F324655

General Info

Members Datasets Scaffolds Average Seq Length
213 146 426 245

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2995463766|2995468051
Length 281
Sequence SGTPGAVAPFVPSGRPAPGGGRDLASGISAGRQQLLSIGAVLTELQAEFPEVTISKIRFLEAERLVEPQRTPSGYRKFSAVDVERLAYVLRMQRDHYLPLRVIREHLAALDRGENPPALPGSGSGAAGGQGDSAGGAGADEAFDPVRDGALVAGSVAGGTRLGRAELLAAAGITEPQLAEWESYGLVTADPDGGFDGEMLQVARLVAELGRFGLEPRHLRAVKAAADREVGLVEQIVAPLRRHRNPQTRAHAAAMARELATLSVRLHASLVQAGLRARPGA

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
13 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
19 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
20 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
28 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
29 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
30 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
31 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
32 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
33 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
34 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
35 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
36 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
37 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
38 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
39 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
40 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
41 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
42 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
43 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
44 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
45 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
46 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
47 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
48 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
49 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
50 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
51 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
52 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
53 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
54 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
55 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
56 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
57 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
58 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
59 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
60 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
61 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
62 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
63 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
64 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
65 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
66 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
67 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
68 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
69 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
70 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
71 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
72 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
73 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
74 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
75 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
76 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
77 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
80 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
81 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
82 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
83 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
108 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
109 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
110 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
111 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
112 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
113 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
