F324990

General Info

Members Datasets Scaffolds Average Seq Length
214 157 428 299

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100131198|Ga0070665_1001311982
Length 320
Sequence VIDLPLDQVRTLLAAVDEGTFEAAAQSLHITPSAVSQRIKALEQRTGRVLLLRTKPVRLTASGEVVVRFGRQLARLERDAGAELGLADAAGPTALPIAVNADSLATWFLPALADAAGRHDITFDLHRDDQDHTAELLRQGLVMAAVTSSPRAVQGCSVRALGRMRYRAMAAPGFVARWIGAAPLRQALPAAPMVVFDRKDDLQDRFLAAPGVAGSRSRSGSPAVPGPREAAARPGAGARHYVPSSEAFVDAVAAGLGWGMIPEVQGAARLAAGALVDLADGRFVDVPLYWQQWKLDSPALAAVADAVARAAGSVLAPHKP

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
12 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
13 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
14 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
21 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
22 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
23 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
24 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
27 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
28 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
31 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
32 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
33 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
34 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
35 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
36 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
37 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
38 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
39 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
40 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
41 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
42 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
43 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
44 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
53 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
54 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
55 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
62 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
63 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
64 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
67 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
70 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
73 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
81 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
82 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
87 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
88 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
93 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
94 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
128 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
129 2558860280 Kutzneria sp. 744 Isolate Unclassified
130 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
131 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
132 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
133 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
134 2643221578 Streptomyces sp. Root63 Isolate Unclassified
135 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
136 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
137 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
138 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
139 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
