F324654

General Info

Members Datasets Scaffolds Average Seq Length
213 182 426 510

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990059506|2990059682
Length 546
Sequence HNSSLLPMAHQEPLMTTIEQPTGPNSAKNTSDDADLAEFGYKPELKRTLGNFHTFAAGISYISILTGTFQLFYFGFASGGPAYWWSWPMVFVGQFMVALCFAELAARYPVAGSVYNWSKKIGNPHLGWLAGWMMLIASVVSIAAVALAYQLTLPQISDVFQIVGDGTGTYDVATNAVILAAVLILFTTVVNAFGVKLMAQVNTAGVFIELIATVVLIVLFAVHITRGPQVVMETNGTGAAYGNGYLGAFLVASLASAYVMYGFDTAASLGEESLDPTRNAPRAIIRAIVASFLLGGLILLLALMSVSSLKGEQLSTDGLQYVVLNVLGPTAGKAMLWCVLIAVTVCALAVHTAAVRLAFAMARDNNLPASSKLAKIHPRFQTPVLPTVIIGVLALSILVVNIRQPQIFTVVTSIGIIMIYLAYLGVTVPMLVARLRGKWQPAGDGRFSLGRWGIPVNILAVVWGTGMTLNLIWPRASVYNATAPFHWYLQWGAVLFVGVIAGGGFAYYWFIQRHRTGVLAEHAVAVEAGTTPPAPAASPVASPAAD