114 2643221548 Streptomyces sp. Root55 Isolate Unclassified
115 2643221578 Streptomyces sp. Root63 Isolate Unclassified
116 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
117 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
118 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
119 2643221670 Streptomyces sp. Root431 Isolate Unclassified
120 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
121 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
122 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
123 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
124 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
125 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
126 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
127 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
128 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
129 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
130 2867369537 Streptomyces sp. Z26 Isolate Unclassified
131 2867475112 Streptomyces sp. TM32 Isolate Unclassified
132 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
133 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
134 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
135 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
136 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
137 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
138 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
139 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
140 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
141 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
142 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
143 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
144 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
145 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
146 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.22
Metatranscriptomes 1.41
Isolates 17.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.82
Nodule 0
Rhizoplane 0.47
Rhizosphere 87.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1007954 3300003354 Bacteria 4083
2 Ga0070658_10005464 3300005327 Bacteria 10307
3 Ga0070680_100013635 3300005336 Bacteria 6336
4 Ga0070660_100495658 3300005339 Bacteria 1016
5 Ga0070713_100764502 3300005436 Bacteria 925
6 Ga0070681_10005943 3300005458 Bacteria 11814
7 Ga0070679_100003650 3300005530 Bacteria 14087
8 Ga0070679_100080438 3300005530 Bacteria 3248
9 Ga0070679_100701207 3300005530 Bacteria 955
10 Ga0070697_100316115 3300005536 Bacteria 1344
11 Ga0070665_100124568 3300005548 Bacteria 2579
12 Ga0068855_100894724 3300005563 Bacteria 938
13 Ga0075428_100176470 3300006844 Bacteria 2314
14 Ga0075428_100230481 3300006844 Bacteria 1999
15 Ga0075430_100330690 3300006846 Bacteria 1259
16 Ga0075429_100276479 3300006880 Bacteria 1470
17 Ga0105245_10352847 3300009098 Bacteria 1458
18 Ga0114129_10050541 3300009147 Bacteria 5839
19 Ga0157369_10019457 3300013105 Bacteria 7596
20 Ga0197907_10096407 3300020069 Bacteria 4978
21 Ga0224712_10050714 3300022467 Bacteria 1613
22 Ga0224712_10088449 3300022467 Bacteria 1293
23 Ga0207426_1009103 3300025302 Bacteria 3949
24 Ga0207426_1031828 3300025302 Bacteria 1718
25 Ga0207426_1077644 3300025302 Bacteria 909
26 Ga0207705_10008652 3300025909 Bacteria 7418
27 Ga0207705_10374161 3300025909 Bacteria 1100
28 Ga0207705_10377025 3300025909 Bacteria 1095
29 Ga0207707_10151585 3300025912 Bacteria 2026
30 Ga0207707_10159270 3300025912 Bacteria 1974
31 Ga0207660_10026885 3300025917 Bacteria 3922
32 Ga0207660_10259427 3300025917 Bacteria 1374
33 Ga0207657_10330843 3300025919 Bacteria 1203
34 Ga0207652_10014337 3300025921 Bacteria 6419
35 Ga0207652_10065165 3300025921 Bacteria 3154
36 Ga0268266_10023641 3300028379 Bacteria 5231
37 Ga0307416_100058053 3300032002 Bacteria 3135
38 Ga0395898_0122958 3300037466 Bacteria 2487
39 Ga0466969_0003154 3300044656 Bacteria 8777
40 Ga0466969_0013005 3300044656 Bacteria 4383
41 Ga0466972_0046912 3300044658 Bacteria 2090
42 Ga0466966_0007030 3300044684 Bacteria 7452
43 Ga0466966_0017897 3300044684 Bacteria 4679
