 Ga0070696_1017559131 151
50 3300005563 Ga0068855_100000001 Ga0068855_100000001684 151
51 3300005841 Ga0068863_100039519 Ga0068863_1000395197 151
52 3300006038 Ga0075365_10000012 Ga0075365_1000001239 151
53 3300006852 Ga0075433_10601583 Ga0075433_106015832 151
54 3300009174 Ga0105241_10000009 Ga0105241_1000000973 151
55 3300009174 Ga0105241_10000192 Ga0105241_100001925 151
56 3300009551 Ga0105238_10554399 Ga0105238_105543992 151
57 3300013105 Ga0157369_10001636 Ga0157369_1000163624 151
58 3300025909 Ga0207705_10000019 Ga0207705_10000019171 151
59 3300025911 Ga0207654_10000002 Ga0207654_10000002203 151
60 3300025911 Ga0207654_10003399 Ga0207654_100033995 151
61 3300025924 Ga0207694_10429657 Ga0207694_104296572 151
62 3300025931 Ga0207644_10021130 Ga0207644_100211302 151
63 3300025949 Ga0207667_10000003 Ga0207667_10000003672 151
64 3300028556 Ga0265337_1015186 Ga0265337_10151862 151
65 3300028573 Ga0265334_10000502 Ga0265334_100005029 151
66 3300028800 Ga0265338_10000217 Ga0265338_100002179 151
67 3300031240 Ga0265320_10188048 Ga0265320_101880482 151
68 3300031247 Ga0265340_10000983 Ga0265340_100009839 151
69 3300037312 Ga0395899_0007401 Ga0395899_0007401_2668_3135 151
70 3300037418 Ga0395900_0018107 Ga0395900_0018107_3891_4358 151
71 3300037418 Ga0395900_1038674 Ga0395900_1038674_243_710 151
72 3300037466 Ga0395898_0039977 Ga0395898_0039977_4033_4500 151
73 3300037471 Ga0395905_0014359 Ga0395905_0014359_4749_5216 151
74 3300037471 Ga0395905_0087433 Ga0395905_0087433_2072_2539 151
75 3300038443 Ga0395901_0104217 Ga0395901_0104217_2004_2468 151
76 3300039437 Ga0436365_0981200 Ga0436365_0981200_122_589 151
77 3300046506 Ga0495583_0099376 Ga0495583_0099376_642_1100 151
78 3300049570 Ga0501033_0262789 Ga0501033_0262789_482_949 151
79 3300050492 nmdc:mga0yw44_7_c1 nmdc:mga0yw44_7_c1_96178_96633 151
80 3300050515 nmdc:mga0a205_879466_c1 nmdc:mga0a205_879466_c1_162_629 151
81 3300050516 nmdc:mga0sz30_85898_c1 nmdc:mga0sz30_85898_c1_840_1295 151
82 3300053129 Ga0500628_003724 Ga0500628_003724_364_819 151
83 3300014968 Ga0157379_10008956 Ga0157379_1000895610 152
84 3300005337 Ga0070682_100194073 Ga0070682_1001940732 153
85 3300005344 Ga0070661_100064556 Ga0070661_1000645565 153
86 3300005563 Ga0068855_100849423 Ga0068855_1008494232 153
87 3300005577 Ga0068857_100174058 Ga0068857_1001740582 153
88 3300005616 Ga0068852_100088736 Ga0068852_1000887362 153
89 3300006195 Ga0075366_10000382 Ga0075366_100003824 153
90 3300009148 Ga0105243_11111865 Ga0105243_111118652 153
91 3300009174 Ga0105241_10657989 Ga0105241_106579892 153
92 3300009174 Ga0105241_11287035 Ga0105241_112870351 153
93 3300009176 Ga0105242_10691779 Ga0105242_106917792 153
94 3300009545 Ga0105237_10958379 Ga0105237_109583792 153
95 3300009551 Ga0105238_10000151 Ga0105238_1000015178 153
96 3300010375 Ga0105239_10589543 Ga0105239_105895432 153
97 3300013104 Ga0157370_10629039 Ga0157370_106290392 153
98 3300013307 Ga0157372_10103296 Ga0157372_101032962 153
99 3300013307 Ga0157372_10763017 Ga0157372_107630171 153
100 3300025911 Ga0207654_10612712 Ga0207654_106127121 153
101 3300025911 Ga0207654_10764814 Ga0207654_107648141 153
102 3300025912 Ga0207707_10596259 Ga0207707_105962592 153
103 3300025919 Ga0207657_10011343 Ga0207657_100113439 153
104 3300025920 Ga0207649_10046458 Ga0207649_100464582 153
105 3300025921 Ga0207652_10138298 Ga0207652_101382982 153
106 3300025924 Ga0207694_10016919 Ga0207694_100169192 153
107 3300025932 Ga0207690_10298742 Ga0207690_102987423 153
108 3300025934 Ga0207686_10513123 Ga0207686_105131232 153
109 3300025944 Ga0207661_10222760 Ga0207661_102227603 153
110 3300025949 Ga0207667_10025542 Ga0207667_100255428 153
111 3300026116 Ga0207674_10001822 Ga0207674_100018227 153
112 3300039450 Ga0436363_1272177 Ga0436363_1272177_413_889 153
113 3300049570 Ga0501033_0009581 Ga0501033_0009581_3324_3797 153
114 3300049571 Ga0501034_0000510 Ga0501034_0000510_59123_59596 153
115 3300049572 Ga0501036_0124499 Ga0501036_0124499_1378_1851 153
116 3300049573 Ga0501037_0014497 Ga0501037_0014497_4974_5447 153
117 3300049574 Ga0501038_0046508 Ga0501038_0046508_785_1258 153
118 3300049581 Ga0501047_0000024 Ga0501047_0000024_177150_177623 153
119 3300049586 Ga0501070_0182227 Ga0501070_0182227_1104_1577 153
120 3300049744 Ga0501083_0300317 Ga0501083_0300317_555_1031 153
121 3300049822 Ga0501035_0000005 Ga0501035_0000005_177235_177708 153
122 3300049823 Ga0501044_0004809 Ga0501044_0004809_10289_10762 153
123 3300050493 nmdc:mga0k408_264_c1 nmdc:mga0k408_264_c1_20709_21170 153
124 3300005329 Ga0070683_100264839 Ga0070683_1002648392 154
125 3300005530 Ga0070679_100097683 Ga0070679_1000976834 154
126 3300005535 Ga0070684_100342835 Ga0070684_1003428352 154
127 3300005539 Ga0068853_100980853 Ga0068853_1009808531 154
128 3300005563 Ga0068855_100599725 Ga0068855_1005997252 154
129 3300009093 Ga0105240_10495092 Ga0105240_104950922 154
130 3300025921 Ga0207652_10247042 Ga0207652_102470422 154
131 3300025944 Ga0207661_10186246 Ga0207661_101862462 154