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
8 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
14 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
15 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
23 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
24 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
25 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
26 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
27 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
28 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
29 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
30 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
31 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
32 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
39 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
42 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
43 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
44 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
45 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
46 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
47 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
48 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
51 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
52 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
53 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
68 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
69 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
70 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
79 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
103 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
123 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
124 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
125 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
126 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
127 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
128 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
129 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
132 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
133 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
134 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
135 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
136 2558860280 Kutzneria sp. 744 Isolate Unclassified
137 2582580736 Prauserella sp. Am3 Isolate Unclassified
138 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
139 2643221578 Streptomyces sp. Root63 Isolate Unclassified
140 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
141 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
142 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
143 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
144 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
145 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
146 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
147 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
148 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
149 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
150 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
151 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
152 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
153 2862574272 Streptomyces sp. AcE210 Isolate Nodule
154 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
155 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
156 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
157 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
158 2867475112 Streptomyces sp. TM32 Isolate Unclassified
159 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
160 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
161 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
162 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
163 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
164 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
165 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
166 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
167 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
168 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
169 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
170 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
171 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
172 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
173 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
174 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
175 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
176 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
177 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
178 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
179 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
180 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
181 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
182 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.06
Metatranscriptomes 0
Isolates 23.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.39
Nodule 1.88
Rhizoplane 1.41
Rhizosphere 64.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003035 3300000549 Bacteria 2274
2 rootH2_10165302 3300003320 Bacteria 3822
3 Ga0055540_1002313 3300003792 Bacteria 10223
4 Ga0070671_100001577 3300005355 Bacteria 17149
5 Ga0068853_100047440 3300005539 Bacteria 3686
6 Ga0070665_100001649 3300005548 Bacteria 25714
7 Ga0068852_100145076 3300005616 Bacteria 2201
8 Ga0068863_100059094 3300005841 Bacteria 3628
9 Ga0081455_10047876 3300005937 Bacteria 3698
10 Ga0081538_10000107 3300005981 Bacteria 82480
11 Ga0081538_10005783 3300005981 Bacteria 11034
12 Ga0081538_10011782 3300005981 Bacteria 7057
13 Ga0081539_10030047 3300005985 Bacteria 3382
14 Ga0075363_100015565 3300006048 Bacteria 3741
15 Ga0163162_10016540 3300013306 Bacteria 7209
16 Ga0207426_1001209 3300025302 Bacteria 22896
17 Ga0207426_1001671 3300025302 Bacteria 17176
18 Ga0207426_1009137 3300025302 Bacteria 3942
19 Ga0209051_1001713 3300025303 Bacteria 17505
20 Ga0207644_10014643 3300025931 Bacteria 5252
21 Ga0207668_10001483 3300025972 Bacteria 13731
22 Ga0207678_10047485 3300026067 Bacteria 3712
23 Ga0207698_10078819 3300026142 Bacteria 2647
24 Ga0268266_10017653 3300028379 Bacteria 6084
25 Ga0268264_10000939 3300028381 Bacteria 30234
26 Ga0307517_10002046 3300028786 Bacteria 32818
27 Ga0307515_10072441 3300028794 Bacteria 4649
28 Ga0307515_10169602 3300028794 Bacteria 2182
29 Ga0307511_10001274 3300030521 Bacteria 26705
30 Ga0307512_10010984 3300030522 Bacteria 8604
31 Ga0307513_10001838 3300031456 Bacteria 30130
32 Ga0307513_10011811 3300031456 Bacteria 10824
33 Ga0307513_10125337 3300031456 Bacteria 2525
34 Ga0307408_100195989 3300031548 Bacteria 1631
35 Ga0307508_10010343 3300031616 Bacteria 8537
36 Ga0307508_10012516 3300031616 Bacteria 7757
37 Ga0307508_10013883 3300031616 Bacteria 7351
38 Ga0307514_10001837 3300031649 Bacteria 23539
39 Ga0307405_10036040 3300031731 Bacteria 2961
40 Ga0307518_10011228 3300031838 Bacteria 6403
41 Ga0307410_10004782 3300031852 Bacteria 7066
42 Ga0307410_10048158 3300031852 Bacteria 2853
43 Ga0307406_10005140 3300031901 Bacteria 7136
44 Ga0307407_10026822 3300031903 Bacteria 3056
45 Ga0307412_10072842 3300031911 Bacteria 2349
46 Ga0307409_100003664 3300031995 Bacteria 8408
47 Ga0307416_100028039 3300032002 Bacteria 4181
48 Ga0307414_10007100 3300032004 Bacteria 6284
49 Ga0307411_10057223 3300032005 Bacteria 2574
50 Ga0307415_100001425 3300032126 Bacteria 11428
51 Ga0373925_0082128 3300037068 Bacteria 2452
52 Ga0436364_0087408 3300037853 Bacteria 2511
53 Ga0436363_0059349 3300039450 Bacteria 2363
54 Ga0439436_0014196 3300041404 Bacteria 2406
55 Ga0451791_1451545 3300041451 Bacteria 6089
56 Ga0451793_0018824 3300041452 Bacteria 3471
57 Ga0451837_0479361 3300041494 Bacteria 4861
58 Ga0451837_0604323 3300041494 Bacteria 3100
59 Ga0451853_0062929 3300041512 Bacteria 5375
60 Ga0439449_0040254 3300042007 Bacteria 1737
61 Ga0439457_001118 3300042014 Bacteria 8081
62 Ga0450894_000021 3300042131 Bacteria 21934
63 Ga0450896_000969 3300042133 Bacteria 3336
64 Ga0450899_001197 3300042135 Bacteria 2945
65 Ga0466969_0001610 3300044656 Bacteria 12091
66 Ga0466972_0004796 3300044658 Bacteria 6778
67 Ga0466966_0002202 3300044684 Bacteria 12663
68 Ga0466961_0008625 3300044693 Bacteria 6497
69 Ga0466961_0092643 3300044693 Bacteria 1907
70 Ga0466970_0024778 3300044765 Bacteria 3138
71 Ga0466970_0096405 3300044765 Bacteria 1608
72 Ga0466957_0065302 3300044842 Bacteria 2241
73 Ga0466960_0001368 3300044901 Bacteria 8867
74 Ga0466967_0024364 3300045976 Bacteria 4974
75 Ga0466967_0097068 3300045976 Bacteria 2689
76 Ga0495617_005879 3300046452 Bacteria 4327
77 Ga0495592_0024088 3300046454 Bacteria 4628
78 Ga0495603_0009117 3300046455 Bacteria 5997
79 Ga0495603_0015160 3300046455 Bacteria 4662
80 Ga0495603_0022428 3300046455 Bacteria 3822
81 Ga0495629_0018267 3300046459 Bacteria 5022
82 Ga0495629_0033507 3300046459 Bacteria 3633
83 Ga0495651_0011287 3300046462 Bacteria 6867
84 Ga0495653_0004776 3300046463 Bacteria 10980
85 Ga0495580_0002130 3300046472 Bacteria 17360
86 Ga0495605_0001778 3300046474 Bacteria 13820
87 Ga0495639_0008200 3300046475 Bacteria 4488
88 Ga0495662_0000606 3300046476 Bacteria 16577
89 Ga0495662_0019853 3300046476 Bacteria 3250
90 Ga0495664_0003084 3300046477 Bacteria 9028
91 Ga0495594_0024715 3300046499 Bacteria 3229
92 Ga0495607_0057523 3300046501 Bacteria 2228
93 Ga0495583_0027183 3300046506 Bacteria 2826
94 Ga0495606_0019484 3300046507 Bacteria 5045
95 Ga0495608_0024249 3300046511 Bacteria 4150
96 Ga0495616_0008884 3300046513 Bacteria 5909