44 Ga0466961_0010009 3300044693 Bacteria 6041
45 Ga0466961_0024937 3300044693 Bacteria 3848
46 Ga0466971_0001082 3300044719 Bacteria 11307
47 Ga0466968_0242406 3300044735 Bacteria 854
48 Ga0466970_0079358 3300044765 Bacteria 1772
49 Ga0466957_0155105 3300044842 Bacteria 1484
50 Ga0466960_0024305 3300044901 Bacteria 2732
51 Ga0466959_0001862 3300045049 Bacteria 13254
52 Ga0466959_0012563 3300045049 Bacteria 6123
53 Ga0466959_0262427 3300045049 Bacteria 1189
54 Ga0466958_0207147 3300045836 Bacteria 1249
55 Ga0495592_0005962 3300046454 Bacteria 9055
56 Ga0495603_0000602 3300046455 Bacteria 20226
57 Ga0495603_0004346 3300046455 Bacteria 8453
58 Ga0495603_0008687 3300046455 Bacteria 6139
59 Ga0495603_0105626 3300046455 Bacteria 1643
60 Ga0495629_0002606 3300046459 Bacteria 13822
61 Ga0495629_0008929 3300046459 Bacteria 7367
62 Ga0495629_0018772 3300046459 Bacteria 4943
63 Ga0495629_0020481 3300046459 Bacteria 4722
64 Ga0495629_0140510 3300046459 Bacteria 1680
65 Ga0495651_0023716 3300046462 Bacteria 4770
66 Ga0495651_0109238 3300046462 Bacteria 2047
67 Ga0495653_0017407 3300046463 Bacteria 5845
68 Ga0495582_0065668 3300046473 Bacteria 2005
69 Ga0495639_0014087 3300046475 Bacteria 3459
70 Ga0495662_0002146 3300046476 Bacteria 9900
71 Ga0495662_0007708 3300046476 Bacteria 5303
72 Ga0495662_0086817 3300046476 Bacteria 1524
73 Ga0495664_0000797 3300046477 Bacteria 16119
74 Ga0495664_0101007 3300046477 Bacteria 1738
75 Ga0495594_0003181 3300046499 Bacteria 8494
76 Ga0495594_0044442 3300046499 Bacteria 2436
77 Ga0495583_0070961 3300046506 Bacteria 1531
78 Ga0495608_0017897 3300046511 Bacteria 4897
79 Ga0495628_0020754 3300046516 Bacteria 5413
80 Ga0495628_0054598 3300046516 Bacteria 3149
81 Ga0495630_0506792 3300046517 Bacteria 925
82 Ga0495643_0133406 3300046522 Bacteria 1245
83 Ga0495666_0023850 3300046526 Bacteria 3025
84 Ga0495665_0009836 3300046531 Bacteria 5176
85 Ga0495640_0001343 3300046533 Bacteria 19357
86 Ga0495640_0015041 3300046533 Bacteria 5830
87 Ga0495586_0013757 3300046535 Bacteria 4294
88 Ga0495586_0074995 3300046535 Bacteria 1852
89 Ga0495645_0027907 3300046543 Bacteria 4101
90 Ga0495645_0139948 3300046543 Bacteria 1689
91 Ga0495622_0037464 3300046557 Bacteria 2259
92 Ga0495622_0180957 3300046557 Bacteria 945
93 Ga0495667_0007366 3300046559 Bacteria 7462
94 Ga0495656_0041587 3300046615 Bacteria 1921
95 Ga0495588_0002418 3300046674 Bacteria 7985
96 Ga0495588_0015849 3300046674 Bacteria 3634
97 Ga0495657_0007696 3300046675 Bacteria 8293
98 Ga0495657_0014021 3300046675 Bacteria 5887
99 Ga0495657_0036484 3300046675 Bacteria 3397
100 Ga0495623_0028373 3300046679 Bacteria 3601
101 Ga0495646_0022524 3300046680 Bacteria 3972
102 Ga0495613_0001133 3300046689 Bacteria 20309
103 Ga0495613_0003465 3300046689 Bacteria 11799
104 Ga0495613_0045478 3300046689 Bacteria 3246
105 Ga0495613_0318119 3300046689 Bacteria 1074
106 Ga0495624_0057410 3300046690 Bacteria 2447
107 Ga0495670_0213465 3300046691 Bacteria 1024
108 Ga0495589_0162519 3300046794 Bacteria 1063
109 Ga0495600_0038355 3300046809 Bacteria 3117
110 Ga0495581_0029563 3300047315 Bacteria 3176
111 Ga0495581_0083404 3300047315 Bacteria 1851
112 Ga0495581_0144698 3300047315 Bacteria 1387
113 Ga0495581_0162097 3300047315 Bacteria 1307
114 Ga0495604_0000717 3300047317 Bacteria 28071
115 Ga0495604_0032281 3300047317 Bacteria 4152
116 Ga0495636_0005011 3300047318 Bacteria 5198
117 Ga0495636_0008796 3300047318 Bacteria 3979
118 Ga0495636_0152917 3300047318 Bacteria 1036
119 Ga0495674_0020148 3300047319 Bacteria 6179
120 Ga0495676_0002482 3300047321 Bacteria 16411
121 Ga0495676_0004276 3300047321 Bacteria 13029
122 Ga0495676_0010521 3300047321 Bacteria 8385
123 Ga0495683_0190393 3300047323 Bacteria 931
124 Ga0495687_001837 3300047443 Bacteria 18639
125 Ga0495675_0012537 3300047444 Bacteria 5335
126 Ga0495675_0016732 3300047444 Bacteria 4637
127 Ga0495685_030734 3300047447 Bacteria 1847
128 Ga0495685_066993 3300047447 Bacteria 1206
129 Ga0495681_0058671 3300047470 Bacteria 1782
130 Ga0495593_0018986 3300047673 Bacteria 3858
131 Ga0495602_0014063 3300048088 Bacteria 8140
132 Ga0495614_0000686 3300048089 Bacteria 14242