140 2808606448 Streptomyces sp. 193411 Isolate Unclassified
141 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
142 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
143 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
144 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
145 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
146 2922554459 Rhodococcus sp. 66b Isolate Unclassified
147 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
148 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
149 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
150 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
151 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
152 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
153 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
154 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
155 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
156 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
157 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.51
Metatranscriptomes 0.47
Isolates 14.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0.47
Rhizoplane 0.93
Rhizosphere 77.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100131198 3300005548 Bacteria 2508
2 rootH2_10066633 3300003320 Bacteria 3970
3 rootH2_10193441 3300003320 Bacteria 3257
4 rootH1_10073933 3300003323 Bacteria 6747
5 Ga0006562J51391_1069578 3300003578 Bacteria 5717
6 Ga0070709_10274771 3300005434 Bacteria 1222
7 Ga0070714_100038206 3300005435 Bacteria 4037
8 Ga0070710_10003372 3300005437 Bacteria 7576
9 Ga0068852_100058618 3300005616 Bacteria 3336
10 Ga0070717_10278391 3300006028 Bacteria 1483
11 Ga0075367_10081320 3300006178 Bacteria 1960
12 Ga0105238_10121919 3300009551 Bacteria 2586
13 Ga0182008_10002840 3300014497 Bacteria 10712
14 Ga0182007_10000199 3300015262 Bacteria 40278
15 Ga0209148_1001506 3300025254 Bacteria 11549
16 Ga0209455_1001172 3300025272 Bacteria 12608
17 Ga0207692_10001968 3300025898 Bacteria 7838
18 Ga0207699_10153309 3300025906 Bacteria 1527
19 Ga0207698_10045315 3300026142 Bacteria 3312
20 Ga0268266_10088016 3300028379 Bacteria 2718
21 Ga0307517_10095738 3300028786 Bacteria 2385
22 Ga0307515_10040578 3300028794 Bacteria 7354
23 Ga0307511_10000188 3300030521 Bacteria 61440
24 Ga0307511_10012278 3300030521 Bacteria 8412
25 Ga0307511_10051491 3300030521 Bacteria 3300
26 Ga0316177_1037908 3300030731 Bacteria 1684
27 Ga0314311_1005402 3300030733 Bacteria 2519
28 Ga0307513_10057748 3300031456 Bacteria 4131
29 Ga0307509_10012567 3300031507 Bacteria 10116
30 Ga0307509_10166586 3300031507 Bacteria 2091
31 Ga0307508_10059266 3300031616 Bacteria 3386
32 Ga0307514_10146335 3300031649 Bacteria 1596
33 Ga0307516_10017913 3300031730 Bacteria 7376
34 Ga0307518_10002393 3300031838 Bacteria 13694
35 Ga0307518_10059449 3300031838 Bacteria 2775
36 Ga0307507_10014993 3300033179 Bacteria 9168
37 Ga0307510_10067262 3300033180 Bacteria 3609
38 Ga0373951_0000213 3300035091 Bacteria 20460
39 Ga0373925_0379627 3300037068 Bacteria 1151
40 Ga0451853_1473579 3300041512 Bacteria 2166
41 Ga0439448_0003314 3300042005 Bacteria 4454
42 Ga0439457_000104 3300042014 Bacteria 19859
43 Ga0450898_000272 3300042134 Bacteria 5773
44 Ga0450899_000410 3300042135 Bacteria 4773
45 Ga0450906_000721 3300042145 Bacteria 7109
46 Ga0450908_003170 3300042184 Bacteria 3202
47 Ga0466969_0003000 3300044656 Bacteria 8988
48 Ga0466969_0003827 3300044656 Bacteria 7994