97 Ga0495631_0005503 3300046518 Bacteria 6620
98 Ga0495643_0001509 3300046522 Bacteria 21031
99 Ga0495643_0001900 3300046522 Bacteria 17646
100 Ga0495666_0012761 3300046526 Bacteria 4188
101 Ga0495640_0013822 3300046533 Bacteria 6131
102 Ga0495640_0054144 3300046533 Bacteria 2750
103 Ga0495586_0018259 3300046535 Bacteria 3734
104 Ga0495587_0048290 3300046536 Bacteria 2520
105 Ga0495609_0010236 3300046538 Bacteria 4506
106 Ga0495667_0003449 3300046559 Bacteria 10597
107 Ga0495634_0014384 3300046642 Bacteria 5707
108 Ga0495634_0028054 3300046642 Bacteria 3911
109 Ga0495588_0092234 3300046674 Bacteria 1587
110 Ga0495657_0001305 3300046675 Bacteria 21708
111 Ga0495646_0000518 3300046680 Bacteria 20635
112 Ga0495613_0005759 3300046689 Bacteria 9277
113 Ga0495613_0052257 3300046689 Bacteria 3010
114 Ga0495670_0013882 3300046691 Bacteria 3962
115 Ga0495671_0058508 3300046692 Bacteria 1907
116 Ga0495649_0052337 3300046694 Bacteria 2212
117 Ga0495589_0005075 3300046794 Bacteria 6965
118 Ga0495589_0026141 3300046794 Bacteria 2959
119 Ga0495600_0035761 3300046809 Bacteria 3228
120 Ga0495600_0058388 3300046809 Bacteria 2520
121 Ga0495660_0049597 3300046810 Bacteria 2290
122 Ga0495604_0001697 3300047317 Bacteria 18117
123 Ga0495676_0010774 3300047321 Bacteria 8275
124 Ga0495676_0078870 3300047321 Bacteria 2505
125 Ga0495687_007181 3300047443 Bacteria 6634
126 Ga0495675_0003213 3300047444 Bacteria 9825
127 Ga0495675_0005764 3300047444 Bacteria 7573
128 Ga0495677_0029498 3300047445 Bacteria 1995
129 Ga0495685_000284 3300047447 Bacteria 16923
130 Ga0495681_0000813 3300047470 Bacteria 23988
131 Ga0495681_0043611 3300047470 Bacteria 2161
132 Ga0495686_0025670 3300047472 Bacteria 3862
133 Ga0495686_0028932 3300047472 Bacteria 3607
134 Ga0495593_0016606 3300047673 Bacteria 4150
135 Ga0495602_0030677 3300048088 Bacteria 5095
136 Ga0501032_0001059 3300049569 Bacteria 21988
137 Ga0501034_0006210 3300049571 Bacteria 12863
138 Ga0501036_0026917 3300049572 Bacteria 4859
139 Ga0501037_0000982 3300049573 Bacteria 21204
140 Ga0501039_0004784 3300049575 Bacteria 10252
141 Ga0501043_0012171 3300049579 Bacteria 6724
142 Ga0501070_0003104 3300049586 Bacteria 14471
143 Ga0501071_0016512 3300049587 Bacteria 5078
144 Ga0501073_0064587 3300049589 Bacteria 2553
145 Ga0501076_0214849 3300049592 Bacteria 1572
146 nmdc:mga0sz30_6417_c1 3300050516 Bacteria 4364
147 Ga0495601_0043598 3300053077 Bacteria 2817
148 Ga0495655_0001538 3300053083 Bacteria 3548
149 Ga0495619_0197340 3300053085 Bacteria 1393
150 Ga0500578_0005517 3300053086 Bacteria 8569
151 Ga0500654_025769 3300053099 Bacteria 3657
152 Ga0500569_001860 3300053109 Bacteria 4063
153 Ga0500628_003924 3300053129 Bacteria 2454
154 Ga0500652_001464 3300053131 Bacteria 7296
155 Ga0500652_001656 3300053131 Bacteria 6774
156 Ga0500658_0007372 3300053134 Bacteria 4062
157 Ga0500561_0002091 3300053137 Bacteria 3325
158 Ga0500600_0036100 3300053149 Bacteria 2874
159 Ga0500616_0009463 3300053153 Bacteria 5927
160 Ga0500633_0004298 3300053160 Bacteria 3249
161 Ga0500634_0035642 3300053161 Bacteria 2709
162 Ga0500587_000862 3300053739 Bacteria 4011
163 2990059682 2990059506 Bacteria 9321252
164 2558906002 2558860112 Bacteria 9931328
165 2559431392 2558860280 Bacteria 11429938
166 2583150165 2582580736 Bacteria 5325865
167 2586062473 2585427649 Bacteria 9053857
168 2643904263 2643221578 Bacteria 9213798
169 2644402617 2643221673 Bacteria 9196637
170 2644443590 2643221678 Bacteria 9540101
171 2644488662 2643221687 Bacteria 6500351
172 2753035158 2751185725 Bacteria 5740550
173 2776371370 2775506925 Bacteria 7237746
174 2785345841 2784746763 Bacteria 9783172
175 2793977285 2791355406 Bacteria 11364898
176 2809588350 2808606522 Bacteria 9488490
177 2811842965 2808606982 Bacteria 7791042
178 2812360414 2811994879 Bacteria 9313447
179 2852637614 2852635781 Bacteria 8251373
180 2862180906 2862178590 Bacteria 8583590
181 2862383659 2862382967 Bacteria 10317375
182 2862580383 2862574272 Bacteria 10567477
183 2862583820 2862574272 Bacteria 10567477
184 2863072139 2863067949 Bacteria 8541735
185 2863407073 2863404153 Bacteria 9672205
186 2866557271 2866552031 Bacteria 5824618
187 2866618377 2866612099 Bacteria 7543886
188 2867477796 2867475112 Bacteria 6909112
189 2870790002 2870782633 Bacteria 9624083
190 2875397326 2875391855 Bacteria 7600475
191 2899366705 2899359706 Bacteria 10940472
192 2912764776 2912757875 Bacteria 7940295
193 2915361552 2915358134 Bacteria 6050864
194 2915774741 2915768154 Bacteria 8424322
195 2917741476 2917736166 Bacteria 9690793
196 2919472293 2919468124 Bacteria 9133025
197 2946047240 2946045630 Bacteria 8527308
198 2946065474 2946064051 Bacteria 8957905
199 2954011178 2954002825 Bacteria 9173742
200 2997455102 2997451912 Bacteria 8492419
201 2997603644 2997600082 Bacteria 9896405
202 2997605971 2997600082 Bacteria 9896405
203 3006393787 3006393351 Bacteria 6615579