133 Ga0496106_0055810 3300048909 Bacteria 2986
134 Ga0501031_0005622 3300049568 Bacteria 8168
135 Ga0501031_0051889 3300049568 Bacteria 2672
136 Ga0501032_0030047 3300049569 Bacteria 3727
137 Ga0501033_0035398 3300049570 Bacteria 3743
138 Ga0501033_0081219 3300049570 Bacteria 2377
139 Ga0501034_0017007 3300049571 Bacteria 7456
140 Ga0501034_0027557 3300049571 Bacteria 5779
141 Ga0501034_0043005 3300049571 Bacteria 4573
142 Ga0501036_0014558 3300049572 Bacteria 6549
143 Ga0501036_0040487 3300049572 Bacteria 3941
144 Ga0501037_0358244 3300049573 Bacteria 1005
145 Ga0501038_0022252 3300049574 Bacteria 5682
146 Ga0501038_0038964 3300049574 Bacteria 4159
147 Ga0501039_0027902 3300049575 Bacteria 4342
148 Ga0501043_0055399 3300049579 Bacteria 3115
149 Ga0501043_0088226 3300049579 Bacteria 2437
150 Ga0501046_0088238 3300049580 Bacteria 2389
151 Ga0501047_0003295 3300049581 Bacteria 15296
152 Ga0501047_0056593 3300049581 Bacteria 3792
153 Ga0501047_0307921 3300049581 Bacteria 1425
154 Ga0501069_0007606 3300049585 Bacteria 5686
155 Ga0501070_0007619 3300049586 Bacteria 9191
156 Ga0501070_0028044 3300049586 Bacteria 4721
157 Ga0501071_0002969 3300049587 Bacteria 10484
158 Ga0501072_0005901 3300049588 Bacteria 9329
159 Ga0501035_0021743 3300049822 Bacteria 5898
160 Ga0501035_0071454 3300049822 Bacteria 3072
161 Ga0501035_0139311 3300049822 Bacteria 2110
162 Ga0501035_0158482 3300049822 Bacteria 1960
163 Ga0501044_0092300 3300049823 Bacteria 3053
164 Ga0501044_0100805 3300049823 Bacteria 2905
165 Ga0501044_0101877 3300049823 Bacteria 2888
166 Ga0501044_0102149 3300049823 Bacteria 2883
167 Ga0501044_0315814 3300049823 Bacteria 1488
168 Ga0501044_0444750 3300049823 Bacteria 1203
169 Ga0501045_0032328 3300049824 Bacteria 3792
170 nmdc:mga05p37_221116_c1 3300050507 Bacteria 2285
171 nmdc:mga0qj67_20561_c1 3300050509 Bacteria 5056
172 Ga0495601_0011311 3300053077 Bacteria 5333
173 Ga0495619_0030392 3300053085 Bacteria 3497
174 Ga0500578_0021965 3300053086 Bacteria 4099
175 Ga0500573_0027264 3300053140 Bacteria 3285
176 Ga0466962_0031223 3300061719 Bacteria 2550
177 2995468051 2995463766 Bacteria 8577691
178 2554259661 2554235005 Bacteria 6457341
179 2585297859 2582581312 Bacteria 7308206
180 2616905335 2616644941 Bacteria 8510691
181 2643764561 2643221548 Bacteria 8053412
182 2643905218 2643221578 Bacteria 9213798
183 2643942717 2643221587 Bacteria 7586415
184 2644016258 2643221601 Bacteria 7493239
185 2644178520 2643221631 Bacteria 8168043
186 2644385891 2643221670 Bacteria 6497041
187 2644403276 2643221673 Bacteria 9196637
188 2644430176 2643221677 Bacteria 7584031
189 2644458380 2643221682 Bacteria 6743283
190 2811846847 2808606982 Bacteria 7791042
191 2812482537 2811994917 Bacteria 7761064
192 2819699770 2818991463 Bacteria 7948711
193 2819744010 2818991472 Bacteria 10089953
194 2862181422 2862178590 Bacteria 8583590
195 2862294126 2862290372 Bacteria 7471434
196 2862508462 2862507626 Bacteria 9425308
197 2867375228 2867369537 Bacteria 6501581
198 2867475990 2867475112 Bacteria 6909112
199 2875392582 2875391855 Bacteria 7600475
200 2912722632 2912715099 Bacteria 9460473
201 2912758723 2912757875 Bacteria 7940295
202 2918502392 2918501144 Bacteria 8668083
203 2935394167 2935390628 Bacteria 7043367
204 2946052134 2946045630 Bacteria 8527308
205 2966604549 2966598605 Bacteria 7676064
206 2990093379 2990088156 Bacteria 6657676
207 2997451920 2997451912 Bacteria 8492419
208 2997603422 2997600082 Bacteria 9896405
209 3006430712 3006425503 Bacteria 6491253
210 8025486196 8025478263 Bacteria 8209203
211 8025533891 8025530807 Bacteria 8495698
212 8033687846 8033684223 Bacteria 6906479
213 8054166907 8054160619 Bacteria 7783213
214 JGI25160J50197_1007954
215 Ga0070658_10005464
216 Ga0070680_100013635
217 Ga0070660_100495658
218 Ga0070713_100764502
219 Ga0070681_10005943
220 Ga0070679_100003650
221 Ga0070679_100080438
222 Ga0070679_100701207
223 Ga0070697_100316115
224 Ga0070665_100124568
225 Ga0068855_100894724
226 Ga0075428_100176470
227 Ga0075428_100230481
228 Ga0075430_100330690
229 Ga0075429_100276479
230 Ga0105245_10352847
231 Ga0114129_10050541