49 Ga0466969_0012876 3300044656 Bacteria 4407
50 Ga0466969_0017618 3300044656 Bacteria 3726
51 Ga0466969_0019591 3300044656 Bacteria 3515
52 Ga0466972_0008470 3300044658 Bacteria 5156
53 Ga0466972_0016242 3300044658 Bacteria 3720
54 Ga0466972_0030763 3300044658 Bacteria 2642
55 Ga0466965_0004741 3300044683 Bacteria 6061
56 Ga0466965_0007499 3300044683 Bacteria 5014
57 Ga0466965_0066835 3300044683 Bacteria 1803
58 Ga0466966_0003145 3300044684 Bacteria 10869
59 Ga0466966_0007834 3300044684 Bacteria 7070
60 Ga0466961_0015996 3300044693 Bacteria 4816
61 Ga0466961_0029924 3300044693 Bacteria 3498
62 Ga0466961_0079144 3300044693 Bacteria 2081
63 Ga0466963_0005896 3300044694 Bacteria 7218
64 Ga0466963_0114028 3300044694 Bacteria 1857
65 Ga0466971_0000301 3300044719 Bacteria 18981
66 Ga0466971_0016216 3300044719 Bacteria 3283
67 Ga0466971_0115819 3300044719 Bacteria 1239
68 Ga0466968_0026849 3300044735 Bacteria 2367
69 Ga0466970_0032639 3300044765 Bacteria 2751
70 Ga0466957_0286215 3300044842 Bacteria 1104
71 Ga0466959_0006058 3300045049 Bacteria 8345
72 Ga0466959_0019141 3300045049 Bacteria 5033
73 Ga0466959_0036888 3300045049 Bacteria 3611
74 Ga0466959_0179346 3300045049 Bacteria 1482
75 Ga0466958_0033066 3300045836 Bacteria 3080
76 Ga0466958_0121119 3300045836 Bacteria 1638
77 Ga0466967_0001593 3300045976 Bacteria 13358
78 Ga0466967_0412666 3300045976 Bacteria 1315
79 Ga0495592_0137772 3300046454 Bacteria 1700
80 Ga0495603_0006742 3300046455 Bacteria 6892
81 Ga0495590_0039655 3300046457 Bacteria 1643
82 Ga0495629_0132176 3300046459 Bacteria 1738
83 Ga0495651_0008587 3300046462 Bacteria 7830
84 Ga0495651_0086406 3300046462 Bacteria 2360
85 Ga0495651_0120003 3300046462 Bacteria 1933
86 Ga0495605_0002464 3300046474 Bacteria 11448
87 Ga0495605_0112262 3300046474 Bacteria 1242
88 Ga0495664_0094029 3300046477 Bacteria 1804
89 Ga0495585_0021319 3300046492 Bacteria 3721
90 Ga0495594_0130832 3300046499 Bacteria 1421
91 Ga0495583_0028235 3300046506 Bacteria 2761
92 Ga0495606_0205043 3300046507 Bacteria 1121
93 Ga0495620_0006639 3300046515 Bacteria 6340
94 Ga0495628_0003601 3300046516 Bacteria 13859
95 Ga0495628_0360622 3300046516 Bacteria 1067
96 Ga0495643_0001078 3300046522 Bacteria 27199
97 Ga0495648_0020674 3300046524 Bacteria 4583
98 Ga0495652_0001952 3300046529 Bacteria 21893
99 Ga0495640_0008479 3300046533 Bacteria 8057
100 Ga0495597_0021744 3300046542 Bacteria 2981
101 Ga0495668_0000360 3300046616 Bacteria 60235
102 Ga0495668_0013482 3300046616 Bacteria 4819
103 Ga0495634_0032426 3300046642 Bacteria 3593
104 Ga0495635_0018103 3300046663 Bacteria 4920
105 Ga0495657_0026941 3300046675 Bacteria 4064
106 Ga0495599_0163751 3300046678 Bacteria 1374
107 Ga0495623_0010581 3300046679 Bacteria 5971
108 Ga0495613_0106194 3300046689 Bacteria 2026
109 Ga0495624_0104160 3300046690 Bacteria 1746
110 Ga0495600_0059778 3300046809 Bacteria 2489
111 Ga0495660_0114102 3300046810 Bacteria 1375
112 Ga0495604_0036393 3300047317 Bacteria 3880
113 Ga0495636_0062109 3300047318 Bacteria 1581
114 Ga0495636_0077953 3300047318 Bacteria 1423
115 Ga0495687_000798 3300047443 Bacteria 33919
116 Ga0495675_0128326 3300047444 Bacteria 1577
117 Ga0495677_0016213 3300047445 Bacteria 2704
118 Ga0495685_034088 3300047447 Bacteria 1749
119 Ga0496108_0234127 3300048911 Bacteria 1597
120 Ga0496113_0416787 3300048916 Bacteria 1079
121 Ga0496121_0369144 3300048924 Bacteria 950
122 Ga0496125_0050414 3300048928 Bacteria 3446