204 8008561208 8008558824 Bacteria 10610750
205 8025538387 8025530807 Bacteria 8495698
206 8047895092 8047893842 Bacteria 11723082
207 8048363958 8048356638 Bacteria 11044339
208 8048372118 8048369669 Bacteria 11666822
209 8048381052 8048379754 Bacteria 11877923
210 8048408064 8048406513 Bacteria 8936924
211 8054166269 8054160619 Bacteria 7783213
212 8054472627 8054472261 Bacteria 7464355
213 8056210716 8056207758 Bacteria 8639239
214 LJQas_1003035
215 rootH2_10165302
216 Ga0055540_1002313
217 Ga0070671_100001577
218 Ga0068853_100047440
219 Ga0070665_100001649
220 Ga0068852_100145076
221 Ga0068863_100059094
222 Ga0081455_10047876
223 Ga0081538_10000107
224 Ga0081538_10005783
225 Ga0081538_10011782
226 Ga0081539_10030047
227 Ga0075363_100015565
228 Ga0163162_10016540
229 Ga0207426_1001209
230 Ga0207426_1001671
231 Ga0207426_1009137
232 Ga0209051_1001713
233 Ga0207644_10014643
234 Ga0207668_10001483
235 Ga0207678_10047485
236 Ga0207698_10078819
237 Ga0268266_10017653
238 Ga0268264_10000939
239 Ga0307517_10002046
240 Ga0307515_10072441
241 Ga0307515_10169602
242 Ga0307511_10001274
243 Ga0307512_10010984
244 Ga0307513_10001838
245 Ga0307513_10011811
246 Ga0307513_10125337
247 Ga0307408_100195989
248 Ga0307508_10010343
249 Ga0307508_10012516
250 Ga0307508_10013883
251 Ga0307514_10001837
252 Ga0307405_10036040
253 Ga0307518_10011228
254 Ga0307410_10004782
255 Ga0307410_10048158
256 Ga0307406_10005140
257 Ga0307407_10026822
258 Ga0307412_10072842
259 Ga0307409_100003664
260 Ga0307416_100028039
261 Ga0307414_10007100
262 Ga0307411_10057223
263 Ga0307415_100001425
264 Ga0373925_0082128
265 Ga0436364_0087408
266 Ga0436363_0059349
267 Ga0439436_0014196
268 Ga0451791_1451545
269 Ga0451793_0018824
270 Ga0451837_0479361
271 Ga0451837_0604323
272 Ga0451853_0062929
273 Ga0439449_0040254
274 Ga0439457_001118
275 Ga0450894_000021
276 Ga0450896_000969
277 Ga0450899_001197
278 Ga0466969_0001610
279 Ga0466972_0004796
280 Ga0466966_0002202
281 Ga0466961_0008625
282 Ga0466961_0092643
283 Ga0466970_0024778
284 Ga0466970_0096405
285 Ga0466957_0065302
286 Ga0466960_0001368
287 Ga0466967_0024364
288 Ga0466967_0097068
289 Ga0495617_005879
290 Ga0495592_0024088
291 Ga0495603_0009117
292 Ga0495603_0015160
293 Ga0495603_0022428
294 Ga0495629_0018267
295 Ga0495629_0033507
296 Ga0495651_0011287
297 Ga0495653_0004776
298 Ga0495580_0002130
299 Ga0495605_0001778
300 Ga0495639_0008200
301 Ga0495662_0000606
302 Ga0495662_0019853
303 Ga0495664_0003084
304 Ga0495594_0024715
305 Ga0495607_0057523
306 Ga0495583_0027183
307 Ga0495606_0019484
308 Ga0495608_0024249
309 Ga0495616_0008884
310 Ga0495631_0005503
311 Ga0495643_0001509
312 Ga0495643_0001900
313 Ga0495666_0012761
314 Ga0495640_0013822
315 Ga0495640_0054144
316 Ga0495586_0018259
317 Ga0495587_0048290
318 Ga0495609_0010236
319 Ga0495667_0003449
320 Ga0495634_0014384
321 Ga0495634_0028054
322 Ga0495588_0092234
323 Ga0495657_0001305
324 Ga0495646_0000518
325 Ga0495613_0005759
326 Ga0495613_0052257
327 Ga0495670_0013882
328 Ga0495671_0058508
329 Ga0495649_0052337
330 Ga0495589_0005075
331 Ga0495589_0026141
332 Ga0495600_0035761
333 Ga0495600_0058388
334 Ga0495660_0049597
335 Ga0495604_0001697
336 Ga0495676_0010774
337 Ga0495676_0078870
338 Ga0495687_007181
339 Ga0495675_0003213
340 Ga0495675_0005764
341 Ga0495677_0029498
342 Ga0495685_000284
343 Ga0495681_0000813
344 Ga0495681_0043611
345 Ga0495686_0025670
346 Ga0495686_0028932
347 Ga0495593_0016606
348 Ga0495602_0030677
349 Ga0501032_0001059
350 Ga0501034_0006210
351 Ga0501036_0026917
352 Ga0501037_0000982
353 Ga0501039_0004784
354 Ga0501043_0012171
355 Ga0501070_0003104
356 Ga0501071_0016512
357 Ga0501073_0064587
358 Ga0501076_0214849
359 nmdc:mga0sz30_6417_c1
360 Ga0495601_0043598
361 Ga0495655_0001538
362 Ga0495619_0197340
363 Ga0500578_0005517
364 Ga0500654_025769
365 Ga0500569_001860
366 Ga0500628_003924
367 Ga0500652_001464
368 Ga0500652_001656
369 Ga0500658_0007372
370 Ga0500561_0002091
371 Ga0500600_0036100
372 Ga0500616_0009463
373 Ga0500633_0004298
374 Ga0500634_0035642
375 Ga0500587_000862
376 2990059682
377 2558906002
378 2559431392
379 2583150165
380 2586062473
381 2643904263
382 2644402617
383 2644443590
384 2644488662
385 2753035158
386 2776371370
387 2785345841
388 2793977285
389 2809588350
390 2811842965
391 2812360414
392 2852637614
393 2862180906
394 2862383659
395 2862580383
396 2862583820
397 2863072139
398 2863407073
399 2866557271
400 2866618377
401 2867477796
402 2870790002
403 2875397326
404 2899366705
405 2912764776
406 2915361552
407 2915774741
408 2917741476
409 2919472293
410 2946047240
411 2946065474
412 2954011178
413 2997455102
414 2997603644
415 2997605971
416 3006393787
417 8008561208
418 8025538387
419 8047895092
420 8048363958
421 8048372118
422 8048381052
423 8048408064
424 8054166269
425 8054472627
426 8056210716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00324