132 3300025949 Ga0207667_10660051 Ga0207667_106600512 154
133 3300026041 Ga0207639_10859439 Ga0207639_108594392 154
134 3300005329 Ga0070683_100188291 Ga0070683_1001882912 155
135 3300005339 Ga0070660_100752913 Ga0070660_1007529131 155
136 3300005535 Ga0070684_100390043 Ga0070684_1003900432 155
137 3300005563 Ga0068855_100413464 Ga0068855_1004134642 155
138 3300005616 Ga0068852_100202667 Ga0068852_1002026672 155
139 3300006237 Ga0097621_100000005 Ga0097621_10000000541 155
140 3300006358 Ga0068871_100000003 Ga0068871_100000003131 155
141 3300009093 Ga0105240_12250887 Ga0105240_122508871 155
142 3300009098 Ga0105245_10000007 Ga0105245_10000007267 155
143 3300009545 Ga0105237_10294942 Ga0105237_102949422 155
144 3300013105 Ga0157369_10977310 Ga0157369_109773101 155
145 3300013296 Ga0157374_10000014 Ga0157374_10000014267 155
146 3300025919 Ga0207657_10887572 Ga0207657_108875721 155
147 3300025927 Ga0207687_10000008 Ga0207687_10000008267 155
148 3300025949 Ga0207667_10033412 Ga0207667_100334124 155
149 3300026116 Ga0207674_10048713 Ga0207674_100487131 155
150 3300009093 Ga0105240_10419827 Ga0105240_104198272 156
151 3300025913 Ga0207695_10323847 Ga0207695_103238472 156
152 3300005563 Ga0068855_101006725 Ga0068855_1010067252 157
153 3300005985 Ga0081539_10095061 Ga0081539_100950611 157
154 3300053087 Ga0500643_000009 Ga0500643_000009_266162_266641 157
155 3300053153 Ga0500616_0000005 Ga0500616_0000005_901327_901803 157
156 3300053153 Ga0500616_0171257 Ga0500616_0171257_49_537 157
157 3300003203 JGI25406J46586_10027450 JGI25406J46586_100274502 158
158 3300005617 Ga0068859_100193821 Ga0068859_1001938213 158
159 3300005842 Ga0068858_100026448 Ga0068858_1000264482 158
160 3300005985 Ga0081539_10005462 Ga0081539_100054629 158
161 3300006931 Ga0097620_100193806 Ga0097620_1001938062 158
162 3300025936 Ga0207670_10369021 Ga0207670_103690212 158
163 3300026035 Ga0207703_10005339 Ga0207703_100053395 158
164 3300028558 Ga0265326_10009625 Ga0265326_100096254 158
165 3300028573 Ga0265334_10027316 Ga0265334_100273163 158
166 3300028654 Ga0265322_10002362 Ga0265322_100023623 158
167 3300028800 Ga0265338_10000894 Ga0265338_100008947 158
168 3300029957 Ga0265324_10006011 Ga0265324_100060116 158
169 3300031250 Ga0265331_10191071 Ga0265331_101910712 158
170 3300031251 Ga0265327_10080178 Ga0265327_100801782 158
171 3300031344 Ga0265316_10004980 Ga0265316_1000498011 158
172 3300031711 Ga0265314_10032104 Ga0265314_100321043 158
173 3300028558 Ga0265326_10046065 Ga0265326_100460652 159
174 3300028573 Ga0265334_10000206 Ga0265334_1000020630 159
175 3300028573 Ga0265334_10012617 Ga0265334_100126172 159
176 3300028577 Ga0265318_10025910 Ga0265318_100259103 159
177 3300028577 Ga0265318_10116255 Ga0265318_101162552 159
178 3300028653 Ga0265323_10121862 Ga0265323_101218622 159
179 3300028654 Ga0265322_10053150 Ga0265322_100531502 159
180 3300028654 Ga0265322_10057684 Ga0265322_100576841 159
181 3300028666 Ga0265336_10121455 Ga0265336_101214551 159
182 3300028666 Ga0265336_10208768 Ga0265336_102087681 159
183 3300028800 Ga0265338_10000979 Ga0265338_1000097916 159
184 3300028800 Ga0265338_10109043 Ga0265338_101090432 159
185 3300029957 Ga0265324_10024917 Ga0265324_100249173 159
186 3300029957 Ga0265324_10128724 Ga0265324_101287241 159
187 3300031235 Ga0265330_10016742 Ga0265330_100167422 159
188 3300031238 Ga0265332_10062993 Ga0265332_100629932 159
189 3300031240 Ga0265320_10076274 Ga0265320_100762742 159
190 3300031241 Ga0265325_10011085 Ga0265325_100110852 159
191 3300031241 Ga0265325_10073443 Ga0265325_100734432 159
192 3300031242 Ga0265329_10011539 Ga0265329_100115391 159
193 3300031242 Ga0265329_10127746 Ga0265329_101277461 159
194 3300031249 Ga0265339_10069689 Ga0265339_100696892 159
195 3300031249 Ga0265339_10110883 Ga0265339_101108832 159
196 3300031249 Ga0265339_10267191 Ga0265339_102671912 159
197 3300031250 Ga0265331_10040109 Ga0265331_100401092 159
198 3300031251 Ga0265327_10091216 Ga0265327_100912162 159
199 3300031344 Ga0265316_10000518 Ga0265316_1000051840 159
200 3300031595 Ga0265313_10055633 Ga0265313_100556332 159
201 3300031595 Ga0265313_10109149 Ga0265313_101091491 159
202 3300031711 Ga0265314_10037196 Ga0265314_100371962 159
203 3300031711 Ga0265314_10196106 Ga0265314_101961062 159
204 3300031711 Ga0265314_10481032 Ga0265314_104810321 159
205 3300031712 Ga0265342_10263246 Ga0265342_102632462 159
206 3300002244 JGI24742J22300_10000009 JGI24742J22300_100000097 161
207 3300005328 Ga0070676_10001177 Ga0070676_100011775 161
208 3300006038 Ga0075365_10018373 Ga0075365_100183734 161
209 3300025907 Ga0207645_10006038 Ga0207645_100060382 161
210 3300028800 Ga0265338_10084526 Ga0265338_100845262 161
211 3300028800 Ga0265338_10141479 Ga0265338_101414792 161
212 3300028800 Ga0265338_10470339 Ga0265338_104703392 161
213 3300031240 Ga0265320_10012911 Ga0265320_100129113 161
214 3300031344 Ga0265316_10140187 Ga0265316_101401872 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01424