123 Ga0495678_019835 3300049459 Bacteria 2989
124 Ga0495682_0103453 3300049460 Bacteria 1021
125 Ga0501031_0032012 3300049568 Bacteria 3429
126 Ga0501032_0004870 3300049569 Bacteria 10048
127 Ga0501032_0055905 3300049569 Bacteria 2654
128 Ga0501032_0142474 3300049569 Bacteria 1578
129 Ga0501033_0173519 3300049570 Bacteria 1548
130 Ga0501034_0100118 3300049571 Bacteria 2892
131 Ga0501034_0153479 3300049571 Bacteria 2278
132 Ga0501034_0574732 3300049571 Bacteria 1034
133 Ga0501036_0016055 3300049572 Bacteria 6256
134 Ga0501036_0133346 3300049572 Bacteria 2096
135 Ga0501036_0236105 3300049572 Bacteria 1534
136 Ga0501037_0056125 3300049573 Bacteria 2877
137 Ga0501038_0014245 3300049574 Bacteria 7244
138 Ga0501039_0115966 3300049575 Bacteria 2096
139 Ga0501039_0316604 3300049575 Bacteria 1227
140 Ga0501041_0005150 3300049577 Bacteria 7628
141 Ga0501042_0035635 3300049578 Bacteria 3529
142 Ga0501043_0005831 3300049579 Bacteria 9906
143 Ga0501043_0020964 3300049579 Bacteria 5125
144 Ga0501046_0023224 3300049580 Bacteria 5103
145 Ga0501046_0026150 3300049580 Bacteria 4768
146 Ga0501046_0106505 3300049580 Bacteria 2146
147 Ga0501047_0000054 3300049581 Bacteria 149749
148 Ga0501047_0051730 3300049581 Bacteria 3969
149 Ga0501047_0091405 3300049581 Bacteria 2921
150 Ga0501047_0204240 3300049581 Bacteria 1836
151 Ga0501047_0396922 3300049581 Bacteria 1212
152 Ga0501048_0032385 3300049582 Bacteria 3777
153 Ga0501067_0050055 3300049583 Bacteria 2315
154 Ga0501068_0012798 3300049584 Bacteria 4763
155 Ga0501070_0035140 3300049586 Bacteria 4188
156 Ga0501070_0223188 3300049586 Bacteria 1545
157 Ga0501072_0071807 3300049588 Bacteria 2735
158 Ga0501076_0008596 3300049592 Bacteria 7490
159 Ga0501077_0083310 3300049593 Bacteria 2026
160 Ga0501079_0005514 3300049741 Bacteria 9432
161 Ga0501083_0008091 3300049744 Bacteria 7435
162 Ga0501035_0051172 3300049822 Bacteria 3699
163 Ga0501035_0077301 3300049822 Bacteria 2941
164 Ga0501035_0103266 3300049822 Bacteria 2500
165 Ga0501035_0135280 3300049822 Bacteria 2146
166 Ga0501044_0012287 3300049823 Bacteria 9271
167 Ga0501044_0021323 3300049823 Bacteria 6914
168 Ga0501044_0076127 3300049823 Bacteria 3407
169 Ga0501044_0128240 3300049823 Bacteria 2532
170 Ga0501044_0139097 3300049823 Bacteria 2417
171 Ga0501045_0098037 3300049824 Bacteria 2168
172 Ga0501045_0119371 3300049824 Bacteria 1958
173 Ga0501045_0169957 3300049824 Bacteria 1624
174 nmdc:mga06z11_13164_c1 3300050494 Bacteria 3623
175 Ga0495601_0003970 3300053077 Bacteria 8517
176 Ga0495601_0017754 3300053077 Bacteria 4323
177 Ga0495601_0057739 3300053077 Bacteria 2458
178 Ga0495612_0002666 3300053078 Bacteria 7366
179 Ga0495619_0012526 3300053085 Bacteria 5343
180 Ga0501084_0004520 3300054114 Bacteria 11377
181 Ga0501082_0005445 3300060353 Bacteria 11052
182 Ga0466962_0003289 3300061719 Bacteria 7677
183 Ga0466962_0026299 3300061719 Bacteria 2794
184 Ga0530510_0144384 3300061734 Bacteria 1755
185 2547408919 2547132111 Bacteria 8013147
186 2559425822 2558860280 Bacteria 11429938
187 2566993800 2565956761 Bacteria 6601618
188 2585306070 2582581313 Bacteria 10042643
189 2585316486 2582581314 Bacteria 11452267
190 2586064373 2585427649 Bacteria 9053857
191 2643903587 2643221578 Bacteria 9213798
192 2644182121 2643221632 Bacteria 3406696
193 2644409749 2643221673 Bacteria 9196637
194 2738889095 2738541308 Bacteria 7020677
195 2784585981 2784132148 Bacteria 8627943