AA_permease

Amino acid permease

55

520

0.79

PF13520

AA_permease_2

Amino acid permease

49

500

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dsk-assembly1.cif.gz_B overall structure of the lat1-4f2hc bound with jx-075 0.7977 34 472
3ncy-assembly1.cif.gz_A x-ray crystal structure of an arginine agmatine antiporter (adic) in complex with a fab fragment 0.7686 30 477
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.7627 25 477
3l1l-assembly1.cif.gz_A-2 structure of arg-bound escherichia coli adic 0.7601 36 482
3gia-assembly1.cif.gz_A crystal structure of apct transporter 0.7578 38 475
ID Description Score Start End Superfamily
af_A0A1D8PCS6_27_501_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8617 30 478 1.20.1740.10
af_O60113_56_528_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8617 26 481 1.20.1740.10
af_A0A1D8PH79_86_559_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8358 26 478 1.20.1740.10
af_Q5ACZ5_74_544_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8342 28 483 1.20.1740.10
af_O60113_56_528_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8308 26 481 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A4R7QS94-F1-model_v4 deleted 0.9426 26 493
AF-A0A1V0U032-F1-model_v4 Amino acid permease 0.9296 14 500 GO:0016020
GO:0022857
AF-A0A1U7GBT6-F1-model_v4 Amino acid permease 0.9237 13 500 GO:0016020
GO:0022857
AF-A0A6J5YYJ6-F1-model_v4 Unannotated protein 0.9211 1 486 GO:0016020
GO:0022857
AF-A0A1Q8Y7Q1-F1-model_v4 deleted 0.9158 1 481

Map