232 Ga0157369_10019457
233 Ga0197907_10096407
234 Ga0224712_10050714
235 Ga0224712_10088449
236 Ga0207426_1009103
237 Ga0207426_1031828
238 Ga0207426_1077644
239 Ga0207705_10008652
240 Ga0207705_10374161
241 Ga0207705_10377025
242 Ga0207707_10151585
243 Ga0207707_10159270
244 Ga0207660_10026885
245 Ga0207660_10259427
246 Ga0207657_10330843
247 Ga0207652_10014337
248 Ga0207652_10065165
249 Ga0268266_10023641
250 Ga0307416_100058053
251 Ga0395898_0122958
252 Ga0466969_0003154
253 Ga0466969_0013005
254 Ga0466972_0046912
255 Ga0466966_0007030
256 Ga0466966_0017897
257 Ga0466961_0010009
258 Ga0466961_0024937
259 Ga0466971_0001082
260 Ga0466968_0242406
261 Ga0466970_0079358
262 Ga0466957_0155105
263 Ga0466960_0024305
264 Ga0466959_0001862
265 Ga0466959_0012563
266 Ga0466959_0262427
267 Ga0466958_0207147
268 Ga0495592_0005962
269 Ga0495603_0000602
270 Ga0495603_0004346
271 Ga0495603_0008687
272 Ga0495603_0105626
273 Ga0495629_0002606
274 Ga0495629_0008929
275 Ga0495629_0018772
276 Ga0495629_0020481
277 Ga0495629_0140510
278 Ga0495651_0023716
279 Ga0495651_0109238
280 Ga0495653_0017407
281 Ga0495582_0065668
282 Ga0495639_0014087
283 Ga0495662_0002146
284 Ga0495662_0007708
285 Ga0495662_0086817
286 Ga0495664_0000797
287 Ga0495664_0101007
288 Ga0495594_0003181
289 Ga0495594_0044442
290 Ga0495583_0070961
291 Ga0495608_0017897
292 Ga0495628_0020754
293 Ga0495628_0054598
294 Ga0495630_0506792
295 Ga0495643_0133406
296 Ga0495666_0023850
297 Ga0495665_0009836
298 Ga0495640_0001343
299 Ga0495640_0015041
300 Ga0495586_0013757
301 Ga0495586_0074995
302 Ga0495645_0027907
303 Ga0495645_0139948
304 Ga0495622_0037464
305 Ga0495622_0180957
306 Ga0495667_0007366
307 Ga0495656_0041587
308 Ga0495588_0002418
309 Ga0495588_0015849
310 Ga0495657_0007696
311 Ga0495657_0014021
312 Ga0495657_0036484
313 Ga0495623_0028373
314 Ga0495646_0022524
315 Ga0495613_0001133
316 Ga0495613_0003465
317 Ga0495613_0045478
318 Ga0495613_0318119
319 Ga0495624_0057410
320 Ga0495670_0213465
321 Ga0495589_0162519
322 Ga0495600_0038355
323 Ga0495581_0029563
324 Ga0495581_0083404
325 Ga0495581_0144698
326 Ga0495581_0162097
327 Ga0495604_0000717
328 Ga0495604_0032281
329 Ga0495636_0005011
330 Ga0495636_0008796
331 Ga0495636_0152917
332 Ga0495674_0020148
333 Ga0495676_0002482
334 Ga0495676_0004276
335 Ga0495676_0010521
336 Ga0495683_0190393
337 Ga0495687_001837
338 Ga0495675_0012537
339 Ga0495675_0016732
340 Ga0495685_030734
341 Ga0495685_066993
342 Ga0495681_0058671
343 Ga0495593_0018986
344 Ga0495602_0014063
345 Ga0495614_0000686
346 Ga0496106_0055810
347 Ga0501031_0005622
348 Ga0501031_0051889
349 Ga0501032_0030047
350 Ga0501033_0035398
351 Ga0501033_0081219
352 Ga0501034_0017007
353 Ga0501034_0027557
354 Ga0501034_0043005
355 Ga0501036_0014558
356 Ga0501036_0040487
357 Ga0501037_0358244
358 Ga0501038_0022252
359 Ga0501038_0038964
360 Ga0501039_0027902
361 Ga0501043_0055399
362 Ga0501043_0088226
363 Ga0501046_0088238
364 Ga0501047_0003295
365 Ga0501047_0056593
366 Ga0501047_0307921
367 Ga0501069_0007606
368 Ga0501070_0007619
369 Ga0501070_0028044
370 Ga0501071_0002969
371 Ga0501072_0005901
372 Ga0501035_0021743
373 Ga0501035_0071454
374 Ga0501035_0139311
375 Ga0501035_0158482
376 Ga0501044_0092300
377 Ga0501044_0100805
378 Ga0501044_0101877
379 Ga0501044_0102149
380 Ga0501044_0315814
381 Ga0501044_0444750
382 Ga0501045_0032328
383 nmdc:mga05p37_221116_c1
384 nmdc:mga0qj67_20561_c1
385 Ga0495601_0011311
386 Ga0495619_0030392
387 Ga0500578_0021965
388 Ga0500573_0027264
389 Ga0466962_0031223
390 2995468051
391 2554259661
392 2585297859
393 2616905335
394 2643764561
395 2643905218
396 2643942717
397 2644016258
398 2644178520
399 2644385891
400 2644403276
401 2644430176
402 2644458380
403 2811846847
404 2812482537
405 2819699770
406 2819744010
407 2862181422
408 2862294126
409 2862508462
410 2867375228
411 2867475990
412 2875392582
413 2912722632
414 2912758723
415 2918502392
416 2935394167
417 2946052134
418 2966604549
419 2990093379
420 2997451920
421 2997603422
422 3006430712
423 8025486196
424 8025533891
425 8033687846
426 8054166907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

43

110

0.95

Map