R3H

R3H domain

99

158

0.91

PF13083

KhpA-B_KH

KhpA/KhpB, KH domain

17

89

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lrr-assembly1.cif.gz_A solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate 0.8669 95 147
2fph-assembly1.cif.gz_X cell division protein ylmh from streptococcus pneumoniae 0.8447 87 151
3gku-assembly2.cif.gz_C-2 crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.7985 4 87
1jva-assembly2.cif.gz_B crystal structure of the vma1-derived endonuclease bearing the n and c extein propeptides 0.7831 106 150
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.7505 107 148
ID Description Score Start End Superfamily
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9526 87 148 3.30.1370.50
af_Q09868_358_423_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9068 108 148 3.30.1370.50
af_B6UEM9_432_490_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9041 93 147 3.30.1370.50
af_I1LZN2_426_500_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.904 93 147 3.30.1370.50
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8975 87 148 3.30.1370.50
ID Description Score Start End GO Terms
AF-A0A6B3G4P8-F1-model_v4 Single-stranded DNA-binding protein 0.9541 85 149 GO:0003677
GO:0003723
AF-A0A6B3G4P8-F1-model_v4 Single-stranded DNA-binding protein 0.927 85 149 GO:0003677
GO:0003723
AF-A0A0K2QVL6-F1-model_v4 deleted 0.9189 79 148
AF-A0A0K2QVL6-F1-model_v4 deleted 0.8728 79 148
AF-X0UTT8-F1-model_v4 R3H domain-containing protein 0.8382 81 155 GO:0003676

Feature Viewer

pLDDT pTM Quality
82.75 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map