196 2785366168 2784746768 Bacteria 10036182
197 2809229483 2808606448 Bacteria 8656184
198 2809586377 2808606522 Bacteria 9488490
199 2862512856 2862507626 Bacteria 9425308
200 2866554964 2866552031 Bacteria 5824618
201 2904536891 2904535858 Bacteria 6308016
202 2915775955 2915768154 Bacteria 8424322
203 2922555318 2922554459 Bacteria 6683962
204 2932400488 2932398195 Bacteria 3847976
205 2946052962 2946045630 Bacteria 8527308
206 2947224496 2947224130 Bacteria 9938529
207 2954700529 2954691527 Bacteria 10720516
208 2990063284 2990059506 Bacteria 9321252
209 2995469384 2995463766 Bacteria 8577691
210 3006325349 3006321560 Bacteria 8247479
211 3006498653 3006493962 Bacteria 8825450
212 8003321162 8003314358 Bacteria 10575343
213 8008560169 8008558824 Bacteria 10610750
214 8023631876 8023623736 Bacteria 8593882
215 Ga0070665_100131198
216 rootH2_10066633
217 rootH2_10193441
218 rootH1_10073933
219 Ga0006562J51391_1069578
220 Ga0070709_10274771
221 Ga0070714_100038206
222 Ga0070710_10003372
223 Ga0068852_100058618
224 Ga0070717_10278391
225 Ga0075367_10081320
226 Ga0105238_10121919
227 Ga0182008_10002840
228 Ga0182007_10000199
229 Ga0209148_1001506
230 Ga0209455_1001172
231 Ga0207692_10001968
232 Ga0207699_10153309
233 Ga0207698_10045315
234 Ga0268266_10088016
235 Ga0307517_10095738
236 Ga0307515_10040578
237 Ga0307511_10000188
238 Ga0307511_10012278
239 Ga0307511_10051491
240 Ga0316177_1037908
241 Ga0314311_1005402
242 Ga0307513_10057748
243 Ga0307509_10012567
244 Ga0307509_10166586
245 Ga0307508_10059266
246 Ga0307514_10146335
247 Ga0307516_10017913
248 Ga0307518_10002393
249 Ga0307518_10059449
250 Ga0307507_10014993
251 Ga0307510_10067262
252 Ga0373951_0000213
253 Ga0373925_0379627
254 Ga0451853_1473579
255 Ga0439448_0003314
256 Ga0439457_000104
257 Ga0450898_000272
258 Ga0450899_000410
259 Ga0450906_000721
260 Ga0450908_003170
261 Ga0466969_0003000
262 Ga0466969_0003827
263 Ga0466969_0012876
264 Ga0466969_0017618
265 Ga0466969_0019591
266 Ga0466972_0008470
267 Ga0466972_0016242
268 Ga0466972_0030763
269 Ga0466965_0004741
270 Ga0466965_0007499
271 Ga0466965_0066835
272 Ga0466966_0003145
273 Ga0466966_0007834
274 Ga0466961_0015996
275 Ga0466961_0029924
276 Ga0466961_0079144
277 Ga0466963_0005896
278 Ga0466963_0114028
279 Ga0466971_0000301
280 Ga0466971_0016216
281 Ga0466971_0115819
282 Ga0466968_0026849
283 Ga0466970_0032639
284 Ga0466957_0286215
285 Ga0466959_0006058
286 Ga0466959_0019141
287 Ga0466959_0036888
288 Ga0466959_0179346
289 Ga0466958_0033066
290 Ga0466958_0121119
291 Ga0466967_0001593
292 Ga0466967_0412666
293 Ga0495592_0137772
294 Ga0495603_0006742
295 Ga0495590_0039655
296 Ga0495629_0132176
297 Ga0495651_0008587
298 Ga0495651_0086406
299 Ga0495651_0120003
300 Ga0495605_0002464
301 Ga0495605_0112262
302 Ga0495664_0094029
303 Ga0495585_0021319
304 Ga0495594_0130832
305 Ga0495583_0028235
306 Ga0495606_0205043
307 Ga0495620_0006639
308 Ga0495628_0003601
309 Ga0495628_0360622
310 Ga0495643_0001078
311 Ga0495648_0020674
312 Ga0495652_0001952
313 Ga0495640_0008479
314 Ga0495597_0021744
315 Ga0495668_0000360
316 Ga0495668_0013482
317 Ga0495634_0032426
318 Ga0495635_0018103
319 Ga0495657_0026941
320 Ga0495599_0163751
321 Ga0495623_0010581
322 Ga0495613_0106194
323 Ga0495624_0104160
324 Ga0495600_0059778
325 Ga0495660_0114102
326 Ga0495604_0036393
327 Ga0495636_0062109
328 Ga0495636_0077953
329 Ga0495687_000798
330 Ga0495675_0128326
331 Ga0495677_0016213
332 Ga0495685_034088
333 Ga0496108_0234127
334 Ga0496113_0416787
335 Ga0496121_0369144
336 Ga0496125_0050414
337 Ga0495678_019835
338 Ga0495682_0103453
339 Ga0501031_0032012
340 Ga0501032_0004870
341 Ga0501032_0055905
342 Ga0501032_0142474
343 Ga0501033_0173519
344 Ga0501034_0100118
345 Ga0501034_0153479
346 Ga0501034_0574732
347 Ga0501036_0016055
348 Ga0501036_0133346
349 Ga0501036_0236105
350 Ga0501037_0056125
351 Ga0501038_0014245
352 Ga0501039_0115966
353 Ga0501039_0316604
354 Ga0501041_0005150
355 Ga0501042_0035635
356 Ga0501043_0005831
357 Ga0501043_0020964
358 Ga0501046_0023224
359 Ga0501046_0026150
360 Ga0501046_0106505
361 Ga0501047_0000054
362 Ga0501047_0051730
363 Ga0501047_0091405
364 Ga0501047_0204240
365 Ga0501047_0396922
366 Ga0501048_0032385
367 Ga0501067_0050055
368 Ga0501068_0012798
369 Ga0501070_0035140
370 Ga0501070_0223188
371 Ga0501072_0071807
372 Ga0501076_0008596
373 Ga0501077_0083310
374 Ga0501079_0005514
375 Ga0501083_0008091
376 Ga0501035_0051172
377 Ga0501035_0077301
378 Ga0501035_0103266
379 Ga0501035_0135280
380 Ga0501044_0012287
381 Ga0501044_0021323
382 Ga0501044_0076127
383 Ga0501044_0128240
384 Ga0501044_0139097
385 Ga0501045_0098037
386 Ga0501045_0119371
387 Ga0501045_0169957
388 nmdc:mga06z11_13164_c1
389 Ga0495601_0003970
390 Ga0495601_0017754
391 Ga0495601_0057739
392 Ga0495612_0002666
393 Ga0495619_0012526
394 Ga0501084_0004520
395 Ga0501082_0005445
396 Ga0466962_0003289
397 Ga0466962_0026299
398 Ga0530510_0144384
399 2547408919
400 2559425822
401 2566993800
402 2585306070
403 2585316486
404 2586064373
405 2643903587
406 2644182121
407 2644409749
408 2738889095
409 2784585981
410 2785366168
411 2809229483
412 2809586377
413 2862512856
414 2866554964
415 2904536891
416 2915775955
417 2922555318
418 2932400488
419 2946052962
420 2947224496
421 2954700529
422 2990063284
423 2995469384
424 3006325349
425 3006498653
426 8003321162
427 8008560169
428 8023631876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

6

64

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fd3-assembly1.cif.gz_A-2 structure of the c-terminal domains of a lysr family protein from agrobacterium tumefaciens str. c58. 0.9309 92 295
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9265 5 86
3isp-assembly1.cif.gz_A-2 crystal structure of argp from mycobacterium tuberculosis 0.9252 4 295
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9232 5 86
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9232 4 87
ID Description Score Start End Superfamily
af_P9WMF5_6_80_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9841 5 78 1.10.10.10
af_P67662_3_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9731 6 86 1.10.10.10
af_P9WMF5_6_80_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9587 5 78 1.10.10.10
3ispA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9494 4 86 1.10.10.10
af_P0ACQ7_8_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9476 6 86 1.10.10.10
ID Description Score Start End GO Terms
AF-F3ZJR5-F1-model_v4 Putative chromosome replication initiation inhibitor protein 0.988 2 89 GO:0003700
AF-A0A6L6T7X7-F1-model_v4 ArgP/LysG family DNA-binding transcriptional regulator 0.9552 4 295 GO:0003677
GO:0003700
AF-A0A7C6RHW2-F1-model_v4 ArgP/LysG family DNA-binding transcriptional regulator 0.9524 5 161 GO:0003677
GO:0003700
AF-A0A1V4PM17-F1-model_v4 Transcriptional regulator ArgP 0.9475 4 297 GO:0003700
AF-A0A109EJQ2-F1-model_v4 deleted 0.9429 1 295

Map